D-amino acid oxidase

Overview
NameD-amino acid oxidase
Smed IDSMED30033916
Length (bp)1124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of D-amino acid oxidase (SMED30033916) t-SNE clustered cells

Violin plots show distribution of expression levels for D-amino acid oxidase (SMED30033916) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of D-amino acid oxidase (SMED30033916) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for D-amino acid oxidase (SMED30033916) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033916

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033916SMESG000066563.1 Contig2251GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033916SMESG000066563.1 dd_Smed_v4_3560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033916SMESG000066563.1 dd_Smed_v4_3560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30033916SMESG000066563.1 SMED30033916smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033916SMESG000066563.1 SMED30033916smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of D-amino acid oxidase vs. Ensembl Human
Match: DDO (D-aspartate oxidase [Source:HGNC Symbol;Acc:HGNC:2727])

HSP 1 Score: 213.001 bits (541), Expect = 3.329e-65
Identity = 124/332 (37.35%), Postives = 188/332 (56.63%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL--SNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLEN-CNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IAV+GAG+ GLS AV + +  P   VTI ++  TP+TT DVAAG+  P+   +   H  K+W R T+  L   IAN+ +    G+  +  +++  S    ++  + D+V     M EAELK++P + +G A TT+  E    L +   R K  GG    +++ +  E+    +F IV+NC+GLGSR+L  D  I+PVRGQV+++ APW++H I D S   YI P +   V LGGT Q  +WN  PD  +++ IL+ C  L   L   CNI    VGLRP R  VRL+ E    +  G +  ++H+YGHG  G ++ WG +    +LV++ +
Sbjct:   33 RIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFA-IANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHP--SFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSH-VTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIRE-KVGLRPYRPGVRLQTELLARD--GQRLPVVHHYGHGSGGISVHWGTALEAARLVSECV 357          
BLAST of D-amino acid oxidase vs. Ensembl Human
Match: DAO (D-amino acid oxidase [Source:HGNC Symbol;Acc:HGNC:2671])

HSP 1 Score: 195.667 bits (496), Expect = 7.981e-59
Identity = 116/340 (34.12%), Postives = 179/340 (52.65%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYT-LIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++ VIGAG+ GLS A+ + E +  V     + ++ +  TP TT DVAAGLW+PY    ++ Q   W + T+ +L   + ++P     GL  I  + L +E +    + D V     +   EL  +P + YG   T+++ EG+  L +  +R  + G     ++V +F+E+ + G  +IV NCTG+ +  L  D  + P RGQ++++ APW+KH I+          S YIIP +   V LGG  Q  NW+ L +  D   I  GC +L   L+N  I+    G RP R  +RLE+E      TG   T +IHNYGHGG G T+ WGC+    +L   ++
Sbjct:    1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHV-HSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIV-NCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQ-TVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLR---TGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRIL 334          
BLAST of D-amino acid oxidase vs. Ensembl Human
Match: DDO (D-aspartate oxidase [Source:HGNC Symbol;Acc:HGNC:2727])

HSP 1 Score: 131.339 bits (329), Expect = 8.718e-35
Identity = 72/182 (39.56%), Postives = 106/182 (58.24%), Query Frame = 1
Query:  493 FKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLEN-CNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
             K  GG    +++ +  E+    +F IV+NC+GLGSR+L  D  I+PVRGQV+++ APW++H I D S   YI P +   V LGGT Q  +WN  PD  +++ IL+ C  L   L   CNI    VGLRP R  VRL+ E    +  G +  ++H+YGHG  G ++ WG +    +LV++ +
Sbjct:  123 IKGSGGWTLTRRIEDLWELHP--SFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSH-VTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIRE-KVGLRPYRPGVRLQTELLARD--GQRLPVVHHYGHGSGGISVHWGTALEAARLVSECV 298          
BLAST of D-amino acid oxidase vs. Ensembl Human
Match: DAO (D-amino acid oxidase [Source:HGNC Symbol;Acc:HGNC:2671])

HSP 1 Score: 112.464 bits (280), Expect = 6.136e-28
Identity = 62/162 (38.27%), Postives = 88/162 (54.32%), Query Frame = 1
Query:  571 IVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYT-LIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +++NCTG+ +  L  D  + P RGQ++++ APW+KH I+          S YIIP +   V LGG  Q  NW+ L +  D   I  GC +L   L+N  I+    G RP R  +RLE+E      TG   T +IHNYGHGG G T+ WGC+    +L   ++
Sbjct:  111 VIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQ-TVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLR---TGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRIL 268          

HSP 2 Score: 64.6994 bits (156), Expect = 4.123e-11
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKM-KLYNDIVDSSHFMNEAELKRYPTFRYG 432
            M++ VIGAG+ GLS A+ + E +  V     + ++ +  TP TT DVAAGLW+PY    ++ Q   W + T+ +L   + ++P     GL  I  + L +E + + +   D++ +   +    L+R P  + G
Sbjct:    1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHV-HSPNAENLGLFLISGYNLFHEAIPVAREGADVIVNCTGVWAGALQRDPLLQPG 132          
BLAST of D-amino acid oxidase vs. Ensembl Human
Match: DAO (D-amino acid oxidase [Source:HGNC Symbol;Acc:HGNC:2671])

HSP 1 Score: 101.679 bits (252), Expect = 7.179e-25
Identity = 60/194 (30.93%), Postives = 102/194 (52.58%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCND 618
            M++ VIGAG+ GLS A+ + E +  V     + ++ +  TP TT DVAAGLW+PY    ++ Q   W + T+ +L   + ++P     GL  I  + L +E +    + D V     +   EL  +P + YG   T+++ EG+  L +  +R  + G     ++V +F+E+ + G  +IV NCTG+ +  L  D
Sbjct:    1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHV-HSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIV-NCTGVWAGALQRD 192          
BLAST of D-amino acid oxidase vs. Ensembl Celegans
Match: daao-1 (D-amino-acid oxidase [Source:UniProtKB/Swiss-Prot;Acc:Q95XG9])

HSP 1 Score: 211.46 bits (537), Expect = 1.396e-65
Identity = 114/330 (34.55%), Postives = 188/330 (56.97%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIAN-NPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELK---RYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IAV+GAGING++ A+ + E  P  +VTI  E  +PNTT DVAAGL +P+   +D  ++  W  +T   + ++ A+ NP   +    ++    + +EP  +KL  ++    H + +AE+K   R P  ++G+  TT   E    + +  D+F + GG  K Q++ N D++ +  ++ + +NCTGLGSR L  D ++YP RGQ++++  P +KH  +D+ +Y +  +D  + LGGT +AH W+   +   ++ IL      +  L    ILS +V +RP R  VRL+ E           +L+HNYGHGGSG TL WGC+    ++V +V+
Sbjct:    3 KIAVLGAGINGIASALAIQERLPNCEVTIIAEKFSPNTTSDVAAGLIEPFLCDDDVDRIINWTSATISRIHEYQADGNPGAEEQSGYWLQ--SVKSEPKWLKLMKNV----HILTDAEMKQVARRPEHKFGIFYTTWYLEPTPYIKWCTDKFLKNGGKFKKQKIENIDDVAR--SYDVTVNCTGLGSRALIGDKEVYPTRGQILKVSCPRVKHFFIDDKYYAL-LNDSTITLGGTFEAHQWDLTINSELSQKILKENIHNIPSLRTAQILSSHVDMRPSRGTVRLQAEL--------GRSLVHNYGHGGSGITLHWGCALECAEIVENVL 315          
BLAST of D-amino acid oxidase vs. Ensembl Celegans
Match: ddo-2 (D-aspartate oxidase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19564])

HSP 1 Score: 144.05 bits (362), Expect = 1.192e-39
Identity = 98/338 (28.99%), Postives = 167/338 (49.41%), Query Frame = 1
Query:   40 NFKMQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGL----CYIDVFELSNEPMKMKLYNDIVDSSHFMNEAE-LKRYPT-FRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDI-YPVRGQVIRIHAPWIKHC-IMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            N   +IA+IG G+ G + A+ + ++ P  K+T+  +     +     AGL++      D  +  ++ R+++ + S  +    K  + G+     +I    L +   + + Y DIV +  F+++ E L  +P   ++ +  T   +EG K + Y  +   +     K Q+VT+ D +   G + +++NC GL   KL  DDD  YP+RG ++ + APW KH    D + + IP+   VVV G T Q + W+    + D   IL     L  G+    I+     LRP RK VR+E + RT+      Y ++H+YGHG +GFTL WG +    +LV   +
Sbjct:    3 NIIPKIAIIGEGVIGCTSALQISKAIPNAKITVLHDKPFKKSCSAGPAGLFRI-----DYEENTEYGRASFAWFS-HLYRTTKGSETGVKLVSGHIQSDNLESLKQQQRAYGDIVYNFRFLDDRERLDIFPEPSKHCIHYTAYASEGNKYVPYLKNLLLEQKIEFKQQEVTSLDAVADAG-YDVIVNCAGLYGGKLAGDDDTCYPIRGVILEVDAPWHKHFNYRDFTTFTIPKEHSVVV-GSTKQDNRWDLEITDEDRNDILKRYIALHPGMREPKIIKEWSALRPGRKHVRIEAQKRTSVGNSKDYMVVHHYGHGSNGFTLGWGTAIEATKLVKTAL 332          
BLAST of D-amino acid oxidase vs. Ensembl Celegans
Match: ddo-2 (D-aspartate oxidase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19564])

HSP 1 Score: 144.05 bits (362), Expect = 1.192e-39
Identity = 98/338 (28.99%), Postives = 167/338 (49.41%), Query Frame = 1
Query:   40 NFKMQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGL----CYIDVFELSNEPMKMKLYNDIVDSSHFMNEAE-LKRYPT-FRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDI-YPVRGQVIRIHAPWIKHC-IMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            N   +IA+IG G+ G + A+ + ++ P  K+T+  +     +     AGL++      D  +  ++ R+++ + S  +    K  + G+     +I    L +   + + Y DIV +  F+++ E L  +P   ++ +  T   +EG K + Y  +   +     K Q+VT+ D +   G + +++NC GL   KL  DDD  YP+RG ++ + APW KH    D + + IP+   VVV G T Q + W+    + D   IL     L  G+    I+     LRP RK VR+E + RT+      Y ++H+YGHG +GFTL WG +    +LV   +
Sbjct:    3 NIIPKIAIIGEGVIGCTSALQISKAIPNAKITVLHDKPFKKSCSAGPAGLFRI-----DYEENTEYGRASFAWFS-HLYRTTKGSETGVKLVSGHIQSDNLESLKQQQRAYGDIVYNFRFLDDRERLDIFPEPSKHCIHYTAYASEGNKYVPYLKNLLLEQKIEFKQQEVTSLDAVADAG-YDVIVNCAGLYGGKLAGDDDTCYPIRGVILEVDAPWHKHFNYRDFTTFTIPKEHSVVV-GSTKQDNRWDLEITDEDRNDILKRYIALHPGMREPKIIKEWSALRPGRKHVRIEAQKRTSVGNSKDYMVVHHYGHGSNGFTLGWGTAIEATKLVKTAL 332          
BLAST of D-amino acid oxidase vs. Ensembl Celegans
Match: ddo-1 (D-aspartate oxidase 1 [Source:UniProtKB/Swiss-Prot;Acc:O45307])

