PHD-type domain-containing protein

Overview
NamePHD-type domain-containing protein
Smed IDSMED30033913
Length (bp)3557
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PHD-type domain-containing protein (SMED30033913) t-SNE clustered cells

Violin plots show distribution of expression levels for PHD-type domain-containing protein (SMED30033913) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PHD-type domain-containing protein (SMED30033913) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PHD-type domain-containing protein (SMED30033913) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033913

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033913h1SMcG0019485 SmedASXL_004164SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30033913h1SMcG0019485 dd_Smed_v4_8419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PHD-type domain-containing protein vs. Ensembl Human
Match: TAF3 (TATA-box binding protein associated factor 3 [Source:HGNC Symbol;Acc:HGNC:17303])

HSP 1 Score: 68.9366 bits (167), Expect = 5.149e-11
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:  860 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC 912          
BLAST of PHD-type domain-containing protein vs. Ensembl Celegans
Match: taf-3 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:E9P862])

HSP 1 Score: 55.8398 bits (133), Expect = 2.937e-8
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 2
Query: 3209 SEDGKLVYICPICS-GEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLE 3376
            SE  + ++ICP+CS     G  M+GC++C+DW+H  C+ +    P D  WFC RC +
Sbjct:  125 SESSEEIWICPVCSVAYTVGANMIGCDQCQDWFHWHCVGL-TAEPTDSKWFCTRCTK 180          
BLAST of PHD-type domain-containing protein vs. Ensembl Celegans
Match: taf-3 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:E9P862])

HSP 1 Score: 57.7658 bits (138), Expect = 5.750e-8
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 2
Query: 3209 SEDGKLVYICPICS-GEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            SE  + ++ICP+CS     G  M+GC++C+DW+H  C+ +    P D  WFC RC
Sbjct:  923 SESSEEIWICPVCSVAYTVGANMIGCDQCQDWFHWHCVGL-TAEPTDSKWFCTRC 976          
BLAST of PHD-type domain-containing protein vs. Ensembl Celegans
Match: taf-3 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:E9P862])

HSP 1 Score: 57.3806 bits (137), Expect = 6.184e-8
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 2
Query: 3209 SEDGKLVYICPICS-GEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            SE  + ++ICP+CS     G  M+GC++C+DW+H  C+ +    P D  WFC RC
Sbjct:  858 SESSEEIWICPVCSVAYTVGANMIGCDQCQDWFHWHCVGL-TAEPTDSKWFCTRC 911          
BLAST of PHD-type domain-containing protein vs. Ensembl Celegans
Match: taf-3 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:E9P862])

HSP 1 Score: 56.6102 bits (135), Expect = 6.318e-8
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 2
Query: 3209 SEDGKLVYICPICS-GEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLE 3376
            SE  + ++ICP+CS     G  M+GC++C+DW+H  C+ +    P D  WFC RC +
Sbjct:  264 SESSEEIWICPVCSVAYTVGANMIGCDQCQDWFHWHCVGL-TAEPTDSKWFCTRCTK 319          
BLAST of PHD-type domain-containing protein vs. Ensembl Fly
Match: bip2 (gene:FBgn0026262 transcript:FBtr0089110)

HSP 1 Score: 69.707 bits (169), Expect = 1.810e-11
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 3197 AHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCL 3373
            + Y   +G  ++ICP C   DDG  M+GC+ C+ WYH  C+ +   P ++ DWFC+ C+
Sbjct: 1330 SSYVDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCV 1388          
BLAST of PHD-type domain-containing protein vs. Ensembl Zebrafish
Match: taf3 (TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated facto [Source:ZFIN;Acc:ZDB-GENE-030131-6406])

HSP 1 Score: 71.2478 bits (173), Expect = 6.804e-12
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPEDQ WFC +C
Sbjct:  829 EWGNQIWICPGCNKADDGSPMIGCDECDDWYHWPCVGLLAAPPEDQSWFCIKC 881          
BLAST of PHD-type domain-containing protein vs. Ensembl Xenopus
Match: TAF3 (TATA-box binding protein associated factor 3 [Source:NCBI gene;Acc:447984])

