UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4

Overview
NameUDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Smed IDSMED30033909
Length (bp)1763
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (SMED30033909) t-SNE clustered cells

Violin plots show distribution of expression levels for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (SMED30033909) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (SMED30033909) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (SMED30033909) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033909

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033909SMESG000066601.1 dd_Smed_v6_12354_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033909SMESG000066601.1 dd_Smed_v4_12354_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Human
Match: LRRC43 (leucine rich repeat containing 43 [Source:HGNC Symbol;Acc:HGNC:28562])

HSP 1 Score: 91.2781 bits (225), Expect = 1.363e-18
Identity = 96/325 (29.54%), Postives = 150/325 (46.15%), Query Frame = 2
Query:  104 FHNFPCGNGSWNISD-------DYNE---------NPAXXXXXXXXXXXXXRLSPWVEEEILQNEIME---IKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILS-------------GNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNI-----PFKEKPENSPEEPVIKTDYYAKFWF 964
               FPCG GSWN S         + E         +P    ++ L+ L++ R SPW    +L N   E   +++  I N    +    +  F+ L+++DK +  V  D+  FL LEEL LSAN IK +D+  LP  LKVLELY NE+ S+E         LQHLG+G N L+  ++ L  +      +                   +++++L++++ S             GNPL+L   YR   IDS+  L VLDD  ++ +E+   R ++   + +    +F   +++IGNI          PE  PE P I  +YY  + F
Sbjct:   40 LREFPCGAGSWNKSRFLPQTWRTWRELVPREEDVVSPGEETVEALLGLVRSRHSPWA---LLNNSNAEDSFLRELAIRNPLTITDTFFYSYFRSLRVIDKKVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHLGLGHNKLLGPLESLYVTANHWPNLVSLDLG------------FNDLTDLQSMVTSLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNGDLLAQEAQF---VVTIGNIRGVLDTSVLDPEPRPEGPFITYNYYVTYDF 346          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Xenopus
Match: LRRC43 (leucine rich repeat containing 43 [Source:NCBI gene;Acc:100491502])

HSP 1 Score: 105.531 bits (262), Expect = 2.838e-23
Identity = 98/307 (31.92%), Postives = 149/307 (48.53%), Query Frame = 2
Query:  110 NFPCGN-GSWN----------ISDDY--NENPAXXXXXXXXXXXXXRLSPWVEEEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVI-----ISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIP----FKEKPENSPEEPVIKTDYYAKFWF 964
            +FPCG  GS N           SD Y  NE+P    +D L +LL    SPW  E+    E  ++++  + + E+ + + ++  F+ L++VDK +  V   +  F+NLEEL LSAN I +  S  LP+ LKVLEL +N++ +L+       P LQHLG+  N I +    S S         +L    LS    T +      +  + +L+ L+L GNPL+   AYR + IDS+  L  LDD PI  DER     +      ++      + I  +  IP    F E  ++  E P+I  +YY  + F
Sbjct:   21 SFPCGTKGSRNKSSLESGKSLYSDTYWENEDPEEETLDTLQELLTCSRSPWGLEDSWSCEAQQLRQLAVQSPELITNQLIYSHFRSLRVVDKEVTSVDEQLLNFINLEELVLSANKITNASSSSLPQTLKVLELGSNQISTLKDLTVNPPPKLQHLGLAYNRIQHP---SESKYFTEEFWPNLVSLDLSFNDLTDIFDLVPNLCSLQHLRILVLQGNPLTFIPAYRGFTIDSLPLLFALDDVPILPDERHQFSGLLNQKGALEKSAMVLVNIGKLRGIPNPTNFLEA-QDPGEYPIITYNYYVSYEF 323          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Mouse
Match: Lrrc43 (leucine rich repeat containing 43 [Source:MGI Symbol;Acc:MGI:2685907])