HSP 1 Score: 141.354 bits (355), Expect = 1.153e-38
Identity = 101/334 (30.24%), Postives = 171/334 (51.20%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKM----KLYNDIVDSSHFMNEAE-LKRYPT-FRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDD-IYPVRGQVIRIHAPWIKHC-IMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IA+IG G+ G S A+ + ++ P+ +VT+ ++     T     AGL++      DD   +++ +ST+ + +  +    K  K G+  +     S+   ++    K Y DIV +  F+ + E L  +P    + +  T   +EG K + Y   + +  G     ++V + +E+   G + +++NC GL    L  DDD +YP+RG V+ + A W KH    D   + IP+ + VV+ G   Q + W+    + D K IL     L   +    IL    GLRP RK +R+EK  + +E +G KYT++H+YGHGG+GFTL WG +    +LV   +
Sbjct:    4 KIAIIGEGVIGCSTALQVAQAVPDARVTVLSDRPFEQTCSFGPAGLFRI-----DDIANREFGKSTFDWFAH-LHRTEKGDKTGVKLLSGHIQSDSKERLEQQQKAYGDIVYNFRFLEKREILDLFPNPSEHCIHYTAFASEGNKYVPYLKFQCQARGVEFLHRKVRDLEELANEG-YDVIVNCAGLSGGTLAGDDDSVYPIRGVVLDVEAHWHKHFNYKDFITFTIPKENSVVI-GSVKQENRWDLEITDVDRKDILERYVALHPAMREPKILGEWSGLRPARKTIRIEKVEKKSEKSGKKYTVVHHYGHGGNGFTLGWGTAVEATKLVKSAL 329          
BLAST of D-amino acid oxidase vs. Ensembl Celegans
Match: ddo-3 (D-aspartate oxidase 3 [Source:UniProtKB/Swiss-Prot;Acc:O01739])

HSP 1 Score: 103.99 bits (258), Expect = 1.088e-24
Identity = 101/354 (28.53%), Postives = 163/354 (46.05%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLE-----SFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFE---LSNEPMKMKL-----------YNDIVDSSHFMNEA--ELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDD--DIYPVRGQVIRIHAPWIKHCIM-DESHYIIPQSDGVVVLGGTTQ---AHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGN-KYTLIHNYGHGGSGFTLFWGCSENVVQLVTDV 1026
            +++AV+G G+ GLS A  +L+     + P  ++ IF             AGL++  + SE D   +K+   T+  L+            GL  + +     LS+   K+             Y D+ +   F   +  +L R  T R G+  T   +EG +   +        G     +++ N +E+     F +V+N  GL    L  DD  ++ P+RG +IR+ APW KH +  D S   IP  D V +  GT +   A   N +    D + I +    L    +  ++LS  VG RP RK VR+EK+ R  E  G+ K+T++HNYGH G+GFTL +G + +   +V D+
Sbjct:   18 LRVAVVGEGVIGLSTATAILDLAEKRNIPAPEIHIFHHKPFEKILSRHIAGLFRIDSGSEID---RKYGYDTFEKLATLWREYG-----GLSGVQLVSGHILSDSKTKLDSQRESYGSLVYNYRDLAEPELFGPTSLFDLPRNTTTR-GIHYTAYTSEGLRFCPFLKKELMTKGVRFTQRRIGNLEELG--AEFDVVVNSAGLLGGVLAGDDAGNMKPIRGVLIRVDAPWQKHFLYRDFSTITIPVIDHVYM--GTVKQEGAFGPNNV-TSADIQDITSRYVALQPSFKRVHMLSSFVGYRPGRKQVRVEKQIR--ETNGSKKFTVVHNYGHSGNGFTLGYGSAVHAAHIVLDL 355          
BLAST of D-amino acid oxidase vs. Ensembl Fly
Match: CG11236 (gene:FBgn0031860 transcript:FBtr0079339)

HSP 1 Score: 232.261 bits (591), Expect = 2.617e-73
Identity = 133/337 (39.47%), Postives = 200/337 (59.35%), Query Frame = 1
Query:   55 IAVIGAGINGLSVAVNLLESF-----PEVKVTIFTEATTPNTTGDVAAGLWKPYAIS-EDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKM--KLYNDIVDSSHFMNEAELKRY-----PTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES---HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            IAVIGAG+NG++ A+ +LE +       +KVTI +E  TPNTTGD +AGLW PY +      ++ KW +S + FL K I  +    + G+C +    LS   +      + DIV  +  +++ +L  Y       F  G++  T  +E  K+L Y   RF + GG++  +++T+ D       + +++NC+GLGS+ L NDD +Y VRGQV R+ A WI   ++DES   +YIIP ++  VVLGGT Q  ++NT   +ND + I++GCQ+ + GLE+   L   VGLRP R  +RLE E R  ++      LIHNYGHGGSG TL WGC+++V+ ++
Sbjct:    4 IAVIGAGVNGVASAIKILEHYVNDGKTPIKVTIISEDFTPNTTGDGSAGLWGPYLLGGTSQAKVYKWSKSMHQFLEK-IWLSEDAGEAGVCLLPCIRLSTSTVDTVEDFWRDIVYGAVDLSKEQLAAYNKGRSVKFTSGLSFVTYTSEPIKLLPYLMKRFTRNGGVVVRKRITDLDAFVADSEYDVIVNCSGLGSKTLLNDDQMYAVRGQVSRVRANWIFSAVLDESDDGNYIIPNTES-VVLGGTHQERDYNTKVCQNDRRMIVDGCQRYIPGLEHTECLFDWVGLRPGRTQLRLEAERRGRKL------LIHNYGHGGSGVTLCWGCADDVLNIL 332          
BLAST of D-amino acid oxidase vs. Ensembl Fly
Match: CG11236 (gene:FBgn0031860 transcript:FBtr0309812)

HSP 1 Score: 230.335 bits (586), Expect = 1.105e-72
Identity = 133/337 (39.47%), Postives = 198/337 (58.75%), Query Frame = 1
Query:   55 IAVIGAGINGLSVAVNLLESF-----PEVKVTIFTEATTPNTTGDVAAGLWKPYAIS-EDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKM--KLYNDIVDSSHFMNEAELKRY-----PTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES---HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            IAVIGAG+NG++ A+ +LE +       +KVTI +E  TPNTTGD +AGLW PY +      ++ KW +S + FL K I  +    + G+C +    LS   +      + DIV  +  +++ +L  Y       F  G++  T  +E  K+L Y   RF + GG++  +++T+ D       + +++NC+GLGS+ L NDD +Y VRGQV R+ A WI   ++DES   +YIIP     VVLGGT Q  ++NT   +ND + I++GCQ+ + GLE+   L   VGLRP R  +RLE E R  ++      LIHNYGHGGSG TL WGC+++V+ ++
Sbjct:    4 IAVIGAGVNGVASAIKILEHYVNDGKTPIKVTIISEDFTPNTTGDGSAGLWGPYLLGGTSQAKVYKWSKSMHQFLEK-IWLSEDAGEAGVCLLPCIRLSTSTVDTVEDFWRDIVYGAVDLSKEQLAAYNKGRSVKFTSGLSFVTYTSEPIKLLPYLMKRFTRNGGVVVRKRITDLDAFVADSEYDVIVNCSGLGSKTLLNDDQMYAVRGQVSRVRANWIFSAVLDESDDGNYIIPN----VVLGGTHQERDYNTKVCQNDRRMIVDGCQRYIPGLEHTECLFDWVGLRPGRTQLRLEAERRGRKL------LIHNYGHGGSGVTLCWGCADDVLNIL 329          
BLAST of D-amino acid oxidase vs. Ensembl Fly
Match: CG12338 (gene:FBgn0033543 transcript:FBtr0088256)

HSP 1 Score: 161.77 bits (408), Expect = 2.486e-46
Identity = 101/334 (30.24%), Postives = 170/334 (50.90%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYA--ISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVF---ELSNEPMKMKLYNDIVDSSHFMNEAELKRY-PTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM-DESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M   V+G+GI GL+ A+ L + FP  +V++  +    +T   VAAG+++P    +       ++W    + +  + +  + +    G+C +  +     S   ++      ++       E EL+     ++YG   TT L E +  L Y   +F + GG +  Q V +F E+ +  N  +++NCTG+G+++LC D  + P+RGQV+++ APW+K     D   Y++P  +  V LGG  Q  ++NT   + D+  I   C  L+  L    I+   VGLRP R  VR+E E  TN   G +  ++HNYGHGG G T   G +   V+LV D++
Sbjct:    1 MHFGVLGSGIIGLTTALELQKEFPTARVSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKITQQWMTDAFNYWDE-LRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEELRLCNGGWKYGSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVPQ--NIDLLLNCTGMGAKELCGDQHLVPIRGQVLKVRAPWVKTAFYGDYDTYVLPGFE-TVTLGGCRQFDSYNTEWCKYDSMAIRERCYDLLPSLRKAEIVRECVGLRPHRSVVRVEPELITNP-EGRRLKVVHNYGHGGYGVTTAPGTAMYAVRLVRDLL 329          
BLAST of D-amino acid oxidase vs. Ensembl Fly
Match: CG12338 (gene:FBgn0033543 transcript:FBtr0345662)

HSP 1 Score: 161.77 bits (408), Expect = 2.486e-46
Identity = 101/334 (30.24%), Postives = 170/334 (50.90%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYA--ISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVF---ELSNEPMKMKLYNDIVDSSHFMNEAELKRY-PTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM-DESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M   V+G+GI GL+ A+ L + FP  +V++  +    +T   VAAG+++P    +       ++W    + +  + +  + +    G+C +  +     S   ++      ++       E EL+     ++YG   TT L E +  L Y   +F + GG +  Q V +F E+ +  N  +++NCTG+G+++LC D  + P+RGQV+++ APW+K     D   Y++P  +  V LGG  Q  ++NT   + D+  I   C  L+  L    I+   VGLRP R  VR+E E  TN   G +  ++HNYGHGG G T   G +   V+LV D++
Sbjct:    1 MHFGVLGSGIIGLTTALELQKEFPTARVSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKITQQWMTDAFNYWDE-LRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEELRLCNGGWKYGSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVPQ--NIDLLLNCTGMGAKELCGDQHLVPIRGQVLKVRAPWVKTAFYGDYDTYVLPGFE-TVTLGGCRQFDSYNTEWCKYDSMAIRERCYDLLPSLRKAEIVRECVGLRPHRSVVRVEPELITNP-EGRRLKVVHNYGHGGYGVTTAPGTAMYAVRLVRDLL 329          
BLAST of D-amino acid oxidase vs. Ensembl Zebrafish
Match: dao.2 (D-amino-acid oxidase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2634])

HSP 1 Score: 197.208 bits (500), Expect = 1.561e-59
Identity = 113/334 (33.83%), Postives = 181/334 (54.19%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESF----PEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMD--------ESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQL 1014
            M++ +IGAG+ GLS A ++ + F      + + ++ +  TP TT D AAGLW+PY   + + +  +W + T+ +L  FI N+P   K G+     + L  EPM    +   V     +++ EL+ +P + +G  +T ++ EG+  L +  +  KQ G     + + +F E+   G  +I INC+G+ S  L  D ++ P RGQ+I++ APW+KH ++         +S YIIP S  +V +GG  Q  NWN +    D K I     KL   L++  I+    GLRP R  VRLE+E+  +   G+ + +IHNYGHGG G T+  GC+E   +L
Sbjct:    1 MKVCIIGAGVIGLSTAQSIYQHFHSRVSPLTIEVYADIFTPLTTSDGAAGLWQPYLYDKGNVKETQWNKETFNYLLSFI-NSPDSVKMGIFLQSGYNLCAEPMPEPSFKQAVLGFRQLSKRELEMFPGYSFGWFNTALMIEGKTYLPWLMNWLKQRGVAFFQRTIDSFKELSDSGADMI-INCSGVRSGDLQPDPELQPARGQIIKVDAPWLKHWVITHDSTSGVYDSPYIIPGSR-LVTVGGVFQVGNWNRMNSSVDHKGIWEAACKLEPSLQHARIVEDWTGLRPARSKVRLEREAIRS--GGHSFEVIHNYGHGGFGLTIHRGCAEEAARL 329          
BLAST of D-amino acid oxidase vs. Ensembl Zebrafish
Match: dao.1 (D-amino-acid oxidase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050913-127])