HSP 1 Score: 71.633 bits (174), Expect = 6.836e-12
Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPED+ WFC +C
Sbjct:  860 EWGNQIWICPGCNKADDGSPMIGCDLCDDWYHWPCVGINAAPPEDEQWFCTKC 912          
BLAST of PHD-type domain-containing protein vs. Ensembl Mouse
Match: Taf3 (TATA-box binding protein associated factor 3 [Source:MGI Symbol;Acc:MGI:2388097])

HSP 1 Score: 68.5514 bits (166), Expect = 4.005e-11
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:  709 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKC 761          
BLAST of PHD-type domain-containing protein vs. Ensembl Mouse
Match: Taf3 (TATA-box binding protein associated factor 3 [Source:MGI Symbol;Acc:MGI:2388097])

HSP 1 Score: 62.003 bits (149), Expect = 4.590e-11
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:   38 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKC 90          
BLAST of PHD-type domain-containing protein vs. Ensembl Mouse
Match: Taf3 (TATA-box binding protein associated factor 3 [Source:MGI Symbol;Acc:MGI:2388097])

HSP 1 Score: 68.1662 bits (165), Expect = 6.869e-11
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:  862 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKC 914          
BLAST of PHD-type domain-containing protein vs. Ensembl Mouse
Match: Taf3 (TATA-box binding protein associated factor 3 [Source:MGI Symbol;Acc:MGI:2388097])

HSP 1 Score: 45.4394 bits (106), Expect = 6.006e-6
Identity = 16/33 (48.48%), Postives = 23/33 (69.70%), Query Frame = 2
Query: 3272 MLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:    1 MIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKC 33          
BLAST of PHD-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5EAW9|TAF3_XENLA (Transcription initiation factor TFIID subunit 3 OS=Xenopus laevis OX=8355 GN=taf3 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.870e-11
Identity = 26/53 (49.06%), Postives = 37/53 (69.81%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC++C+DWYH  C+ +   PPED+ WFC +C
Sbjct:  776 EWGNQIWICPGCNKPDDGSPMIGCDQCDDWYHWPCVGINAAPPEDEQWFCTKC 828          
BLAST of PHD-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5VWG9|TAF3_HUMAN (Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.473e-10
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:  860 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC 912          
BLAST of PHD-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5HZG4|TAF3_MOUSE (Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.805e-10
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:  862 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKC 914          
BLAST of PHD-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5F489|TAF3_CHICK (Transcription initiation factor TFIID subunit 3 OS=Gallus gallus OX=9031 GN=TAF3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.404e-10
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ CP C+  DDG  M+GC+ C+DWYH  C+ +   PPE+  WFC +C
Sbjct:  861 EWGNQIWFCPGCNKPDDGSPMIGCDDCDDWYHWPCVGITAAPPEEMQWFCSKC 913          
BLAST of PHD-type domain-containing protein vs. TrEMBL
Match: A0A267GIU5 (PHD-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031197g3 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.009e-13
Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 3125 TAHLPAISQIENKTTYNYPCLPGEAHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
             A   ++++++++ +Y          Y  + G  +++CP CS EDDG LM+GC RC+DWYH  CL    PPPED+DW C +C
Sbjct:  810 AADAASLTRVQHEASY----------YFDDQGNQIWLCPACSEEDDGSLMIGCSRCDDWYHAVCLGFAQPPPEDEDWLCPKC 881          
BLAST of PHD-type domain-containing protein vs. TrEMBL
Match: A0A553PGL5 (PHD-type domain-containing protein (Fragment) OS=Tigriopus californicus OX=6832 GN=TCAL_03500 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.696e-12
Identity = 29/59 (49.15%), Postives = 40/59 (67.80%), Query Frame = 2
Query: 3197 AHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCL 3373
             HY   DG  ++ICP C  +DDG  M+GC+ C+DWYH  C+ + + P E Q+WFCQRC+
Sbjct:  691 GHYVDADGNQIWICPACGKQDDGSPMIGCDECDDWYHWLCVGIRSEPDESQNWFCQRCV 749          
BLAST of PHD-type domain-containing protein vs. TrEMBL
Match: A0A2J7PLB7 (PHD-type domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G09094 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.250e-12
Identity = 31/70 (44.29%), Postives = 43/70 (61.43%), Query Frame = 2
Query: 3164 TTYNYPCLPGEAHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCL 3373
            TT   P     A Y   DG  V+ICP C G+DDG  M+GC+ C+ WYH  C+ +  PP E++DW+C+ C+
Sbjct:  112 TTETEPTKEPVAFYYDSDGNKVWICPACGGQDDGSPMIGCDDCDAWYHWVCVGIQVPPDENEDWYCRVCI 181          
BLAST of PHD-type domain-containing protein vs. TrEMBL
Match: A0A0K2TYK9 (Transcription initiation factor TFIID subunit 3like [Ceratitis capitata] OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.555e-12
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 2
Query: 3197 AHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCL 3373
             HY   +G  ++ICP C  +DDG  M+GC++C+DWYH  C+ +   P E+QDWFC RC+
Sbjct:  723 GHYVDAEGNQIWICPACGKQDDGSPMIGCDKCDDWYHWACVGISAEPAENQDWFCTRCM 781          
BLAST of PHD-type domain-containing protein vs. TrEMBL
Match: A0A183B7Q5 (PHD-type domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS15240 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.820e-12
Identity = 35/86 (40.70%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 3128 AHLPAISQIENKTTYNYPCLPGEAHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLEDML 3385
            +H P+ +Q+   T        G ++Y +  G+ +++CPIC  EDDG LM+GC+ C+DWYH  CL + +  PED  WFC RC    L
Sbjct:  148 SHRPSSAQVVVATA-------GSSYYFNSSGEQIWLCPICLQEDDGNLMIGCDSCDDWYHSTCLGL-SAEPEDPHWFCPRCAGQSL 225          
BLAST of PHD-type domain-containing protein vs. Ensembl Cavefish
Match: taf3 (TATA-box binding protein associated factor 3 [Source:NCBI gene;Acc:103042521])