HSP 1 Score: 98.2117 bits (243), Expect = 6.402e-21
Identity = 78/242 (32.23%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVI-ISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFK-----EKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEI 1042
            V+K +  V  D+  FL LEEL LSAN I+ ID+  LP  LKVLELY N + S+E   +   P LQHLG+G N L+  ++ L  +      +             +  ++ +S + +L+ L+L GNPLSL   YR + IDS+  L VLDD  ++ +E+   R +    + +    +F   +++IGN+          PE  P+ P I   YY  + F        +     E T+ + + DEI
Sbjct:  132 VNKGVSLVDKDLLKFLKLEELVLSANKIEEIDANNLPPTLKVLELYGNLIASMECLCSAPPPRLQHLGLGHNKLLGPLESLYVTSHNWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQGNPLSLVPYYRGFTIDSLAHLCVLDDITVSPNEKHQFRGLNIHGDLLAREAQF---VVTIGNVRGVLDSSILDPEPGPDGPFISYSYYVTYDFVEDEDMERNVSGLVEATHHDSVLDEI 370          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Mouse
Match: Lrrc43 (leucine rich repeat containing 43 [Source:MGI Symbol;Acc:MGI:2685907])

HSP 1 Score: 98.2117 bits (243), Expect = 6.533e-21
Identity = 78/242 (32.23%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVI-ISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFK-----EKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEI 1042
            V+K +  V  D+  FL LEEL LSAN I+ ID+  LP  LKVLELY N + S+E   +   P LQHLG+G N L+  ++ L  +      +             +  ++ +S + +L+ L+L GNPLSL   YR + IDS+  L VLDD  ++ +E+   R +    + +    +F   +++IGN+          PE  P+ P I   YY  + F        +     E T+ + + DEI
Sbjct:  132 VNKGVSLVDKDLLKFLKLEELVLSANKIEEIDANNLPPTLKVLELYGNLIASMECLCSAPPPRLQHLGLGHNKLLGPLESLYVTSHNWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQGNPLSLVPYYRGFTIDSLAHLCVLDDITVSPNEKHQFRGLNIHGDLLAREAQF---VVTIGNVRGVLDSSILDPEPGPDGPFISYSYYVTYDFVEDEDMERNVSGLVEATHHDSVLDEI 370          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Mouse
Match: Lrrc43 (leucine rich repeat containing 43 [Source:MGI Symbol;Acc:MGI:2685907])