HSP 1 Score: 195.282 bits (495), Expect = 8.612e-59
Identity = 112/339 (33.04%), Postives = 180/339 (53.10%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESF----PEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++ +IGAG+ GLS A ++ + F      + + ++ +  TP TT D AAG W+PY   + + +  +W + T+ +L  F+ N+P   K G+     + L  EPM    +   V     +++ EL+ +P F +G  +T ++ EG+  L +  D   Q G     +++ +F E+   G  +I INC+G+ S  L  D ++ P RGQ+I++ APW+KH ++          + YIIP S  +V +GG  Q  NWN +    + K I  G  KL   L++  I+    GLRP R  VRLE+ES      G+ + +IHNYGHGG G T+  GC+E   +L    +
Sbjct:    1 MRVCIIGAGVIGLSTAQSIYQHFHSRVSPLTIEVYADIFTPLTTSDGAAGFWQPYLYDKGNVKETQWNKETFNYLLSFL-NSPDSIKMGIFLESGYNLCFEPMPEPSFKQAVLGFRQLSKRELEMFPGFSFGWFNTALVIEGKSYLPWLMDWLNQRGVKFFQRKIDSFKELSDSGADMI-INCSGVRSGDLQPDPELQPARGQIIKVDAPWLKHWVITHDSKLGTYNTPYIIPGSR-LVTVGGVFQVGNWNRMNSSVEHKQIWEGACKLEPSLQHARIVEDWTGLRPARSKVRLERES--IRCGGHSFEVIHNYGHGGFGLTIHRGCAEEAARLFGQFL 334          
BLAST of D-amino acid oxidase vs. Ensembl Zebrafish
Match: dao.1 (D-amino-acid oxidase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050913-127])

HSP 1 Score: 195.282 bits (495), Expect = 8.612e-59
Identity = 112/339 (33.04%), Postives = 180/339 (53.10%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESF----PEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++ +IGAG+ GLS A ++ + F      + + ++ +  TP TT D AAG W+PY   + + +  +W + T+ +L  F+ N+P   K G+     + L  EPM    +   V     +++ EL+ +P F +G  +T ++ EG+  L +  D   Q G     +++ +F E+   G  +I INC+G+ S  L  D ++ P RGQ+I++ APW+KH ++          + YIIP S  +V +GG  Q  NWN +    + K I  G  KL   L++  I+    GLRP R  VRLE+ES      G+ + +IHNYGHGG G T+  GC+E   +L    +
Sbjct:    1 MRVCIIGAGVIGLSTAQSIYQHFHSRVSPLTIEVYADIFTPLTTSDGAAGFWQPYLYDKGNVKETQWNKETFNYLLSFL-NSPDSIKMGIFLESGYNLCFEPMPEPSFKQAVLGFRQLSKRELEMFPGFSFGWFNTALVIEGKSYLPWLMDWLNQRGVKFFQRKIDSFKELSDSGADMI-INCSGVRSGDLQPDPELQPARGQIIKVDAPWLKHWVITHDSKLGTYNTPYIIPGSR-LVTVGGVFQVGNWNRMNSSVEHKQIWEGACKLEPSLQHARIVEDWTGLRPARSKVRLERES--IRCGGHSFEVIHNYGHGGFGLTIHRGCAEEAARLFGQFL 334          
BLAST of D-amino acid oxidase vs. Ensembl Zebrafish
Match: dao.3 (D-amino-acid oxidase, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1894])

HSP 1 Score: 193.741 bits (491), Expect = 3.048e-58
Identity = 115/333 (34.53%), Postives = 176/333 (52.85%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESF----PEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE-------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQL 1014
            M++ +IGAG+ GLS A ++ + F      + + ++ +  TP TT D AAGLW+PY   +   +  +W + T+ +L  FI N+P   K G+     + L  E      + D V     +   EL+ +P + +G  +T+I+ EG+  L +  D  K+       +++ +F E+   G   ++INC+G+ S +L  D ++ P RGQ+I++ APWIKH I          S YIIP S  +V +GG  Q  NWN L    D K I     KL   L++  I+    GLRP R  VRLE+ES      G+ + +IHNYGHGG G T+  GC+E   +L
Sbjct:    1 MKVCIIGAGVIGLSTAQSIYQHFHSRVSPLTIEVYADFFTPLTTSDGAAGLWQPYLYDKGIVKETQWNKETFDYLLSFI-NSPDSIKMGIFLQSGYNLCAETAADPSFKDTVLGFRQLTSRELEMFPGYSFGWFNTSIMIEGKTYLPWLMDWLKERNVKFYQRKIDSFKELSACGA-DVIINCSGVRSGELQPDPELQPARGQIIKVDAPWIKHWISTHNFSSRGNSAYIIPGSR-LVTVGGVFQVGNWNRLNSSVDHKQIWEAACKLEPSLQHARIVEDWTGLRPARSKVRLERES--IRCGGHSFEVIHNYGHGGFGLTIHRGCAEEAARL 328          
BLAST of D-amino acid oxidase vs. Ensembl Zebrafish
Match: zgc:172341 (zgc:172341 [Source:ZFIN;Acc:ZDB-GENE-080204-116])

HSP 1 Score: 189.889 bits (481), Expect = 6.675e-57
Identity = 113/316 (35.76%), Postives = 177/316 (56.01%), Query Frame = 1
Query:   85 LSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKK-WCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMK--LYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM--DESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            LS AV + E+ P   VT+ +E  +P+TT D AAG+  P    +   + ++ W + ++ +L   IA++P+    G+     +++  +  + K   + D+V    +M + ELKR+P  ++G A TT+  E    L +   RF  +GG I  ++VT+  ++    N+  +INC+GLGSR L  D+++YPVRGQ++++HAPW+K+ I   D + YI P    V V GGT QA +W    DE D + IL    +L   L    IL   VGLRP R+ +RLE+E     + G    L+HNYGHG  G TL WG + + + L+
Sbjct:   16 LSTAVCIAETLPYCSVTLISEKFSPHTTSDGAAGILLPKEFPDIPLEWQQQWFKKSFEYLLA-IADSPQASDAGVYLSSGYQIFKDVPRDKKPFWADLVFGFRYMTDHELKRFPDHKFGQAFTTLKCECLSYLPWLEQRFIAVGGRIIHEKVTDLHKLAL--NYDAIINCSGLGSRALLKDEEVYPVRGQILKLHAPWLKNFIRDGDGNTYIYPGIRFVSV-GGTRQADDWRMELDERDREGILERSVRLEPSLRAAAILGEWVGLRPARENLRLERE--YVNVGGRAVPLVHNYGHGSCGVTLSWGTALDALHLL 325          
BLAST of D-amino acid oxidase vs. Ensembl Xenopus
Match: DDO (D-aspartate oxidase [Source:NCBI gene;Acc:100488513])

HSP 1 Score: 232.646 bits (592), Expect = 3.379e-73
Identity = 126/330 (38.18%), Postives = 193/330 (58.48%), Query Frame = 1
Query:   55 IAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMK--MKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM--DESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            IA+IG G+ GLS A+ L ES P+  VTI +E  +PNTTGDVAAG   P+A  +    Q K+W + T+  L K IAN+P+    G+  +  +++     K     ++D+V     M +AEL ++P + +G A TT+  +    L++   RF+  GG++  ++V N  ++   G + +++NC+G+GSR L +D  IYPV+GQV+++HAPW+KH I   D S YI P       LGGT + H+W   PD   +K I   C  L   L+   ++   VGLRP R A+RLEKE       G++  +IHNYGHGG GF++  G ++   +LV +++
Sbjct:    4 IAIIGGGLVGLSTALCLSESLPQCSVTIISETFSPNTTGDVAAGCLIPHAYPDTSLQQQKEWFKETFDHLLK-IANSPEASTAGISLLSGWQIYKTSPKEIYPFWSDLVLGFRTMTDAELAKFPGYSFGQAFTTLKCQSSLYLAWMKKRFQNHGGLVHREKVINVWDLH--GKYDVIVNCSGIGSRNLFDDLSIYPVKGQVLQVHAPWLKHFIRDGDGSTYIYPGISS-TTLGGTREKHDWTLSPDAKTSKEIFERCCSLEPSLQGSRVIEEKVGLRPVRSAIRLEKEIMIK--NGHQLPVIHNYGHGGGGFSVHIGTAKTASRLVKELL 327          
BLAST of D-amino acid oxidase vs. Ensembl Xenopus
Match: terf2ip (TERF2 interacting protein [Source:Xenbase;Acc:XB-GENE-5905850])

HSP 1 Score: 212.616 bits (540), Expect = 2.476e-65
Identity = 117/340 (34.41%), Postives = 187/340 (55.00%), Query Frame = 1
Query:   46 KMQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            KM I +IGAG+ GLS A+ + E++  +    K+ I+ +  +P TT D AAGLW+PY     + Q  KW + T+  + KF+ ++ +    GL     + +  EP     + DIV     +   EL+ +P + YG  +T ++ EG+  L +   R +  G     +++ +F E+  LG   ++INCTG+ + +L  D ++ P RGQ++++HAPW+KH I+          + YIIP SD  V LGG  Q  NW+   +  D K+I + C +L+  L+N  I+    GLRP R  VRLE+E+  +    NK  +IHNYGHGG G T+ WGC+    ++   ++
Sbjct:    9 KMHITIIGAGVIGLSTALCIHENYHRIVRPLKIEIYADKFSPLTTSDGAAGLWQPYLYDNGNTQETKWNKETFDHMLKFV-HSVEAPNMGLFLQSGYNILKEPAPEPSWKDIVLGFRHLTSKELELFPGYSYGWFNTALMIEGKHYLPWMMKRLEDRGVKFVHKRIKSFGELAALGAD-VIINCTGIRAGELQPDPELKPGRGQILKVHAPWMKHFILTHDLKTGVYTTPYIIPGSDS-VTLGGIYQLGNWSEENNSEDYKWIWDKCTELVPSLKNAKIVHTWTGLRPARSKVRLEREAFVS--GSNKSQIIHNYGHGGYGLTIHWGCAMEAAKIFGQIL 343          
BLAST of D-amino acid oxidase vs. Ensembl Xenopus
Match: terf2ip (TERF2 interacting protein [Source:Xenbase;Acc:XB-GENE-5905850])

HSP 1 Score: 212.616 bits (540), Expect = 4.363e-65
Identity = 117/340 (34.41%), Postives = 187/340 (55.00%), Query Frame = 1
Query:   46 KMQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            KM I +IGAG+ GLS A+ + E++  +    K+ I+ +  +P TT D AAGLW+PY     + Q  KW + T+  + KF+ ++ +    GL     + +  EP     + DIV     +   EL+ +P + YG  +T ++ EG+  L +   R +  G     +++ +F E+  LG   ++INCTG+ + +L  D ++ P RGQ++++HAPW+KH I+          + YIIP SD  V LGG  Q  NW+   +  D K+I + C +L+  L+N  I+    GLRP R  VRLE+E+  +    NK  +IHNYGHGG G T+ WGC+    ++   ++
Sbjct:   21 KMHITIIGAGVIGLSTALCIHENYHRIVRPLKIEIYADKFSPLTTSDGAAGLWQPYLYDNGNTQETKWNKETFDHMLKFV-HSVEAPNMGLFLQSGYNILKEPAPEPSWKDIVLGFRHLTSKELELFPGYSYGWFNTALMIEGKHYLPWMMKRLEDRGVKFVHKRIKSFGELAALGAD-VIINCTGIRAGELQPDPELKPGRGQILKVHAPWMKHFILTHDLKTGVYTTPYIIPGSDS-VTLGGIYQLGNWSEENNSEDYKWIWDKCTELVPSLKNAKIVHTWTGLRPARSKVRLEREAFVS--GSNKSQIIHNYGHGGYGLTIHWGCAMEAAKIFGQIL 355          
BLAST of D-amino acid oxidase vs. Ensembl Xenopus
Match: terf2ip (TERF2 interacting protein [Source:Xenbase;Acc:XB-GENE-5905850])