HSP 1 Score: 71.2478 bits (173), Expect = 5.751e-12
Identity = 26/53 (49.06%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPEDQ W+C +C
Sbjct:  840 EWGNQIWICPGCNKPDDGSPMIGCDECDDWYHWPCVGILTAPPEDQSWYCVKC 892          
BLAST of PHD-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006999.1 (pep scaffold:Pmarinus_7.0:GL484485:3565:11554:-1 gene:ENSPMAG00000006323.1 transcript:ENSPMAT00000006999.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.829e-11
Identity = 27/59 (45.76%), Postives = 37/59 (62.71%), Query Frame = 2
Query: 3200 HYTSED--GKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            +Y  ED  G  V+ICP C+  DDG  M+GC+ C+DW+H  C+ +   PP+   WFC RC
Sbjct:  730 NYRLEDAQGNKVWICPGCNKMDDGSPMIGCDMCDDWFHWPCVGISKAPPDAVKWFCPRC 788          
BLAST of PHD-type domain-containing protein vs. Ensembl Medaka
Match: taf3 (TATA-box binding protein associated factor 3 [Source:NCBI gene;Acc:101163568])

HSP 1 Score: 70.8626 bits (172), Expect = 7.808e-12
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPEDQ WFC +C
Sbjct:  835 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIVAEPPEDQPWFCVKC 887          
BLAST of PHD-type domain-containing protein vs. Ensembl Medaka
Match: taf3 (TATA-box binding protein associated factor 3 [Source:NCBI gene;Acc:101163568])

HSP 1 Score: 70.4774 bits (171), Expect = 1.017e-11
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 3212 EDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRC 3370
            E G  ++ICP C+  DDG  M+GC+ C+DWYH  C+ +   PPEDQ WFC +C
Sbjct:  888 EWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIVAEPPEDQPWFCVKC 940          
BLAST of PHD-type domain-containing protein vs. Planmine SMEST
Match: SMESG000069975.1 (SMESG000069975.1)