HSP 1 Score: 97.8265 bits (242), Expect = 7.090e-21
Identity = 78/242 (32.23%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVI-ISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFK-----EKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEI 1042
            V+K +  V  D+  FL LEEL LSAN I+ ID+  LP  LKVLELY N + S+E   +   P LQHLG+G N L+  ++ L  +      +             +  ++ +S + +L+ L+L GNPLSL   YR + IDS+  L VLDD  ++ +E+   R +    + +    +F   +++IGN+          PE  P+ P I   YY  + F        +     E T+ + + DEI
Sbjct:  132 VNKGVSLVDKDLLKFLKLEELVLSANKIEEIDANNLPPTLKVLELYGNLIASMECLCSAPPPRLQHLGLGHNKLLGPLESLYVTSHNWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQGNPLSLVPYYRGFTIDSLAHLCVLDDITVSPNEKHQFRGLNIHGDLLAREAQF---VVTIGNVRGVLDSSILDPEPGPDGPFISYSYYVTYDFVEDEDMERNVSGLVEATHHDSVLDEI 370          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q3V0L5|LRC43_MOUSE (Leucine-rich repeat-containing protein 43 OS=Mus musculus OX=10090 GN=Lrrc43 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.960e-20
Identity = 78/242 (32.23%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVI-ISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFK-----EKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEI 1042
            V+K +  V  D+  FL LEEL LSAN I+ ID+  LP  LKVLELY N + S+E   +   P LQHLG+G N L+  ++ L  +      +             +  ++ +S + +L+ L+L GNPLSL   YR + IDS+  L VLDD  ++ +E+   R +    + +    +F   +++IGN+          PE  P+ P I   YY  + F        +     E T+ + + DEI
Sbjct:  132 VNKGVSLVDKDLLKFLKLEELVLSANKIEEIDANNLPPTLKVLELYGNLIASMECLCSAPPPRLQHLGLGHNKLLGPLESLYVTSHNWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQGNPLSLVPYYRGFTIDSLAHLCVLDDITVSPNEKHQFRGLNIHGDLLAREAQF---VVTIGNVRGVLDSSILDPEPGPDGPFISYSYYVTYDFVEDEDMERNVSGLVEATHHDSVLDEI 370          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q8N309|LRC43_HUMAN (Leucine-rich repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=LRRC43 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 6.547e-18
Identity = 96/325 (29.54%), Postives = 150/325 (46.15%), Query Frame = 2
Query:  104 FHNFPCGNGSWNISD-------DYNE---------NPAXXXXXXXXXXXXXRLSPWVEEEILQNEIME---IKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILS-------------GNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNI-----PFKEKPENSPEEPVIKTDYYAKFWF 964
               FPCG GSWN S         + E         +P    ++ L+ L++ R SPW    +L N   E   +++  I N    +    +  F+ L+++DK +  V  D+  FL LEEL LSAN IK +D+  LP  LKVLELY NE+ S+E         LQHLG+G N L+  ++ L  +      +                   +++++L++++ S             GNPL+L   YR   IDS+  L VLDD  ++ +E+   R ++   + +    +F   +++IGNI          PE  PE P I  +YY  + F
Sbjct:   40 LREFPCGAGSWNKSRFLPQTWRTWRELVPREEDVVSPGEETVEALLGLVRSRHSPWA---LLNNSNAEDSFLRELAIRNPLTITDTFFYSYFRSLRVIDKKVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHLGLGHNKLLGPLESLYVTANHWPNLVSLDLG------------FNDLTDLQSMVTSLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNGDLLAQEAQF---VVTIGNIRGVLDTSVLDPEPRPEGPFITYNYYVTYDF 346          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q95JT3|LRC43_MACFA (Leucine-rich repeat-containing protein 43 OS=Macaca fascicularis OX=9541 GN=LRRC43 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.283e-17
Identity = 99/346 (28.61%), Postives = 157/346 (45.38%), Query Frame = 2
Query:  104 FHNFPCGNGSWNISD-------DYNE---------NPAXXXXXXXXXXXXXRLSPWV-------EEEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGN-LISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILS-------------GNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNI-----PFKEKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELT 1015
               FPCG GSWN S         + E         +P    ++ L+ L++   SPW        E+  L+   + I+  L+I     +    +  F+ L++VDK +  V  D+  FL LEEL LSAN IK +D+  LP  LKVLELY NE+ S+E         LQHLG+G N L+  ++ L  +      +                   +++++L++++ S             GNPL+L   YR   IDS+  L VLDD  ++ +E+   R ++   + +    +F   +++IGNI          PE  PE P +   YY  + F  + +   + E+T EL 
Sbjct:   38 LREFPCGAGSWNKSRFLPQTWRTWRELVPKEEDVVSPGEETVEALLGLVRSPHSPWALLNDSNAEDSFLRE--LAIRNPLMI-----TDTFFYSYFRSLRVVDKEVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHLGLGHNKLLGPLESLYVTADHWPNLVSLDLG------------FNDLTDLQSMVASLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNGDLLAQEAQF---VVTIGNIRGVLDTSVLDPEPGPEGPFVAYSYYVTYDF-VRDEEGEAVEDTGELA 360          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. TrEMBL
Match: A0A1S3ISY0 (leucine-rich repeat-containing protein 43 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106167050 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.740e-31
Identity = 89/212 (41.98%), Postives = 129/212 (60.85%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK---PENSPEEPVIKTDYYAKFWF 964
            +DK + E+  ++  F NLEELTL+AN +  ++SK LP++LKVLEL AN++  L F    D P L HLG+G N ++ +D          ++SLDLS N LS+L +    +S +  L+NL+L GNPL +   YR Y+IDS+K L +LDD  I+ADER   + +AK  E + +  KF  E+  I  +P  E+   PE  PE P+I+  YY +F F
Sbjct:  137 IDKGVTEIDENLLNFTNLEELTLTANLLCQVNSKNLPRSLKVLELCANQICDL-FSLCVDPPPLHHLGLGYNQLTYLDEYMTGDYWPQLLSLDLSHNTLSDLVEVVRKLSTLPKLRNLVLHGNPLCVIPGYRGYVIDSLKKLFLLDDIRISADERHHFKGLAKRKEFILDEAKFTFEVKYIKGVPMPEEMKNPEEQPEFPIIERKYYVQFMF 347          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. TrEMBL
Match: A0A1S3ISJ5 (leucine-rich repeat-containing protein 43 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106167050 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 7.686e-31
Identity = 89/212 (41.98%), Postives = 129/212 (60.85%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK---PENSPEEPVIKTDYYAKFWF 964
            +DK + E+  ++  F NLEELTL+AN +  ++SK LP++LKVLEL AN++  L F    D P L HLG+G N ++ +D          ++SLDLS N LS+L +    +S +  L+NL+L GNPL +   YR Y+IDS+K L +LDD  I+ADER   + +AK  E + +  KF  E+  I  +P  E+   PE  PE P+I+  YY +F F
Sbjct:  137 IDKGVTEIDENLLNFTNLEELTLTANLLCQVNSKNLPRSLKVLELCANQICDL-FSLCVDPPPLHHLGLGYNQLTYLDEYMTGDYWPQLLSLDLSHNTLSDLVEVVRKLSTLPKLRNLVLHGNPLCVIPGYRGYVIDSLKKLFLLDDIRISADERHHFKGLAKRKEFILDEAKFTFEVKYIKGVPMPEEMKNPEEQPEFPIIERKYYVQFMF 347          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. TrEMBL
Match: A0A1S3ITC6 (leucine-rich repeat-containing protein 43 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106167050 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.828e-31
Identity = 89/212 (41.98%), Postives = 129/212 (60.85%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK---PENSPEEPVIKTDYYAKFWF 964
            +DK + E+  ++  F NLEELTL+AN +  ++SK LP++LKVLEL AN++  L F    D P L HLG+G N ++ +D          ++SLDLS N LS+L +    +S +  L+NL+L GNPL +   YR Y+IDS+K L +LDD  I+ADER   + +AK  E + +  KF  E+  I  +P  E+   PE  PE P+I+  YY +F F
Sbjct:  137 IDKGVTEIDENLLNFTNLEELTLTANLLCQVNSKNLPRSLKVLELCANQICDL-FSLCVDPPPLHHLGLGYNQLTYLDEYMTGDYWPQLLSLDLSHNTLSDLVEVVRKLSTLPKLRNLVLHGNPLCVIPGYRGYVIDSLKKLFLLDDIRISADERHHFKGLAKRKEFILDEAKFTFEVKYIKGVPMPEEMKNPEEQPEFPIIERKYYVQFMF 347          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. TrEMBL
Match: A0A210QTV4 (Leucine-rich repeat-containing protein 43 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15713 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.909e-28
Identity = 93/232 (40.09%), Postives = 134/232 (57.76%), Query Frame = 2
Query:  338 VDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK---PENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDN 1024
            VDK + EV +++  F NL+ELTLSAN + +++SK LP NLKVLEL AN++  L     +    + HLG+G N IS +           ++SLDLS N L++L      +  +  L+NLIL GNPLSL A YR Y IDS++ L VLDD  I+ADER   + +AK  E + +  K  + +  I  +P  E+   PE  PE PVI+  YY +F F     + A   +  E+++D+
Sbjct:  120 VDKGVTEVDSNLLHFKNLKELTLSANHLVTVNSKHLPPNLKVLELCANKISDLSALCVRPPQSMIHLGLGFNKISFMGDYLTGDYWPQMLSLDLSNNNLTDLLDVVRKLGTLPKLRNLILQGNPLSLIAGYRGYTIDSMRKLSVLDDIMISADERHHYKGLAKRREYILDEAKVTLHVSYIKGLPVPEEVKNPEEQPEFPVIERKYYVQFMF---LHDTAGKGDMLEVSHDD 348          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. TrEMBL
Match: A0A267H0G3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034003g3 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.278e-28
Identity = 86/213 (40.38%), Postives = 127/213 (59.62%), Query Frame = 2
Query:  341 DKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK---PENSPEEPVIKTDYYAKFWFPF 970
            DKN+ E+  D+    NLEEL LSAN++  ID + LP  LKVLEL+ N +E L     K  P L+HLG+G N ++ I      +    ++SLDLS N L +L      +S +  L++L+L+GNPL+L   YR Y ID +K L+ LDD  +TADER   R M +  E ++  C+ ++++ S+ N+P   +   P++ PE P+I   YY +FW PF
Sbjct:  138 DKNVDEIDKDMKRLTNLEELVLSANYLTWIDGQNLPPTLKVLELHGNFVEDLAGLLPKPPPLLEHLGIGRNNLAFIGEHLNGVYWPCLLSLDLSFNHLDDLKSLLESLSSLPKLRSLVLAGNPLALTPWYRGYTIDQLKKLLSLDDSKVTADERHFYRGMVRRREFVQEQCQLQLKVHSLKNLPIPPEILSPDDFPEYPLIVRKYYVRFWLPF 350          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Nematostella
Match: EDO44581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI3])