HSP 1 Score: 211.846 bits (538), Expect = 6.407e-65
Identity = 117/340 (34.41%), Postives = 187/340 (55.00%), Query Frame = 1
Query:   46 KMQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            KM I +IGAG+ GLS A+ + E++  +    K+ I+ +  +P TT D AAGLW+PY     + Q  KW + T+  + KF+ ++ +    GL     + +  EP     + DIV     +   EL+ +P + YG  +T ++ EG+  L +   R +  G     +++ +F E+  LG   ++INCTG+ + +L  D ++ P RGQ++++HAPW+KH I+          + YIIP SD  V LGG  Q  NW+   +  D K+I + C +L+  L+N  I+    GLRP R  VRLE+E+  +    NK  +IHNYGHGG G T+ WGC+    ++   ++
Sbjct:   19 KMHITIIGAGVIGLSTALCIHENYHRIVRPLKIEIYADKFSPLTTSDGAAGLWQPYLYDNGNTQETKWNKETFDHMLKFV-HSVEAPNMGLFLQSGYNILKEPAPEPSWKDIVLGFRHLTSKELELFPGYSYGWFNTALMIEGKHYLPWMMKRLEDRGVKFVHKRIKSFGELAALGAD-VIINCTGIRAGELQPDPELKPGRGQILKVHAPWMKHFILTHDLKTGVYTTPYIIPGSDS-VTLGGIYQLGNWSEENNSEDYKWIWDKCTELVPSLKNAKIVHTWTGLRPARSKVRLEREAFVS--GSNKSQIIHNYGHGGYGLTIHWGCAMEAAKIFGQIL 353          
BLAST of D-amino acid oxidase vs. Ensembl Xenopus
Match: terf2ip (TERF2 interacting protein [Source:Xenbase;Acc:XB-GENE-5905850])

HSP 1 Score: 210.69 bits (535), Expect = 1.204e-64
Identity = 116/339 (34.22%), Postives = 186/339 (54.87%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M I +IGAG+ GLS A+ + E++  +    K+ I+ +  +P TT D AAGLW+PY     + Q  KW + T+  + KF+ ++ +    GL     + +  EP     + DIV     +   EL+ +P + YG  +T ++ EG+  L +   R +  G     +++ +F E+  LG   ++INCTG+ + +L  D ++ P RGQ++++HAPW+KH I+          + YIIP SD  V LGG  Q  NW+   +  D K+I + C +L+  L+N  I+    GLRP R  VRLE+E+  +    NK  +IHNYGHGG G T+ WGC+    ++   ++
Sbjct:    1 MHITIIGAGVIGLSTALCIHENYHRIVRPLKIEIYADKFSPLTTSDGAAGLWQPYLYDNGNTQETKWNKETFDHMLKFV-HSVEAPNMGLFLQSGYNILKEPAPEPSWKDIVLGFRHLTSKELELFPGYSYGWFNTALMIEGKHYLPWMMKRLEDRGVKFVHKRIKSFGELAALGAD-VIINCTGIRAGELQPDPELKPGRGQILKVHAPWMKHFILTHDLKTGVYTTPYIIPGSDS-VTLGGIYQLGNWSEENNSEDYKWIWDKCTELVPSLKNAKIVHTWTGLRPARSKVRLEREAFVS--GSNKSQIIHNYGHGGYGLTIHWGCAMEAAKIFGQIL 334          
BLAST of D-amino acid oxidase vs. Ensembl Mouse
Match: Ddo (D-aspartate oxidase [Source:MGI Symbol;Acc:MGI:1925528])

HSP 1 Score: 201.445 bits (511), Expect = 2.971e-61
Identity = 119/331 (35.95%), Postives = 182/331 (54.98%), Query Frame = 1
Query:   55 IAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL--SNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNK-YTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            IAV+GAG+ GLS A  + +  P   VT+ ++  TP+TT +VAAG+  P+  ++      K+W R T+  LS+ IA + +    G+  +  +++  S    ++  + D+V     M EAELKR+P + +G A TT+  E    L +   R K  GG++  +++ +  E+Q   +F IV+NC+GLGSR+L  D  I PVRGQV++  APW+KH I D     Y+ P     V LGGT Q  +WN  PD   ++ I + C  L   L     +   VGLRP R  VRL+KE     + G +   ++HNYGHG  G ++ WG +    +LV + +
Sbjct:    6 IAVVGAGVIGLSTAACISQLVPGCTVTVISDRFTPDTTSNVAAGMLIPHTCADTPVPTQKRWFRETFEHLSE-IAKSAEAADAGVHLVSGWQIFRSVPAEEVPFWADVVLGFRKMTEAELKRFPQYVFGQAFTTLKCETSAYLPWLERRIKGSGGLLLTRRIEDLWELQP--SFDIVVNCSGLGSRRLVGDPMISPVRGQVLQARAPWVKHFIRDGGGLTYVYPGMS-YVTLGGTRQKGDWNRSPDAELSREIFSRCCTLEPSLHRAYDIKEKVGLRPSRPGVRLQKEIL---VRGQQTLPVVHNYGHGSGGISVHWGSALEATRLVMECI 329          
BLAST of D-amino acid oxidase vs. Ensembl Mouse
Match: Dao (D-amino acid oxidase [Source:MGI Symbol;Acc:MGI:94859])

HSP 1 Score: 195.282 bits (495), Expect = 6.926e-59
Identity = 114/338 (33.73%), Postives = 176/338 (52.07%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVK---VTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++AVIGAG+ GLS A+ + E +   +   + I+ +  TP TT DVAAGLW+PY     + Q  +W + T+ +L   + ++P   K GL  I  + L  + +    + + V     +  +E+  +P + YG  +T++L EG+  L +  +R  + G  +  ++V + +E+ +     ++INCTG+ +  L  D  + P RGQ+I++ APWIKH I+          S YIIP S   V LGG  Q  NW+ L    D   I   C KL   L+N  I+    G RP R  VRLE+E        +   +IHNYGHGG G T+ WGC+     L   ++
Sbjct:    1 MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSNPQEAEWSQQTFDYLLSCL-HSPNAEKMGLALISGYNLFRDEVPDPFWKNAVLGFRKLTPSEMDLFPDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVAR--GVDVIINCTGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSK-TVTLGGIFQLGNWSGLNSVRDHNTIWKSCCKLEPTLKNARIVGELTGFRPVRPQVRLEREWL--HFGSSSAEVIHNYGHGGYGLTIHWGCAMEAANLFGKIL 332          
BLAST of D-amino acid oxidase vs. Ensembl Mouse
Match: Dao (D-amino acid oxidase [Source:MGI Symbol;Acc:MGI:94859])

HSP 1 Score: 195.282 bits (495), Expect = 6.926e-59
Identity = 114/338 (33.73%), Postives = 176/338 (52.07%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVK---VTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++AVIGAG+ GLS A+ + E +   +   + I+ +  TP TT DVAAGLW+PY     + Q  +W + T+ +L   + ++P   K GL  I  + L  + +    + + V     +  +E+  +P + YG  +T++L EG+  L +  +R  + G  +  ++V + +E+ +     ++INCTG+ +  L  D  + P RGQ+I++ APWIKH I+          S YIIP S   V LGG  Q  NW+ L    D   I   C KL   L+N  I+    G RP R  VRLE+E        +   +IHNYGHGG G T+ WGC+     L   ++
Sbjct:    1 MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSNPQEAEWSQQTFDYLLSCL-HSPNAEKMGLALISGYNLFRDEVPDPFWKNAVLGFRKLTPSEMDLFPDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVAR--GVDVIINCTGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSK-TVTLGGIFQLGNWSGLNSVRDHNTIWKSCCKLEPTLKNARIVGELTGFRPVRPQVRLEREWL--HFGSSSAEVIHNYGHGGYGLTIHWGCAMEAANLFGKIL 332          
BLAST of D-amino acid oxidase vs. Ensembl Mouse
Match: Dao (D-amino acid oxidase [Source:MGI Symbol;Acc:MGI:94859])

HSP 1 Score: 131.724 bits (330), Expect = 1.333e-35
Identity = 74/232 (31.90%), Postives = 126/232 (54.31%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESF---PEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIP 711
            M++AVIGAG+ GLS A+ + E +     + + I+ +  TP TT DVAAGLW+PY     + Q  +W + T+ +L   + ++P   K GL  I  + L  + +    + + V     +  +E+  +P + YG  +T++L EG+  L +  +R  + G  +  ++V + +E+ +     ++INCTG+ +  L  D  + P RGQ+I++ APWIKH I+          S YIIP
Sbjct:    1 MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSNPQEAEWSQQTFDYLLSCL-HSPNAEKMGLALISGYNLFRDEVPDPFWKNAVLGFRKLTPSEMDLFPDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVAR--GVDVIINCTGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIP 229          
BLAST of D-amino acid oxidase vs. Ensembl Mouse
Match: Ddo (D-aspartate oxidase [Source:MGI Symbol;Acc:MGI:1925528])