HSP 1 Score: 1739.93 bits (4505), Expect = 0.000e+0
Identity = 1088/1091 (99.73%), Postives = 1090/1091 (99.91%), Query Frame = 2
Query:  113 MESHYKDSLSTAIVNILLQCGFENSSKRALDELIGMSLNYMKNITLKISNLTNECNLPETDILIGLGALKLHGHNLDELFDFVQNYNDIFPPPPKTYFGPIPLKSIEPKKLEEKPLGIVSWAPEMSSSLATIGMKLKNRQIVSDPNFDRSNYLALSLNSPPLKNSEYRTNDXXXXXXXXXXXXXXXYGSNCSYELPPEAYPNKYEPPTIDLDSNGAVIGLNGKIGKLPDPFINDIEEQDLLRQKSKFHDINLSKLSYSNHQLFNGVRQRKLNKSTEEISKRLSTPNRSLLESTTDEEMKENISKIHNNQENSPCPYLITNDNSLNYKPNHQVDRNAISDDVWNAALQATVDQSELFXXXXXXXXXXXXXXLPTNTNDXXXXXXXXXXXXXXXXXXXXFSSSRPKKTRKIEVGEKIVEIDSQVCKNESTMDSYVSDRSVPYSSPSDREQPLYNRNDQFREQATGFREKSPSYSPINNFVPADSMYYQTEIIPSSPPTQXXXXXXXXXXXXXXXTHFSNKRKKKSFYPSSTVGNNFCSMVTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSSNRTEFNDNASISQRSLSINYDNRSNTPLSPHPPVDTCFEDSDDDRTEPMVESSEELIKMLEMTDDTIRRGRQHQQPNSVHAIEXXXXXXXXXXXXXXXXXXXXXXXXXXXHDTHNPIANTPXXXXXXXXXXXXXXXXXXXIRMKIKFRKSKNSIVRGASSIVNSNTDLSSPIQSQHSDDKNSISERLQLMQYHSPLSDIDEARHPHSSFDKSSNHSNYGAIQPPHSPAYSSMQESPMRDLYRFDNSVASVGAGSSTFSKPPTPNKLIIRPSNFGVIRFNSSSTHSSPKTLPALDDCDKVPNLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNHEQQIQKPMEKPXXXXXXXXXXXXXXXXKSEPNHFNTVSVNNSRPSISDRPPIIHQSQLPLLISSPPHGIMXXXXXXXXXXXXXXXXXXXXXXXXXXTAHLPAISQIENKTTYNYPCLPGEAHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLEDML 3385
            MESHYKDSLSTAIVNILLQCGFENSSKRALDELIGMSLNYMKNITLKISNLTNECNLPETDILIGLGALKLHGHNLDELFDFVQNYNDIFPPPPKTYFGPIPLKSIEPKKLEEKPLGIVSWAPEMSSSLATIGMKLKNRQIVSDPNFDRSNYLALSLNSPPLKNSEYRTNDQSKSSINNMNSKIQKYGSNCSYELPPEAYPNKYEPPTIDLDSNGAVIGLNGKIGKLPDPFINDIEEQDLLRQKSKFHDINLSKLSYSNHQLFNGVRQRKLNKSTEEISKRLSTPNRSLLESTTDEEMKENISKIHNNQENSPCPYLITNDNSLNYKPNHQVDRNAISDDVWNAALQATVDQSELFISTASSIVTSISTSLPTNTNDSLAQSIKSSKKAKKHKRNSSFSSSRPKKTRKIEVGEKIVEIDSQVCKNESTMDSYVSDRSVPYSSPSDREQPLYNRNDQFREQATGFREKSPSYSPINNFVPADSMYYQTEIIPSSPPTQSVTKPFKAKKKSSRKTHFSNKRKKKSFYPSSTVGNNFCSMVTNHHQQHNPHEHQQQQLYHHHHHQQHHIEHNSSNRTEFNDNASISQRSLSINYDNRSNTPLSPHPPVDTCFEDSDDDRTEPMVESSEELIKMLEMTDDTIRRGRQHQQPNSVHAIESPPPSPPSLQQPVNSNQQNTRINIQNQHDTHNPIANTPGLSGTAAA+VGGGGGSSGGIRMKIKFRKSKNSIVRGASSIVNSNTDLSSPIQSQHSDDKNSISERLQLMQYHSPLSDIDEARHPHSSFDKSSNHSNYGAIQPP SPAYSSMQESPMRDLYRFDNSVASVGAGSSTFSKPPTPNKLIIRPSNFGVIRFNSSSTHSSPKTLPALDDCDKVPNLQLKTSKSVKKRKRSRLSSGSKK+KSKKSVKLKPNHEQQIQKPMEKPFVSVDDIFSDEDDIIIKSEPNHFNTVSVNNSRPSISDRPPIIHQSQLPLLISSPPHGIMSIPSVNSINSKSSVKKSSKSKHKSINTAHLPAISQIENKTTYNYPCLPGEAHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLEDML
Sbjct:    1 MESHYKDSLSTAIVNILLQCGFENSSKRALDELIGMSLNYMKNITLKISNLTNECNLPETDILIGLGALKLHGHNLDELFDFVQNYNDIFPPPPKTYFGPIPLKSIEPKKLEEKPLGIVSWAPEMSSSLATIGMKLKNRQIVSDPNFDRSNYLALSLNSPPLKNSEYRTNDQSKSSINNMNSKIQKYGSNCSYELPPEAYPNKYEPPTIDLDSNGAVIGLNGKIGKLPDPFINDIEEQDLLRQKSKFHDINLSKLSYSNHQLFNGVRQRKLNKSTEEISKRLSTPNRSLLESTTDEEMKENISKIHNNQENSPCPYLITNDNSLNYKPNHQVDRNAISDDVWNAALQATVDQSELFISTASSIVTSISTSLPTNTNDSLAQSIKSSKKAKKHKRNSSFSSSRPKKTRKIEVGEKIVEIDSQVCKNESTMDSYVSDRSVPYSSPSDREQPLYNRNDQFREQATGFREKSPSYSPINNFVPADSMYYQTEIIPSSPPTQSVTKPFKAKKKSSRKTHFSNKRKKKSFYPSSTVGNNFCSMVTNHHQQHNPHEHQQQQLYHHHHHQQHHIEHNSSNRTEFNDNASISQRSLSINYDNRSNTPLSPHPPVDTCFEDSDDDRTEPMVESSEELIKMLEMTDDTIRRGRQHQQPNSVHAIESPPPSPPSLQQPVNSNQQNTRINIQNQHDTHNPIANTPGLSGTAAAVVGGGGGSSGGIRMKIKFRKSKNSIVRGASSIVNSNTDLSSPIQSQHSDDKNSISERLQLMQYHSPLSDIDEARHPHSSFDKSSNHSNYGAIQPPQSPAYSSMQESPMRDLYRFDNSVASVGAGSSTFSKPPTPNKLIIRPSNFGVIRFNSSSTHSSPKTLPALDDCDKVPNLQLKTSKSVKKRKRSRLSSGSKKMKSKKSVKLKPNHEQQIQKPMEKPFVSVDDIFSDEDDIIIKSEPNHFNTVSVNNSRPSISDRPPIIHQSQLPLLISSPPHGIMSIPSVNSINSKSSVKKSSKSKHKSINTAHLPAISQIENKTTYNYPCLPGEAHYTSEDGKLVYICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLEDML 1091          
The following BLAST results are available for this feature:
BLAST of PHD-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TAF35.149e-1147.17TATA-box binding protein associated factor 3 [Sour... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
taf-32.937e-840.35TAF (TBP-associated transcription factor) family ... [more]
taf-35.750e-841.82TAF (TBP-associated transcription factor) family ... [more]
taf-36.184e-841.82TAF (TBP-associated transcription factor) family ... [more]
taf-36.318e-840.35TAF (TBP-associated transcription factor) family ... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bip21.810e-1138.98gene:FBgn0026262 transcript:FBtr0089110[more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf36.804e-1250.94TAF3 RNA polymerase II, TATA box binding protein (... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TAF36.836e-1249.06TATA-box binding protein associated factor 3 [Sour... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Taf34.005e-1147.17TATA-box binding protein associated factor 3 [Sour... [more]
Taf34.590e-1147.17TATA-box binding protein associated factor 3 [Sour... [more]
Taf36.869e-1147.17TATA-box binding protein associated factor 3 [Sour... [more]
Taf36.006e-648.48TATA-box binding protein associated factor 3 [Sour... [more]
back to top
BLAST of PHD-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5EAW9|TAF3_XENLA1.870e-1149.06Transcription initiation factor TFIID subunit 3 OS... [more]
sp|Q5VWG9|TAF3_HUMAN2.473e-1047.17Transcription initiation factor TFIID subunit 3 OS... [more]