HSP 1 Score: 87.0409 bits (214), Expect = 9.976e-19
Identity = 85/297 (28.62%), Postives = 133/297 (44.78%), Query Frame = 2
Query:  113 FPCGNGSWNISDDY----------NENPAXXXXXXXXXXXXXRLSPWVEEEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESL-EFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLS-----------------------------------------------LFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKI 829
            FPCG G W +  D           +  P                +P+  +    +E   +++  + N E  +   +   FK L++VDK + E+   +  F NL++LTLSAN I  +DS+ LPK LK LEL AN++  +   C+N   P L HLG+G N I++I      +  + ++SLDLS N L +L  T   +  +  L+NL++ GNPL+                                               L   YR Y+IDSI+ L +LDD  I+ADE+   + ++K+
Sbjct:   27 FPCGFGQWRVPSDTIFGTTVKSMTSPEPTACYETVEDLQELAIKTPYNVDCTWSSEATTLREIAVKNPEKLTNSFVLSHFKSLRIVDKKVTEIDEGLLNFKNLQQLTLSANLISLVDSQRLPKCLKELELSANKISDISSLCRNP--PPLIHLGLGYNQITSISGHMTPLAWRHLLSLDLSCNNLPDLYSTINTLKTLPKLRNLVMQGNPLAVSMKQYVEACLLIIYDSCEEKHVAWAVTVAAKFLVVIHIDNSYGDLQLVPGYRGYVIDSIRALTILDDTRISADEKHYFKGLSKL 321          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Medaka
Match: LRRC43 (leucine rich repeat containing 43 [Source:NCBI gene;Acc:101171172])