HSP 1 Score: 79.337 bits (194), Expect = 2.788e-17
Identity = 49/149 (32.89%), Postives = 81/149 (54.36%), Query Frame = 1
Query:   55 IAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL--SNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDR 492
            IAV+GAG+ GLS A  + +  P   VT+ ++  TP+TT +VAAG+  P+  ++      K+W R T+  LS+ IA + +    G+  +  +++  S    ++  + D+V     M EAELKR+P + +G A TT+  E    L +   R
Sbjct:    6 IAVVGAGVIGLSTAACISQLVPGCTVTVISDRFTPDTTSNVAAGMLIPHTCADTPVPTQKRWFRETFEHLSE-IAKSAEAADAGVHLVSGWQIFRSVPAEEVPFWADVVLGFRKMTEAELKRFPQYVFGQAFTTLKCETSAYLPWLERR 153          
BLAST of D-amino acid oxidase vs. UniProt/SwissProt
Match: sp|Q99489|OXDD_HUMAN (D-aspartate oxidase OS=Homo sapiens OX=9606 GN=DDO PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 5.147e-65
Identity = 124/332 (37.35%), Postives = 188/332 (56.63%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL--SNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLEN-CNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IAV+GAG+ GLS AV + +  P   VTI ++  TP+TT DVAAG+  P+   +   H  K+W R T+  L   IAN+ +    G+  +  +++  S    ++  + D+V     M EAELK++P + +G A TT+  E    L +   R K  GG    +++ +  E+    +F IV+NC+GLGSR+L  D  I+PVRGQV+++ APW++H I D S   YI P +   V LGGT Q  +WN  PD  +++ IL+ C  L   L   CNI    VGLRP R  VRL+ E    +  G +  ++H+YGHG  G ++ WG +    +LV++ +
Sbjct:    5 RIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFA-IANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHP--SFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSH-VTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIRE-KVGLRPYRPGVRLQTELLARD--GQRLPVVHHYGHGSGGISVHWGTALEAARLVSECV 329          
BLAST of D-amino acid oxidase vs. UniProt/SwissProt
Match: sp|Q95XG9|OXDA_CAEEL (D-amino-acid oxidase OS=Caenorhabditis elegans OX=6239 GN=daao-1 PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 1.775e-64
Identity = 114/330 (34.55%), Postives = 188/330 (56.97%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIAN-NPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELK---RYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IAV+GAGING++ A+ + E  P  +VTI  E  +PNTT DVAAGL +P+   +D  ++  W  +T   + ++ A+ NP   +    ++    + +EP  +KL  ++    H + +AE+K   R P  ++G+  TT   E    + +  D+F + GG  K Q++ N D++ +  ++ + +NCTGLGSR L  D ++YP RGQ++++  P +KH  +D+ +Y +  +D  + LGGT +AH W+   +   ++ IL      +  L    ILS +V +RP R  VRL+ E           +L+HNYGHGGSG TL WGC+    ++V +V+
Sbjct:    3 KIAVLGAGINGIASALAIQERLPNCEVTIIAEKFSPNTTSDVAAGLIEPFLCDDDVDRIINWTSATISRIHEYQADGNPGAEEQSGYWLQ--SVKSEPKWLKLMKNV----HILTDAEMKQVARRPEHKFGIFYTTWYLEPTPYIKWCTDKFLKNGGKFKKQKIENIDDVAR--SYDVTVNCTGLGSRALIGDKEVYPTRGQILKVSCPRVKHFFIDDKYYAL-LNDSTITLGGTFEAHQWDLTINSELSQKILKENIHNIPSLRTAQILSSHVDMRPSRGTVRLQAEL--------GRSLVHNYGHGGSGITLHWGCALECAEIVENVL 315          
BLAST of D-amino acid oxidase vs. UniProt/SwissProt
Match: sp|A3KCL7|OXDD_PIG (D-aspartate oxidase OS=Sus scrofa OX=9823 GN=DDO PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.916e-63
Identity = 121/332 (36.45%), Postives = 183/332 (55.12%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL--SNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            ++IAV+GAG+ GLS AV + +  P   +T+ ++  TP TT DVAAG+  P    +   H+ K+W + T+  L   IAN+ +    G+  +  +++  S    ++  + D+V     M + ELK++P    G A TT+  EG   L +   R K  GG++  ++V +  E+    +F IV+NC+GLGS++L  D DI+PVRGQV+++ APW+KH I D S   YI P     V LGGT Q  +WN  P+   +K IL+ C  L   L     +   VGLRP R  VRLEKE         +  ++HNYGHG  G  + WG +    +LV++ +
Sbjct:    4 VRIAVVGAGVMGLSTAVCIFKLVPGCSITVISDKFTPETTSDVAAGMLIPPVYPDTPIHKQKQWFKDTFDHLFA-IANSAEAKDAGVLLVSGWQIFQSAPTEEVPFWADVVLGFRKMTKNELKKFPQHVCGQAFTTLKYEGPTYLPWLEKRVKGSGGLVLTRRVEDLWELHP--SFDIVVNCSGLGSKQLVGDMDIFPVRGQVLKVQAPWVKHFIRDGSGLTYIYPGLAN-VTLGGTRQKGDWNLSPNAEISKQILSRCCALEPSLRGACDIREKVGLRPSRPGVRLEKELLVQ--GSQRLPVVHNYGHGSGGIAMHWGTALEAARLVSECV 329          
BLAST of D-amino acid oxidase vs. UniProt/SwissProt
Match: sp|P31228|OXDD_BOVIN (D-aspartate oxidase OS=Bos taurus OX=9913 GN=DDO PE=1 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 7.529e-63
Identity = 121/332 (36.45%), Postives = 182/332 (54.82%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQ-LKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL--SNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            ++IAV+GAG+ GLS AV + +  P   +T+ ++  TP TT DVAAG+  P    +   Q  K+W + T+  L   I N+ +    G+  +  +++  S    ++  + D+V     M + ELK++P   +G A TT+  EG   L +   R K  GG+I  +++ +  E+    +F IV+NC+GLGSR+L  D  I+PVRGQV+++ APW+KH I D S   YI P     V LGGT Q  +WN  PD   +K IL+ C  L   L     L   VGLRP R +VRLEKE    +    +  ++H+YGHG  G  + WG +    +LV + +
Sbjct:    4 VRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYPDTPIQKQKQWFKETFDHLFA-IVNSAEAEDAGVILVSGWQIFQSIPTEEVPYWADVVLGFRKMTKDELKKFPQHVFGHAFTTLKCEGPAYLPWLQKRVKGNGGLILTRRIEDLWELHP--SFDIVVNCSGLGSRQLAGDSKIFPVRGQVLKVQAPWVKHFIRDSSGLTYIYPGVSN-VTLGGTRQKGDWNLSPDAEISKEILSRCCALEPSLRGAYDLREKVGLRPTRPSVRLEKELLAQD--SRRLPVVHHYGHGSGGIAMHWGTALEATRLVNECV 329          
BLAST of D-amino acid oxidase vs. UniProt/SwissProt
Match: sp|P00371|OXDA_PIG (D-amino-acid oxidase OS=Sus scrofa OX=9823 GN=DAO PE=1 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 1.053e-60
Identity = 118/339 (34.81%), Postives = 180/339 (53.10%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEV----KVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++ VIGAG+ GLS A+ + E +  V     V ++ +  TP TT DVAAGLW+PY     + Q   W + T+ +L   I + P     GL  +  + L  E +    + D+V     +   EL  +P +RYG  +T+++ EG+K L +  +R  + G    +++V +F+E+ + G   ++INCTG+ +  L  D  + P RGQ+I++ APW+K+ I+          S YIIP     V LGGT Q  NWN + +  D   I  GC +L   L++  I+    G RP R  VRLE+E        +   +IHNYGHGG G T+ WGC+  V +L   V+
Sbjct:    1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTSEPSNPQEANWNQQTFNYLLSHIGS-PNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPRELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRKVESFEEVAR-GGADVIINCTGVWAGVLQPDPLLQPGRGQIIKVDAPWLKNFIITHDLERGIYNSPYIIPGLQA-VTLGGTFQVGNWNEINNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFRPVRPQVRLEREQL--RFGSSNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVL 334          
BLAST of D-amino acid oxidase vs. TrEMBL
Match: T2HG31 (D-amino acid oxidase OS=Dugesia ryukyuensis OX=79738 GN=Dr-DAO PE=2 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 1.959e-180
Identity = 238/327 (72.78%), Postives = 280/327 (85.63%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M IAVIGAGING+SVAVNLLE+ P VKVTIFT   TPNTTGDVAAGL++PY ++E DH++KKWCRSTY FL  FIA NPKHHKYG CY++VFEL  EP++  L+N+IV +S F+NE ELKRYPT +YG+AST+I++EG+KIL YF ++FK LGG IKV QV NFDE+Q + NF IVINC+GLGSR LCND DIYPVRGQ+IRIHAPWIK+      HYIIPQSDGVVVLGGTTQ +NWNTLPDENDTK ILNGC+ ++ GLE CNILSVNVGLRP RK+VRLEKE+RTN  TGNKYT+IHNYGHGGSGFTLFWGC+++V QLV+D++
Sbjct:    1 MHIAVIGAGINGISVAVNLLETLPGVKVTIFTHNVTPNTTGDVAAGLFRPYLVAEGDHRIKKWCRSTYNFLENFIATNPKHHKYGCCYLEVFELDTEPLEKTLFNEIVGNSRFLNEFELKRYPTAKYGLASTSIISEGKKILPYFYEKFKMLGGKIKVMQVKNFDEVQMIHNFPIVINCSGLGSRSLCNDMDIYPVRGQIIRIHAPWIKYSFNKAEHYIIPQSDGVVVLGGTTQENNWNTLPDENDTKNILNGCKTILNGLEECNILSVNVGLRPGRKSVRLEKENRTNFTTGNKYTIIHNYGHGGSGFTLFWGCAKDVGQLVSDIL 327          
BLAST of D-amino acid oxidase vs. TrEMBL
Match: A0A293N312 (D-amino acid oxidase (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 2.407e-77
Identity = 127/331 (38.37%), Postives = 202/331 (61.03%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPY---AISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPT-FRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMD-ESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IA++GAGI GL+ AV  +E+  +V +T+ ++  TP TTGDVAAG + PY    + ED  ++++WC  T+ F  + +  + +    GLC I  + L  + +   L+ D       +   EL+ +P+ +++G    +++ E ++ L Y   RF++ GG +K  +V N +E+    NF IV+NC+G+G+  +  D+ + PVRGQ IR+HAPWIKH ++  E  ++IP  D V+ LGGT    NW+ +PD    + I NGC +L+  ++   I+  NVGLRP R  VR+EKE R  +  G K  +IHNYGHGGSG T+ WGC+ + V+L+ +V+
Sbjct:    4 RIAIVGAGIIGLTTAVKAIETLHDVDITVLSDKFTPETTGDVAAGFFNPYILKGVPED--KVREWCVQTFDFYLELLRGD-QAGDLGLCLIPAYLLDTKWIPRPLHADAFLHYRDLTAKELQAFPSKYKHGAFVVSMIIECKRFLPYLMQRFRKGGGKLKSHKVQNLEELAS--NFDIVVNCSGVGAAAITPDNILKPVRGQTIRVHAPWIKHVVVGGEDFHVIPNIDNVM-LGGTKDVGNWSLIPDPKAKEAIWNGCVELIPSIKGAQIIEENVGLRPGRDPVRIEKEERRLQGLGRKLPIIHNYGHGGSGITVCWGCAHDAVKLLREVI 328          
BLAST of D-amino acid oxidase vs. TrEMBL
Match: A0A293LGC5 (D-amino acid oxidase (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.350e-76
Identity = 131/328 (39.94%), Postives = 190/328 (57.93%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISE-DDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPT-FRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +IAV+GAGI GL+ AV  +E+  +V VT+  +  TP TTGDVA G + P AI    + +LK W   ++ F S  +  +      GLC +  + L    +    Y D       M   EL+ +P+ ++YG   TT+  + ++ L Y  +RFK+ GG +K  +V N +E+    +F +V+NC G+ +  +  DD I PVRGQ IR+HAPWIKH + +   +IIP  D V  LGG+    NW+  PD    + I N C +L+  ++   I+  NVGLRP R  VR+EKE R+ E    K+ +IHNYGHGGSG TL WGC+ + VQL+ DV+
Sbjct:    4 RIAVVGAGIIGLTTAVKAIETLQDVDVTVLADKFTPETTGDVAGGFFAPSAIEGVPEEKLKDWAVQSFEFFSDLLKRD-DAGDIGLCLVPAYLLRTAFIPRPPYADAYLHYRDMTVKELQAFPSKYKYGACITTMTIQCRRFLPYLMERFKRSGGKLKSYKVQNLEELAS--DFDVVVNCAGVRAGAITPDDVIKPVRGQNIRVHAPWIKHIVGNNRFHIIPNVDNVY-LGGSYDVGNWSLTPDPKIREAIWNECVELIPSIKKAKIIEENVGLRPGRDPVRIEKEERSIEGLEEKFPIIHNYGHGGSGITLSWGCAHDAVQLLKDVI 327          
BLAST of D-amino acid oxidase vs. TrEMBL
Match: A0A267ERA0 (DAO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021842g1 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.157e-75
Identity = 132/332 (39.76%), Postives = 201/332 (60.54%), Query Frame = 1
Query:   46 KMQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLK-KWCRSTYGFLSKFIANNPKHHKYGLCYIDVFEL-SNEPMKMKLYNDIVDSSHFMNEAELKRYPT-FRYGVASTTILAEGQKILSYFNDRFKQLGG-MIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTD 1023
            ++++A++G GI G +  + +LE+ P  +VTIFT+  TPNTTGDVAAG W P  +S+   QL   W   TY +L   + +NP   + G+ Y   + +  +E + +  ++ I      M E+E+  +P   + G    +++AEG+K+L    D+FK+LGG ++  +++T+FD +   G F  ++NCTGLG+R LC D+ +YP+RGQV R+ APW+   +MD   S Y +P SD  VVLGGT+Q  NW+T     D   IL+    L   L +  I+   VGLRP R+ VRLE+E R +       T+ HNYGHGGSG T+FWGC++  V+L+ +
Sbjct:    4 QLKVAIVGGGIIGTACGLRILETLPAAEVTIFTDQVTPNTTGDVAAGFWTPVYLSKTPTQLSDSWSEETYRYLQSIVESNPTPGENGVHYTPGYTVYRSENLPVISWSHIPIGFRPMTESEVSMFPPEIKGGYFYVSVMAEGRKLLPILMDKFKRLGGRLVTNRRLTSFDSLIGQG-FARIVNCTGLGARDLCADEKMYPIRGQVHRVRAPWMNFWLMDSETSTYCLPNSD-TVVLGGTSQKGNWSTEVSAVDKADILHRVTSLWPSLASAPIVQDAVGLRPGREQVRLEREIRPD------CTIYHNYGHGGSGLTIFWGCAKETVRLLLE 327          
BLAST of D-amino acid oxidase vs. TrEMBL
Match: B4JQK4 (GH13713 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH13713 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 9.020e-75
Identity = 139/339 (41.00%), Postives = 205/339 (60.47%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPE-----VKVTIFTEATTPNTTGDVAAGLWKPYAIS-EDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKM--KLYNDIVDSSHFMNEAELKRYPT-----FRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES---HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            +++AVIGAG+NG++ A+ +LE + +     V+VTI ++  TPNTTGD +AGLW PY +   D+ ++ KW R  + FL K I  +    + G+C I    LS +P     + + DIV  +  +   +L  Y       F  G++  T  +E  K+L Y   RF + GG I+ Q+VT+ +   +   + +++NCTGLGSR+L NDD +Y VRGQV RI A W+   I+DES   +YIIP ++  VVLGGT Q  +++T   E D ++I++GC+ LM  LE+   L   VGLRP R  +RLE E R  ++      LIHNYGHGGSG TL WGC+++V+ L+
Sbjct:    2 LRVAVIGAGVNGVACAIKILEHYQDEKKTNVQVTIISDEFTPNTTGDGSAGLWGPYLLGGTDESKVHKWSRDMHLFLEK-IWLSEDAGEAGVCLIPCVRLSTDPNASVGEFWRDIVYGAVDLTAEQLTAYNKNRDIKFTSGLSFVTYTSEPVKLLPYLTKRFVRRGGRIEQQKVTDLETFVRDSPYDVIVNCTGLGSRQLLNDDSMYAVRGQVTRIKANWVFTAILDESDVGNYIIPNTES-VVLGGTHQVKDYSTKVCETDKRFIIDGCRSLMPALEHTQHLFDWVGLRPGRDQLRLESERRGRKL------LIHNYGHGGSGVTLAWGCADDVLSLL 332          
BLAST of D-amino acid oxidase vs. Ensembl Cavefish
Match: dao.3 (D-amino-acid oxidase, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1894])