sp|Q5HZG4|TAF3_MOUSE4.805e-1047.17Transcription initiation factor TFIID subunit 3 OS... [more]
sp|Q5F489|TAF3_CHICK7.404e-1045.28Transcription initiation factor TFIID subunit 3 OS... [more]
back to top
BLAST of PHD-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GIU53.009e-1340.24PHD-type domain-containing protein OS=Macrostomum ... [more]
A0A553PGL51.696e-1249.15PHD-type domain-containing protein (Fragment) OS=T... [more]
A0A2J7PLB72.250e-1244.29PHD-type domain-containing protein OS=Cryptotermes... [more]
A0A0K2TYK92.555e-1247.46Transcription initiation factor TFIID subunit 3lik... [more]
A0A183B7Q52.820e-1240.70PHD-type domain-containing protein OS=Echinostoma ... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf35.751e-1249.06TATA-box binding protein associated factor 3 [Sour... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006999.12.829e-1145.76pep scaffold:Pmarinus_7.0:GL484485:3565:11554:-1 g... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PHD-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf37.808e-1250.94TATA-box binding protein associated factor 3 [Sour... [more]
taf31.017e-1150.94TATA-box binding protein associated factor 3 [Sour... [more]
back to top
BLAST of PHD-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000069975.10.000e+099.73SMESG000069975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033913 ID=SMED30033913|Name=PHD-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3557bp
CTAAATGCTGGTAAAAATTGTAGCTAACGAATAATATGATAATAAAAAAG
AAATAATTAGCTTATTTCTTTAGAAAATATTAATGAGAAATGTTTCTTTA
ATTGAATTTGATATGGAGTCACATTACAAAGATTCTCTATCAACTGCTAT
TGTAAATATTTTACTTCAATGCGGTTTTGAGAATTCTTCTAAAAGGGCAT
TGGATGAATTGATTGGAATGTCACTTAATTACATGAAAAACATTACTTTA
AAGATCTCAAACCTTACAAATGAATGTAATTTACCAGAAACAGATATTTT
AATTGGTCTCGGTGCACTGAAATTGCATGGCCATAATCTTGACGAGTTGT
TTGATTTTGTACAGAACTATAATGATATATTTCCACCTCCTCCAAAAACC
TATTTTGGTCCAATACCATTAAAATCCATTGAACCGAAAAAACTCGAAGA
AAAACCTTTAGGAATCGTTTCATGGGCTCCTGAAATGTCTTCATCGTTAG
CTACTATTGGAATGAAATTAAAAAACAGACAGATTGTTTCGGATCCTAAC
TTCGATCGATCAAATTACTTAGCTCTTTCACTCAATTCACCACCTCTAAA
GAATTCAGAATACCGAACAAATGATCAATCGAAATCATCAATTAACAATA
TGAATAGTAAAATTCAAAAGTATGGTTCAAATTGCTCATATGAATTGCCA
CCAGAAGCCTATCCAAACAAATATGAGCCTCCCACAATCGACCTCGATTC
CAACGGTGCCGTTATCGGTCTAAATGGAAAAATCGGCAAATTGCCAGATC
CATTTATCAACGATATCGAAGAACAGGATCTATTGCGCCAGAAATCTAAA
TTCCACGACATAAATCTATCAAAATTGTCATATTCCAACCACCAGTTGTT
TAATGGAGTACGACAGAGGAAATTGAACAAATCCACCGAGGAAATATCGA
AGCGGTTGTCGACACCGAATCGATCGCTGCTGGAATCTACAACCGATGAG
GAAATGAAAGAAAACATTTCAAAGATTCACAATAACCAAGAGAATTCTCC
ATGCCCGTATTTAATCACCAATGACAACAGTCTAAACTACAAGCCGAATC