HSP 1 Score: 106.301 bits (264), Expect = 1.015e-23
Identity = 92/298 (30.87%), Postives = 149/298 (50.00%), Query Frame = 2
Query:  104 FHNFPCGNGSWNISDDYNENPAXXXXXXXXXXXXXRLSPWVE-EEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVI--ISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKE-KPENSPEEPVIKTDYYAKFWFPFQYQNN 985
             ++FPCGNGSW  S D  + P     D+L+DLLK   SPW + ++    ++  +++  ++  E      ++  F  L++VDK +  + + +  F  LEEL LSAN +  I  + LP  LKVLEL AN L SL    +  +P LQ+L +G N I   + +S    +K    + L  +      + A++  +S +S LK LIL GNP +L  AY    +D++  L  LD   I+ +ER   R  A +++   +     + +  +  +P    + E S  E  + T YY  + FP  +  N
Sbjct:   19 LNDFPCGNGSWRKSKDGGDGPERESADELLDLLKCPRSPWGQVDDSWSPQVSTLRELAVLTPERLRKNFIYNHFTTLRIVDKGVSVIDDGLLKFSKLEELVLSANLLTEIAVESLPITLKVLELRANRLSSLSGLSSCRLPQLQYLSLGSNPIGLHEDVSCITGRKWPQLVCLDLSDCDFEDQQALVKALSTLSCLKTLILEGNPFTLAPAYPGLTVDTLTQLAYLDGSDISPEERQQFRGFATMNDLKADTALATVSVGRMRGMPDPTVRVEGSAPELFVTTKYYIFYEFPSHHAPN 316          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Medaka
Match: LRRC43 (leucine rich repeat containing 43 [Source:NCBI gene;Acc:101171172])