HSP 1 Score: 198.364 bits (503), Expect = 2.371e-59
Identity = 119/339 (35.10%), Postives = 183/339 (53.98%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPE----VKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++AVIGAG+ GLS A ++ E + E    + + I+ +  TP TT D AAGLW+PY   E + Q  KW + T+ +L  F  ++P+  K G+     + L  E +    + D V     + + EL  +P + YG  +T ++ EG+  L +  +   Q G     +++T+F E+   G   ++INCTG+ S  L  D ++ P RGQ+I++ APWIKH I+          S YIIP S  V V GG  Q  NW+ L    D K + +   +L   L++  I+    GLRP R  VRLE+E   + +  N + +IHNYGHGG G T+  GC+E   +L  +++
Sbjct:   76 MRVAVIGAGVIGLSTAQSIYEHYHEKVSPLTIEIYADVFTPLTTSDGAAGLWQPYLYDEGNVQETKWNKETFDYLLSF-HSSPESVKMGIFLQSGYNLCTERVPEPSFKDTVLGFRELTQRELDIFPGYSYGWFNTALMIEGKTYLPWLMNWLSQRGIRFYNRKITSFKELAD-GGADVIINCTGVRSGDLQPDPELTPGRGQIIKVDAPWIKHWILTHNFTTGVYNSPYIIPGSRSVTV-GGIFQRGNWSELNSSIDHKKVWDEACELEPSLKHAQIIQDWTGLRPVRSKVRLEREKIKSGL--NTFEVIHNYGHGGFGLTIHRGCAEEAARLFGEIL 409          
BLAST of D-amino acid oxidase vs. Ensembl Cavefish
Match: zgc:172341 (D-aspartate oxidase-like [Source:NCBI gene;Acc:103024550])

HSP 1 Score: 176.407 bits (446), Expect = 9.702e-52
Identity = 103/317 (32.49%), Postives = 173/317 (54.57%), Query Frame = 1
Query:   82 GLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD-HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNE-PMKMKLY-NDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDES--HYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            GLS AV L E+     VTI +E  +P+TT D AAG+  P    +    + ++W + T+  L   +  +P+  + G+     + +  E P   K Y ++ V    FM + E+KR+P  ++G A T+I  E  + L +   RF+  GG +K ++VT+  ++  + ++ +++NC+G+ +  L  D+ +YPVRGQ++++ A W+K+ I D     Y+ P  D  V +GGT Q  +W    D+ D + ++  C  L   L+   +L   VGLRP RK  R+E E   +     +  L+HNYGHGG G +L WG + + ++LV
Sbjct:   15 GLSTAVRLSETLQNSVVTILSEKFSPDTTSDGAAGILLPEVFPDIPLERQQRWFKETFDHLQGLV-ESPEAPEAGVFLSSGYHIFKEVPSDPKPYWSEYVFGFRFMTDREMKRFPNHKFGQAFTSIKCECPRYLPWLEKRFRGAGGDVKQEKVTDLKQL--VSSYDVIVNCSGVWANHLVGDEGVYPVRGQILKLRATWLKNFIRDGDGKTYLYPGID-YVTIGGTRQKDDWRLELDKGDNEDMMKHCIALEPSLQKAQVLEEWVGLRPGRKNPRIESEWLQD--GERQALLVHNYGHGGCGISLSWGSALDALELV 325          
BLAST of D-amino acid oxidase vs. Ensembl Cavefish
Match: zgc:172341 (zgc:172341 [Source:ZFIN;Acc:ZDB-GENE-080204-116])

HSP 1 Score: 172.17 bits (435), Expect = 2.351e-50
Identity = 107/317 (33.75%), Postives = 166/317 (52.37%), Query Frame = 1
Query:   82 GLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLK-KWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESH----YIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            GLS AV + E  P   VTI +E  +P+TTGD AAG+  P    +   Q + +W + T+  L   I   P+  + G+ +   +          +Y   V  +        +  P  ++G A T+I  E  + L +  +RF++ GG IK ++VT+  ++  + ++ +++NC+GLGSR L  D+ +YPVRGQ++++HAPW+K+ I         YI P  D + V GGT Q  +W    D  DT+ I+  C +L   L    +L   VGLRP R+  R+E E    +    +  L+HNYGH G G TL WG + + V LV
Sbjct:   15 GLSTAVCIAEGLPFSSVTILSEKFSPDTTGDGAAGILIPDVFPDIPLQRQQRWFKDTFDHLEGII-ETPEAPEAGVFFSSGY---------CIYIPFVQGN--------EEIPNHKFGQAFTSIKCECLRYLPWLEERFRKAGGQIKREKVTDLQQL--VNSYDVIVNCSGLGSRLLVGDEGVYPVRGQILKVHAPWVKNFIGGGDGGGRAYIYPGIDYITV-GGTRQVDDWRLEVDMKDTEGIMERCCQLEPSLRKAQVLEEWVGLRPGRRNPRVECEWL--QAGERRVILVHNYGHDGCGITLSWGTALDAVGLV 308          
BLAST of D-amino acid oxidase vs. Ensembl Sea Lamprey
Match: dao.2 (D-amino-acid oxidase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2634])

HSP 1 Score: 214.157 bits (544), Expect = 7.375e-67
Identity = 117/339 (34.51%), Postives = 188/339 (55.46%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLE----SFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIR-IHAPWIKHCIMD--------ESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDV 1026
            M++AV+GAG+ GLS A  + E      P++ +T++ +A +P+TTGD +AG W+PYA+ E     K+W + T+ +L   + N+P+  + GL     + L   P+    + DIV     +   ELK +P + YG  +TT++ E +K L +  ++ K  G     +++ +F E+    ++ +++NCTG+ +  L  D  + P RGQ+++ + APWIKH I+         E+ YI+P S GVV LGG  Q  NWN   D+ D   I  GC  L+  L    ++    GLRP R A+RLE+ES   +    +  +IHNYGHGG G T+ WGC+  +  +   +
Sbjct:    1 MRVAVVGAGVIGLSSAQGVYERCRHEAPDLHITVYADAFSPHTTGDGSAGFWQPYALGEMSPAEKQWNKETFDYLLGLV-NSPEASEMGLFLQSGYNLFETPVPDPAWKDIVLGFRHLTVDELKMFPGWSYGWFNTTLMLECKKYLPWLMNKLKSYGVQFIQKKIHSFSELS--ASYDVILNCTGVWAGDLQPDPLLQPARGQLMKKVFAPWIKHFIVTHDTNKGVYETPYILPGSSGVVALGGCFQVGNWNQGIDKKDRANIWEGCCNLVPSLSKARLVEEWAGLRPARHAIRLERES-LRQGGAIQSEIIHNYGHGGYGVTIHWGCALELANIFRQI 335          
BLAST of D-amino acid oxidase vs. Ensembl Sea Lamprey
Match: zgc:172341 (zgc:172341 [Source:ZFIN;Acc:ZDB-GENE-080204-116])

HSP 1 Score: 180.644 bits (457), Expect = 5.255e-54
Identity = 112/334 (33.53%), Postives = 169/334 (50.60%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDD--HQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPM--KMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM--DESHYIIPQSDGV--VVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            ++ V+GAG+ GLS A+ +  S P   +++  +  +P+TT DVAAG+  P  I        ++ W + T+  +   ++        G+  +  +E+  EP       + D+V     M + EL  +P   +G   TT+  E    L +   + +     +K   V N   +   G + +V+NCTGLGS  L  D+++YPVRGQVI + APW+KH +   D   YI P   GV  V LGGT Q+H    LP   D+  I   C  L+  L+    L+  VGLRP R ++RLE+E         + T++H YGHGG G TL WGC+  V  LV D +
Sbjct:   18 RVCVLGAGVMGLSTALCISRSLPHAHISVLADNFSPDTTSDVAAGILHPSTIPVTHIFGWVQYWFKQTFEHVLG-LSRRDDAPSIGVQLVSGYEVFREPPVEHPPFWADLVIGFRAMTDQELSGFPGHTFGWFFTTLQCESSFYLPWLMKKLQSANVELKKTHVENIWHLH--GQYDVVVNCTGLGSHALFGDNEVYPVRGQVIMVRAPWLKHFVRAGDGHTYIYP---GVRDVTLGGTRQSHWGMLLPIAEDSLGIWERCCALVPSLKRSRRLAERVGLRPSRASIRLERECLA--CGALRMTVVHCYGHGGVGVTLHWGCAREVAALVCDSL 343          
BLAST of D-amino acid oxidase vs. Ensembl Nematostella
Match: EDO36103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJI0])

HSP 1 Score: 201.06 bits (510), Expect = 1.540e-61
Identity = 113/340 (33.24%), Postives = 192/340 (56.47%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQL-KKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYP-TFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHY---------IIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGN---KYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            ++AV+G G+ G + A+ +L+S P V++T+  +  +P  T D AAGL  P+A+ E D  L ++W + T     + + +     + G+       +++   ++  + D+V     M+  EL+R+P + + G    TI+A+G   + +   R +  GG I  +++ +F E+ +  +F +V+NC GLG++ L  D  ++P+RGQ++R+ APWIK  I+ E +          IIPQ D VV LGG  QA ++NT+P   DT  I+    K++  L+N  ++S   GLRP RK VRLEKE    +       K  ++HNYGHGG+G +L +GC+++   LV  ++
Sbjct:    4 RVAVVGCGVIGATSALEILQSNPSVRLTVIADTFSPENTSDGAAGLLMPFAVGETDPGLVRRWFKETMRRFEELLRSE-IAPELGVFRASGCLVADHQQEIPDWKDLVYGFKQMSREELERFPLSAKIGFVFETIIAQGSYYIPWLMKRIQHYGGKIVKRRLDSFQELAR--SFDVVVNCCGLGAKGLAQDRHMFPIRGQILRVKAPWIKQFILYEKYEDLKAGRLNDIIPQMDHVV-LGGCAQAGSFNTVPTLQDTVNIIEDTSKVIPALKNAEVISNWSGLRPGRKTVRLEKEVMLFKDESGCIIKLNVVHNYGHGGAGPSLSFGCAKDTADLVAQIL 339          
BLAST of D-amino acid oxidase vs. Ensembl Nematostella
Match: EDO41884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S323])

HSP 1 Score: 187.578 bits (475), Expect = 3.278e-56
Identity = 112/339 (33.04%), Postives = 183/339 (53.98%), Query Frame = 1
Query:   55 IAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQL-KKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYP-TFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM---------DESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKE---SRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +AV+G G  G++ A+++LE  P V+VTI +++ +P+ T D AAG+  P+ + +    L +KW   T     + +       + G+  I      + P +   + D V     + + ELK  P   + G A +TI ++    + +   R K LG +   ++V +  E+   G++ +V+NCTG+ +++L +D+ + P+RGQV+R+  P IK   +             YI+PQ + VVV+GGT Q  N+NT P   DT  I+ G  K +  L+N NI+    GLRP RK+VRLEKE    R       K  ++HNYGHGGSG +L +GC+++   LV + +
Sbjct:    8 VAVVGCGCIGITAALSILERDPCVRVTIISDSFSPDNTTDGAAGILLPFVLWDTPESLQRKWFGETIDRFHQLLQTE-MAPELGIFKISGCFYFDTPKEEPFWKDQVFGFRRLRQEELKACPWPVKDGFAFSTIFSQAAYYMPWMMKRAKDLGAVFIQKKVKSLQELS--GSYDVVVNCTGMRAKELVHDELLRPIRGQVLRVQTPNIKEFCLYVNQEWEKYGRVAYILPQMNDVVVIGGTDQLDNYNTSPTLKDTVNIIEGVSKFVPSLKNANIIKNWAGLRPARKSVRLEKEIMTFRDGSGQERKLNVVHNYGHGGSGLSLCFGCAKDCCDLVFEFL 343          
BLAST of D-amino acid oxidase vs. Ensembl Nematostella
Match: EDO47557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM86])