ACCAGGTCGACCGAAACGCAATCAGTGATGACGTGTGGAACGCAGCACTG
CAAGCCACAGTCGACCAGTCGGAATTATTCATTTCTACTGCCAGCAGCAT
AGTAACTTCGATTAGCACCTCCCTGCCGACCAATACCAACGATTCATTAG
CTCAATCCATCAAATCAAGCAAAAAAGCCAAAAAACACAAACGGAACTCT
TCATTCTCCAGTTCCAGGCCAAAGAAAACCCGAAAGATCGAAGTGGGTGA
AAAAATTGTCGAAATCGATTCTCAGGTCTGTAAAAACGAATCGACAATGG
ATTCCTATGTGTCTGATAGATCTGTGCCTTATTCCTCGCCGTCAGACAGG
GAGCAGCCCCTATATAATCGCAACGATCAATTCCGAGAGCAAGCAACTGG
CTTTCGGGAGAAATCGCCGAGTTATTCGCCTATCAATAATTTTGTGCCTG
CAGACAGCATGTATTACCAGACTGAAATTATCCCGTCATCTCCCCCCACT
CAGTCCGTTACGAAGCCATTCAAGGCCAAGAAAAAGTCATCTCGAAAAAC
TCATTTTTCCAACAAACGGAAAAAGAAATCGTTTTATCCATCATCGACAG
TTGGGAACAATTTCTGCTCCATGGTGACGAATCACCATCAGCAACACAAT
CCCCATGAGCACCAGCAGCAGCAGCTGTACCATCACCACCACCATCAGCA
GCATCACATTGAGCACAACTCATCAAATCGCACTGAATTCAATGACAATG
CGTCAATCAGCCAACGGTCGCTGTCGATCAATTACGATAATCGATCTAAC
ACTCCATTAAGTCCCCACCCTCCTGTTGACACGTGTTTTGAGGATTCAGA
CGATGATCGCACCGAACCAATGGTGGAATCATCAGAAGAACTAATCAAAA
TGCTAGAAATGACCGACGATACAATCAGACGAGGACGACAGCATCAGCAG
CCGAACTCGGTCCATGCTATCGAATCTCCTCCGCCGTCGCCACCATCACT
TCAGCAGCCCGTGAATAGCAACCAACAGAACACTCGTATAAATATCCAGA
ATCAGCATGATACTCACAATCCAATCGCTAACACACCCGGTCTCAGTGGA
ACAGCAGCAGCGTTAGTAGGAGGAGGAGGGGGCAGCAGTGGCGGAATCAG
AATGAAAATCAAATTCAGGAAAAGCAAAAATTCAATCGTCAGAGGTGCCA
GCTCAATTGTCAATAGTAACACAGATCTTTCATCACCAATTCAGTCTCAG
CATTCAGATGATAAAAACTCTATATCAGAACGCCTTCAACTCATGCAATA
TCACAGCCCTTTGTCGGATATTGATGAAGCTCGCCATCCACACAGCTCTT
TCGACAAGTCGTCTAACCACTCGAATTACGGCGCTATCCAGCCTCCTCAC
AGCCCGGCATACTCATCGATGCAAGAATCACCAATGAGAGATCTGTACAG
GTTCGATAACTCGGTTGCCAGTGTCGGTGCTGGCTCGTCAACATTCTCCA
AACCCCCGACTCCCAATAAGCTCATTATCAGACCTTCAAATTTCGGTGTC
ATCCGTTTCAATTCCTCTTCGACTCATTCTTCTCCGAAAACTCTACCTGC
TCTAGATGACTGTGATAAAGTACCGAACCTTCAGTTGAAAACCAGTAAAT
CAGTAAAGAAAAGGAAACGGTCGCGATTAAGTTCAGGTTCCAAGAAAGTG
AAATCAAAGAAATCTGTGAAATTAAAACCGAATCACGAGCAACAAATACA
GAAACCAATGGAGAAACCGTTTGTTTCAGTTGATGATATATTTTCAGACG
AAGACGATATAATCATCAAATCAGAACCCAATCATTTTAACACAGTGAGT
GTAAACAACTCGCGGCCATCAATTTCCGACAGACCGCCAATCATCCACCA
ATCACAACTACCGTTACTTATCAGTTCTCCGCCACACGGAATAATGTCTA
TTCCATCAGTTAATTCCATCAATTCAAAATCATCAGTAAAAAAATCATCC
AAATCCAAACACAAATCCATCAACACCGCTCATCTTCCGGCTATTTCTCA
AATTGAAAATAAAACCACTTATAATTATCCCTGCCTTCCGGGCGAAGCAC
ATTACACTTCAGAAGATGGGAAGCTCGTCTACATTTGTCCGATATGCAGT
GGTGAAGATGATGGGTTTCTAATGTTGGGCTGTGAACGATGTGAAGACTG
GTATCATGGGCGTTGTTTGAAAGTATACAATCCTCCACCAGAAGACCAAG
ATTGGTTTTGTCAAAGATGTCTTGAAGATATGTTAAAAGGAAGCCAAAAT
AAAGGAAATTCTAAATCCAATTCAAAAAGTCGAACTAAAAAGAAATAAAG
ATTTATTTTGAAGATTCATTAAACTAATTCTATCAAATGTTCTTGTATAT
ATAAAAGAGAAAATCATTTAACCTTATTTATATTGTAATTTTTTTATGAG
AATGGTG
back to top