HSP 1 Score: 85.1149 bits (209), Expect = 2.218e-18
Identity = 95/376 (25.27%), Postives = 157/376 (41.76%), Query Frame = 1
Query:   46 KMQIAVIGAGINGLSVAVNLLESFPEVKVTIFT-EATTPNT----TGDVAAGLWK------PYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTT---ILAEGQK----ILSYFNDR---FKQLGGMIKVQQVTNFDE------IQKLGNFLI------VINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWI----KHCIMDESHYIIPQSDGVVVLG---------GTTQAHNWNTLPDEND--TKYILNGCQKL---MKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVT 1020
            + ++ VIGAG+ GL+ A  LLE     +VTI   E  +P+        VAAGLW+      P+  ++ +  +  WC  T+   S+          Y    I ++         K+ +D+    H      L   P FR+ +   T   I  +G K     LS   D       L G ++ Q V    E       Q LG          VINCTG  +  +  D   YP+RG  + IH   I      CI   + +    ++G+ ++          GT +  + +   + +D   + +L  CQK+   ++ + + ++  + VG+RP R       E+   E+    + L+HNYGH   G  + WGC+E+V  +V+
Sbjct:    6 RPRVLVIGAGVIGLTTAYELLEK--GFRVTILAKEFVSPSNNHKIASQVAAGLWQIPVRILPWRDAQVEKNIFDWCMRTWHRFSELSKQKDVTGVYMRQRIKLY-------THKIDDDLRVKEHMQAHQHL---PGFRHSLQIITDYGINGDGIKDAFTFLSPVVDTDIFLTWLTGQLQSQGVDFVKEEVTPPLSQHLGVLRSRYKAHWVINCTGFQAEYMAQDKKAYPLRGAGLIIHNADINVMPDACIQTTTPWCEGDAEGLAIIAPRGVHSVWLGTFKQPSSDCFLEMSDPIVRRMLKECQKIYPPLRRIRDEHLSGMTVGVRPNRH------ETPRVELDSTDHNLVHNYGHTSYGVAMSWGCAEHVSTIVS 363          
BLAST of D-amino acid oxidase vs. Ensembl Nematostella
Match: EDO41915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S302])

HSP 1 Score: 76.2554 bits (186), Expect = 1.974e-15
Identity = 95/380 (25.00%), Postives = 150/380 (39.47%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTI--FTEATTPNTTGDVAAGLW----KPYAISEDDHQ-LKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSS-HFMNEAELKRYPTFRY-------------------GVASTTILAEGQKILSYFNDRFKQLG-----GMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPW------IKHCIMDE------------SHYIIPQSD---GVVVLGGTTQAHNWNTLPDEND--TKYILNGCQKLMKGLENC--NILSVNVGLRP-RRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            ++ VIGAG+ GL+ A  LL +  EV V    F     P     +A  LW    K     E   Q ++ W   +Y  L +   N         C   V  + N    + L+ DI   +  F+N++  K  P FR+                    V+    L      + +   + +QLG       ++   ++  + +    N   VINCTGL +++L  DD +YPVRG +I + +        + H    E               I+P  +    +  LG   Q+H +NT    +    K  L  C  +   + +     + V VGLRP R    R+E +            LIHNYGHG  G+ L WGC++  +++V
Sbjct:   21 RVLVIGAGVIGLTTAYELLTAGYEVTVLAKEFPIPGDPVIVSLIAGALWVFPTKMDCFEEFSRQKIEAWAMVSYDKLVQQAKNG--------CKTGVKVIEN----VYLFKDIDGPTMEFINKS--KHLPKFRHSPMIIKEKGINTSPHGVKDAVSFWVPLINSPSYMMWLYQQCQQLGVKYVRASLQGTLLSQLNSLMTSYNADFVINCTGLAAKELATDDKVYPVRGALINVPSDALNIDYRLAHGFKTEYGGGPGENAAIGGPSILPHHNNDPSMGSLGVFYQSHEYNTNLSLSHPLVKKFLQQCIAMYPPVGSIKEKDMVVKVGLRPVRSGGPRVEPDPSNPR-------LIHNYGHGAIGYILSWGCAKECLEMV 379          
BLAST of D-amino acid oxidase vs. Ensembl Medaka
Match: dao.2 (D-amino acid oxidase [Source:NCBI gene;Acc:101166138])

HSP 1 Score: 191.045 bits (484), Expect = 2.768e-57
Identity = 109/339 (32.15%), Postives = 184/339 (54.28%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESF----PEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDE--------SHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            M++AVIGAG+ GLS A ++ E +      + + ++ +  TP TT D AAG W+PY   + + Q  KW + T+ +L  ++ N+P+  K G+     + +  EP     + + V     + + EL+ +P + +G  +T ++ EG+  L +  D  +Q G     +++ +F E+ + G   ++INCTG+ S +L  D D+ P RGQ+I++ APW+KH ++          S YIIP S  +V +GG  Q  NW+   +  D K++     +L   L++  I+    GLRP R  VRLE+E  T +   +   +IHNYGHGG G T+  GC++   +L   ++
Sbjct:    1 MRVAVIGAGVIGLSTAQSIYEQYHSTVSPLTIEVYADRFTPLTTSDGAAGFWQPYLYDKGNVQETKWNKETFDYLLSWL-NSPESVKMGVFLQSGYNIFTEPAPDPSFKEAVLGFRHLTQRELQLFPGYNFGWFNTALMVEGKSYLPWLMDWLQQRGVKFYNKKINSFKELSESGA-DVIINCTGVRSGELQPDPDLKPGRGQIIKVDAPWLKHWVITHNMKTGVYNSPYIIPGSR-LVTVGGLFQLGNWSEQNNSADHKHMWEEACQLEPSLKHARIVEDWAGLRPVRSKVRLERE--TLQSGASTIEVIHNYGHGGFGLTIHRGCAQEAARLFGQIV 334          
BLAST of D-amino acid oxidase vs. Ensembl Medaka
Match: zgc:172341 (D-aspartate oxidase [Source:NCBI gene;Acc:101171471])

HSP 1 Score: 184.496 bits (467), Expect = 7.877e-55
Identity = 111/317 (35.02%), Postives = 174/317 (54.89%), Query Frame = 1
Query:   88 SVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQL---KKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNE-PMKMK-LYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIM--DESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLV 1017
            S AV + E+ P   VT+  +  +P+TT D AAG+   +A    D  +   ++W RS++  L   IA + +  + G+     +++  E P   K  + D+V     M   EL+R+P    G   TT+  E +  L +   RF+  GG ++ ++V +  E+   G+F +++NC+GLGSR L  D  + PVRGQV+++ APW++H I   D   YI P    V + GGT QA +W    D+ DT+ I+  C++L   L    +L   VGLRP R+  R+EKE    ++ G +  ++HNYGHGG G TL WG + + V+LV
Sbjct:   17 STAVCIAEALPLCSVTLIADRFSPDTTSDGAAGIL--FAAEFPDVPIATQRRWFRSSFRHLLA-IAQSEEAPEAGVTLSSGWQIFKELPETPKPFWWDLVIGFRAMTSGELRRFPGHACGQFFTTLKCECRSYLPWLQRRFRGAGGRVERRRVGSLQELG--GDFDLLVNCSGLGSRALLGDMQVEPVRGQVLQVEAPWLQHFIRDGDGKTYIYPGVRSVTI-GGTRQAGDWRLGEDQTDTEGIVERCRRLEPSLSRAKVLGCWVGLRPGRRNPRVEKE--LLQLGGRRVPVVHNYGHGGWGVTLAWGTAVDAVELV 325          
BLAST of D-amino acid oxidase vs. Ensembl Medaka
Match: zgc:172341 (D-aspartate oxidase [Source:NCBI gene;Acc:101171471])

HSP 1 Score: 121.709 bits (304), Expect = 1.099e-31
Identity = 90/323 (27.86%), Postives = 149/323 (46.13%), Query Frame = 1
Query:   76 INGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQL---KKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNE-PMKMK-LYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            + G+S AV + E+ P   VT+  +  +P+TT D AAG+   +A    D  +   ++W RS++  L   IA + +  + G+     +++  E P   K  + D+V     M   EL+R+P    G   TT+  E +  L +   RF+  GG ++ ++V +  E+   G+F +++NC+GLGSR L  D                                                  + D+ DT+ I+  C++L   L    +L   VGLRP R+  R+EKE    ++ G +  ++HNYGHGG G TL WG + + V+LV   +
Sbjct:   13 VVGVSTAVCIAEALPLCSVTLIADRFSPDTTSDGAAGIL--FAAEFPDVPIATQRRWFRSSFRHLLA-IAQSEEAPEAGVTLSSGWQIFKELPETPKPFWWDLVIGFRAMTSGELRRFPGHACGQFFTTLKCECRSYLPWLQRRFRGAGGRVERRRVGSLQELG--GDFDLLVNCSGLGSRALLGD--------------------------------------------------MQDQTDTEGIVERCRRLEPSLSRAKVLGCWVGLRPGRRNPRVEKE--LLQLGGRRVPVVHNYGHGGWGVTLAWGTAVDAVELVRQSL 278          
BLAST of D-amino acid oxidase vs. Planmine SMEST
Match: SMESG000066563.1 (SMESG000066563.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 325/327 (99.39%), Postives = 326/327 (99.69%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNF IVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKL+KGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM
Sbjct:    1 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFPIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLLKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 327          
BLAST of D-amino acid oxidase vs. Planmine SMEST
Match: SMESG000066569.1 (SMESG000066569.1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.779e-140
Identity = 188/328 (57.32%), Postives = 241/328 (73.48%), Query Frame = 1
Query:   49 MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNE-PMKMKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCI-MDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDV 1026
            M+IA+IGAGINGLSV V LLE  P   V I +E  TP TT DV  GLW PY  SE D + +KWCRSTY +LS  +  +P HHKYG+ Y ++++LS++ P++MKL+N++VD S FMNE ELKR+P  +YG+A TTIL+EG+KILSY  D+F   GG+I      +FDE+QKL +F I+INCTGLGSR+LC+D D+ PVR Q+IR+ APW+K  + MD   YI+PQS+GVVVLGG TQ +NW+  P E DTK IL+ C KL+ GL+N  I+S  VGLRP+R  VRLEKE   N  T   Y LIHNYG G SGF +FWGC+E+VVQ+V+D+
Sbjct:    1 MKIAIIGAGINGLSVGVKLLEVHPNFSVIILSEKVTPETTDDVVPGLWMPYVSSEGDPRFEKWCRSTYAYLSNIVQTDPDHHKYGIYYQEMYDLSDDKPLEMKLFNEVVDVSRFMNERELKRFPAAKYGIACTTILSEGEKILSYLTDKFISNGGIIIHHLAESFDEVQKLEDFSIIINCTGLGSRQLCHDLDVNPVRTQIIRVEAPWVKSAVFMDHRCYILPQSNGVVVLGGMTQNNNWDINPHEEDTKSILDSCMKLLPGLKNSRIISAKVGLRPQRSIVRLEKEDSINSSTKTSYKLIHNYGQGESGFAVFWGCAEDVVQIVSDI 328          
BLAST of D-amino acid oxidase vs. Planmine SMEST
Match: SMESG000081233.1 (SMESG000081233.1)

HSP 1 Score: 144.436 bits (363), Expect = 1.057e-39
Identity = 105/336 (31.25%), Postives = 155/336 (46.13%), Query Frame = 1
Query:   52 QIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKPYAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMK-MKLYNDIVDSSHFMNEAELKRY---PTFRYGVASTTILAEGQKILSYFNDRFKQLGGMIKVQQVTNFDEIQKLGNFLI------VINCTGLGSRKLCNDDDIYPVRGQVIRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYILNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIHNYGHGGSGFTLFWGCSENVVQLVTDVM 1029
            +I VIG GI GL++A  LLE +P   + I T     +TT   A G      +     ++  W R +     K I  + +    G+   +++ LS++P     ++NDI      +N  ELK      T  + +   + L E +  L +  + F   GG I ++++    E   + N+ I      VINC+GLGS  L ND D+ PVRGQV+R+ APW +H  M   +         V LG   QA++W+      DT  I     +    L    I+    GLRP R   RLE E      +G +  ++HNYGHG SG  L WG S  V  LV  ++
Sbjct:    8 KIGVIGEGIMGLTIANILLERYPLAHLQITTSKGYRDTTSQGAVGYVCINVVENRGEKIFNWYRKSLDHYWK-IFRSSESVIAGISVSNLYYLSDKPFSDTTIFNDIFPGFREINVKELKALGFSSTLPHAIGLISTLVEPRYYLPFLENIFISNGGEIIIEKLEGTSE--NVANWAIKNEYDVVINCSGLGSAVLFNDPDLIPVRGQVVRVEAPWFRHSFMTTDNTYGFTCRDSVALGTVKQANDWDQSIRFEDTDDIFKRISEHNVCLSESKIIEEWAGLRPWRPQPRLEAEI-LKSTSGIEIPIVHNYGHGSSGIGLSWGTSLEVADLVDSIL 339          
The following BLAST results are available for this feature:
BLAST of D-amino acid oxidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDO3.329e-6537.35D-aspartate oxidase [Source:HGNC Symbol;Acc:HGNC:2... [more]
DAO7.981e-5934.12D-amino acid oxidase [Source:HGNC Symbol;Acc:HGNC:... [more]
DDO8.718e-3539.56D-aspartate oxidase [Source:HGNC Symbol;Acc:HGNC:2... [more]
DAO6.136e-2838.27D-amino acid oxidase [Source:HGNC Symbol;Acc:HGNC:... [more]
DAO7.179e-2530.93D-amino acid oxidase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daao-11.396e-6534.55D-amino-acid oxidase [Source:UniProtKB/Swiss-Prot... [more]
ddo-21.192e-3928.99D-aspartate oxidase 2 [Source:UniProtKB/Swiss-Pro... [more]
ddo-21.192e-3928.99D-aspartate oxidase 2 [Source:UniProtKB/Swiss-Pro... [more]
ddo-11.153e-3830.24D-aspartate oxidase 1 [Source:UniProtKB/Swiss-Pro... [more]
ddo-31.088e-2428.53D-aspartate oxidase 3 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG112362.617e-7339.47gene:FBgn0031860 transcript:FBtr0079339[more]
CG112361.105e-7239.47gene:FBgn0031860 transcript:FBtr0309812[more]
CG123382.486e-4630.24gene:FBgn0033543 transcript:FBtr0088256[more]
CG123382.486e-4630.24gene:FBgn0033543 transcript:FBtr0345662[more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dao.21.561e-5933.83D-amino-acid oxidase, tandem duplicate 2 [Source:Z... [more]
dao.18.612e-5933.04D-amino-acid oxidase, tandem duplicate 1 [Source:Z... [more]
dao.18.612e-5933.04D-amino-acid oxidase, tandem duplicate 1 [Source:Z... [more]
dao.33.048e-5834.53D-amino-acid oxidase, tandem duplicate 3 [Source:Z... [more]
zgc:1723416.675e-5735.76zgc:172341 [Source:ZFIN;Acc:ZDB-GENE-080204-116][more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDO3.379e-7338.18D-aspartate oxidase [Source:NCBI gene;Acc:10048851... [more]
terf2ip2.476e-6534.41TERF2 interacting protein [Source:Xenbase;Acc:XB-G... [more]
terf2ip4.363e-6534.41TERF2 interacting protein [Source:Xenbase;Acc:XB-G... [more]
terf2ip6.407e-6534.41TERF2 interacting protein [Source:Xenbase;Acc:XB-G... [more]
terf2ip1.204e-6434.22TERF2 interacting protein [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddo2.971e-6135.95D-aspartate oxidase [Source:MGI Symbol;Acc:MGI:192... [more]
Dao6.926e-5933.73D-amino acid oxidase [Source:MGI Symbol;Acc:MGI:94... [more]
Dao6.926e-5933.73D-amino acid oxidase [Source:MGI Symbol;Acc:MGI:94... [more]
Dao1.333e-3531.90D-amino acid oxidase [Source:MGI Symbol;Acc:MGI:94... [more]
Ddo2.788e-1732.89D-aspartate oxidase [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of D-amino acid oxidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99489|OXDD_HUMAN5.147e-6537.35D-aspartate oxidase OS=Homo sapiens OX=9606 GN=DDO... [more]
sp|Q95XG9|OXDA_CAEEL1.775e-6434.55D-amino-acid oxidase OS=Caenorhabditis elegans OX=... [more]
sp|A3KCL7|OXDD_PIG3.916e-6336.45D-aspartate oxidase OS=Sus scrofa OX=9823 GN=DDO P... [more]
sp|P31228|OXDD_BOVIN7.529e-6336.45D-aspartate oxidase OS=Bos taurus OX=9913 GN=DDO P... [more]
sp|P00371|OXDA_PIG1.053e-6034.81D-amino-acid oxidase OS=Sus scrofa OX=9823 GN=DAO ... [more]
back to top
BLAST of D-amino acid oxidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2HG311.959e-18072.78D-amino acid oxidase OS=Dugesia ryukyuensis OX=797... [more]
A0A293N3122.407e-7738.37D-amino acid oxidase (Fragment) OS=Ornithodoros er... [more]
A0A293LGC52.350e-7639.94D-amino acid oxidase (Fragment) OS=Ornithodoros er... [more]
A0A267ERA01.157e-7539.76DAO domain-containing protein OS=Macrostomum ligna... [more]
B4JQK49.020e-7541.00GH13713 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dao.32.371e-5935.10D-amino-acid oxidase, tandem duplicate 3 [Source:Z... [more]
zgc:1723419.702e-5232.49D-aspartate oxidase-like [Source:NCBI gene;Acc:103... [more]
zgc:1723412.351e-5033.75zgc:172341 [Source:ZFIN;Acc:ZDB-GENE-080204-116][more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dao.27.375e-6734.51D-amino-acid oxidase, tandem duplicate 2 [Source:Z... [more]
zgc:1723415.255e-5433.53zgc:172341 [Source:ZFIN;Acc:ZDB-GENE-080204-116][more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of D-amino acid oxidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO361031.540e-6133.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418843.278e-5633.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475572.218e-1825.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419151.974e-1525.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of D-amino acid oxidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dao.22.768e-5732.15D-amino acid oxidase [Source:NCBI gene;Acc:1011661... [more]
zgc:1723417.877e-5535.02D-aspartate oxidase [Source:NCBI gene;Acc:10117147... [more]
zgc:1723411.099e-3127.86D-aspartate oxidase [Source:NCBI gene;Acc:10117147... [more]
back to top
BLAST of D-amino acid oxidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000066563.10.000e+099.39SMESG000066563.1[more]
SMESG000066569.11.779e-14057.32SMESG000066569.1[more]
SMESG000081233.11.057e-3931.25SMESG000081233.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033916 ID=SMED30033916|Name=D-amino acid oxidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1124bp
CTAACTTGGTTTCAATTTTTATTTCAAATCATAATATAAAATTTTAAAAT
GCAAATTGCAGTTATTGGTGCAGGTATTAACGGACTTTCTGTAGCCGTTA
ATTTATTAGAATCTTTTCCCGAAGTAAAAGTTACTATATTTACCGAGGCA
ACAACTCCAAATACCACTGGCGATGTTGCTGCTGGTTTGTGGAAGCCATA
TGCTATTTCTGAAGACGATCACCAATTAAAGAAATGGTGCAGGTCAACTT
ATGGATTTCTATCCAAATTTATTGCAAATAACCCGAAACATCACAAATAT
GGATTGTGCTATATTGATGTTTTCGAATTGAGCAATGAACCAATGAAAAT
GAAGTTATACAATGACATAGTGGATAGTAGTCATTTTATGAACGAGGCAG
AACTCAAGCGTTATCCAACTTTTAGATATGGAGTTGCATCAACTACCATT
TTGGCTGAAGGTCAAAAGATTTTATCATATTTTAATGATAGATTTAAACA
ATTAGGTGGTATGATAAAAGTTCAACAAGTAACAAACTTTGACGAGATTC
AAAAACTTGGGAATTTTCTAATTGTCATTAACTGCACCGGACTCGGATCT
CGAAAATTATGTAACGACGATGATATTTATCCAGTAAGAGGTCAAGTAAT
AAGAATCCACGCGCCATGGATCAAGCATTGCATTATGGATGAGAGCCATT
ATATTATTCCTCAAAGTGACGGAGTCGTAGTATTAGGAGGAACAACGCAA
GCACATAATTGGAATACTCTTCCGGATGAAAATGATACAAAATACATTTT
AAATGGATGTCAAAAATTGATGAAAGGATTAGAAAATTGTAACATATTAT
CTGTAAATGTTGGGCTGAGACCCAGAAGAAAAGCGGTAAGACTGGAAAAA
GAAAGCCGAACTAATGAAATCACAGGAAATAAATATACACTAATTCATAA
TTACGGGCATGGAGGATCTGGATTTACACTATTCTGGGGATGTTCAGAAA
ATGTTGTTCAATTAGTTACAGATGTGATGCTTAAAGCAAAATTGTAAAAT
TTATTAGATTGAAATTTTTAGACAAAACATTTTAGATCTTTTGAAATAAA
AACTTATTATTTTTTGAAAAAAAA
back to top

protein sequence of SMED30033916-orf-1

>SMED30033916-orf-1 ID=SMED30033916-orf-1|Name=SMED30033916-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=333bp
MQIAVIGAGINGLSVAVNLLESFPEVKVTIFTEATTPNTTGDVAAGLWKP
YAISEDDHQLKKWCRSTYGFLSKFIANNPKHHKYGLCYIDVFELSNEPMK
MKLYNDIVDSSHFMNEAELKRYPTFRYGVASTTILAEGQKILSYFNDRFK
QLGGMIKVQQVTNFDEIQKLGNFLIVINCTGLGSRKLCNDDDIYPVRGQV
IRIHAPWIKHCIMDESHYIIPQSDGVVVLGGTTQAHNWNTLPDENDTKYI
LNGCQKLMKGLENCNILSVNVGLRPRRKAVRLEKESRTNEITGNKYTLIH
NYGHGGSGFTLFWGCSENVVQLVTDVMLKAKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR023209DAO
IPR006076FAD-dep_OxRdtase
IPR016040NAD(P)-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0003884D-amino-acid oxidase activity
GO:0071949FAD binding
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0046416D-amino acid metabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.9.10coord: 86..276
e-value: 1.2E-93
score: 316.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 3..322
e-value: 1.2E-93
score: 316.0
NoneNo IPR availablePANTHERPTHR11530:SF11D-ASPARTATE OXIDASEcoord: 2..327
NoneNo IPR availableSUPERFAMILYSSF51971Nucleotide-binding domaincoord: 1..325
NoneNo IPR availableSUPERFAMILYSSF54373FAD-linked reductases, C-terminal domaincoord: 193..277
IPR023209D-amino-acid oxidasePIRSFPIRSF000189D-aa_oxidasecoord: 1..332
e-value: 1.4E-75
score: 252.2
IPR023209D-amino-acid oxidasePANTHERPTHR11530D-AMINO ACID OXIDASEcoord: 2..327
IPR006076FAD dependent oxidoreductasePFAMPF01266DAOcoord: 3..321
e-value: 2.0E-37
score: 129.6