protein sequence of SMED30033913-orf-1

>SMED30033913-orf-1 ID=SMED30033913-orf-1|Name=SMED30033913-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1122bp
MRNVSLIEFDMESHYKDSLSTAIVNILLQCGFENSSKRALDELIGMSLNY
MKNITLKISNLTNECNLPETDILIGLGALKLHGHNLDELFDFVQNYNDIF
PPPPKTYFGPIPLKSIEPKKLEEKPLGIVSWAPEMSSSLATIGMKLKNRQ
IVSDPNFDRSNYLALSLNSPPLKNSEYRTNDQSKSSINNMNSKIQKYGSN
CSYELPPEAYPNKYEPPTIDLDSNGAVIGLNGKIGKLPDPFINDIEEQDL
LRQKSKFHDINLSKLSYSNHQLFNGVRQRKLNKSTEEISKRLSTPNRSLL
ESTTDEEMKENISKIHNNQENSPCPYLITNDNSLNYKPNHQVDRNAISDD
VWNAALQATVDQSELFISTASSIVTSISTSLPTNTNDSLAQSIKSSKKAK
KHKRNSSFSSSRPKKTRKIEVGEKIVEIDSQVCKNESTMDSYVSDRSVPY
SSPSDREQPLYNRNDQFREQATGFREKSPSYSPINNFVPADSMYYQTEII
PSSPPTQSVTKPFKAKKKSSRKTHFSNKRKKKSFYPSSTVGNNFCSMVTN
HHQQHNPHEHQQQQLYHHHHHQQHHIEHNSSNRTEFNDNASISQRSLSIN
YDNRSNTPLSPHPPVDTCFEDSDDDRTEPMVESSEELIKMLEMTDDTIRR
GRQHQQPNSVHAIESPPPSPPSLQQPVNSNQQNTRINIQNQHDTHNPIAN
TPGLSGTAAALVGGGGGSSGGIRMKIKFRKSKNSIVRGASSIVNSNTDLS
SPIQSQHSDDKNSISERLQLMQYHSPLSDIDEARHPHSSFDKSSNHSNYG
AIQPPHSPAYSSMQESPMRDLYRFDNSVASVGAGSSTFSKPPTPNKLIIR
PSNFGVIRFNSSSTHSSPKTLPALDDCDKVPNLQLKTSKSVKKRKRSRLS
SGSKKVKSKKSVKLKPNHEQQIQKPMEKPFVSVDDIFSDEDDIIIKSEPN
HFNTVSVNNSRPSISDRPPIIHQSQLPLLISSPPHGIMSIPSVNSINSKS
SVKKSSKSKHKSINTAHLPAISQIENKTTYNYPCLPGEAHYTSEDGKLVY
ICPICSGEDDGFLMLGCERCEDWYHGRCLKVYNPPPEDQDWFCQRCLEDM
LKGSQNKGNSKSNSKSRTKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046982protein heterodimerization activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003743translation initiation factor activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR009072Histone-fold
IPR001965Znf_PHD
IPR019787Znf_PHD-finger
IPR013083Znf_RING/FYVE/PHD
IPR031498Bromo_TP-like
IPR019786Zinc_finger_PHD-type_CS
IPR011011Znf_FYVE_PHD
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 1051..1097
e-value: 2.4E-9
score: 47.1
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 10..99
e-value: 3.3E-5
score: 25.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1037..1102
e-value: 5.9E-16
score: 59.9
IPR031498Bromodomain associated protein-likePFAMPF17027Bromo_TP_likecoord: 19..70
e-value: 2.0E-4
score: 21.5
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 1051..1098
e-value: 6.2E-10
score: 38.8
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1049..1099
score: 9.57
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 392..421
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 395..411
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 552..585
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 652..680
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 437..458
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 501..534
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 888..912
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 865..922
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 514..531
NoneNo IPR availablePANTHERPTHR46452FAMILY NOT NAMEDcoord: 145..1121
NoneNo IPR availableCDDcd15522PHD_TAF3coord: 1051..1096
e-value: 1.15625E-19
score: 81.1793
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 1052..1096
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1040..1099