HSP 1 Score: 69.707 bits (169), Expect = 3.717e-12
Identity = 56/154 (36.36%), Postives = 85/154 (55.19%), Query Frame = 2
Query:  104 FHNFPCGNGSWNISDDYNENPAXXXXXXXXXXXXXRLSPWVE-EEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLIS 562
             ++FPCGNGSW  S D  + P     D+L+DLLK   SPW + ++    ++  +++  ++  E      ++  F  L++VDK +  + + +  F  LEEL LSAN +  I  + LP  LKVLEL AN L SL    +  +P LQ+L +G N I 
Sbjct:   19 LNDFPCGNGSWRKSKDGGDGPERESADELLDLLKCPRSPWGQVDDSWSPQVSTLRELAVLTPERLRKNFIYNHFTTLRIVDKGVSVIDDGLLKFSKLEELVLSANLLTEIAVESLPITLKVLELRANRLSSLSGLSSCRLPQLQYLSLGSNPIG 172          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Planmine SMEST
Match: SMESG000066601.1 (SMESG000066601.1)

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 521/527 (98.86%), Postives = 523/527 (99.24%), Query Frame = 2
Query:   98 FKFHNFPCGNGSWNISDDYNENPAXXXXXXXXXXXXXRLSPWVEEEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMSEDIEIKNITRFCEFLXXXXXXXXXXXXXYLYSPENLPVKAPSRMDSQSSKRRQPTKSANKHTSNNPPXXXXXXXXXXXXXXXLIMFSKFSQKLAEYKIDLINFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKGDQKKLIDK-NTLKDGKSPSTQMEQPIPIECHVVLKLLTITNTTGIY 1675
            FKFHNFPCGNGSWNISDDY+ENPALFKIDDLIDLLKDRLSPWVEEEILQNEIMEIKKSLIINKEVPSIKALFKKFKILKLVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMLKKSVVSLDLSKNKLSNLSKTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK EN+PEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMSEDIEIKNITRFCEFLNERIKIEIIEENKY YSPENLPVKAPSRMDSQSSKRRQ TKSANKHTSNNPPKAKETGKKKKIDESKLIMFSKFSQKLAEYKIDLINFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKGDQKKLIDK NTLKDGKSPSTQMEQPIPIECHVVLKLLTITNTTGIY
Sbjct:   15 FKFHNFPCGNGSWNISDDYSENPALFKIDDLIDLLKDRLSPWVEEEILQNEIMEIKKSLIINKEVPSIKALFKKFKILKLVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMLKKSVVSLDLSKNKLSNLSKTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEKSENAPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMSEDIEIKNITRFCEFLNERIKIEIIEENKYFYSPENLPVKAPSRMDSQSSKRRQLTKSANKHTSNNPPKAKETGKKKKIDESKLIMFSKFSQKLAEYKIDLINFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKGDQKKLIDKNNTLKDGKSPSTQMEQPIPIECHVVLKLLTITNTTGIY 541          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Planmine SMEST
Match: SMESG000066601.1 (SMESG000066601.1)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 476/481 (98.96%), Postives = 478/481 (99.38%), Query Frame = 2
Query:   98 FKFHNFPCGNGSWNISDDYNENPAXXXXXXXXXXXXXRLSPWVEEEILQNEIMEIKKSLIINKEVPSXXXXXXXXXXXXXVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEKPENSPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMSEDIEIKNITRFCEFLXXXXXXXXXXXXXYLYSPENLPVKAPSRMDSQSSKRRQPTKSANKHTSNNPPXXXXXXXXXXXXXXXLIMFSKFSQKLAEYKIDLINFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKG 1540
            FKFHNFPCGNGSWNISDDY+ENPALFKIDDLIDLLKDRLSPWVEEEILQNEIMEIKKSLIINKEVPSIKALFKKFKILKLVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMLKKSVVSLDLSKNKLSNLSKTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEK EN+PEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMSEDIEIKNITRFCEFLNERIKIEIIEENKY YSPENLPVKAPSRMDSQSSKRRQ TKSANKHTSNNPPKAKETGKKKKIDESKLIMFSKFSQKLAEYKIDLINFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKG
Sbjct:   15 FKFHNFPCGNGSWNISDDYSENPALFKIDDLIDLLKDRLSPWVEEEILQNEIMEIKKSLIINKEVPSIKALFKKFKILKLVDKNIHEVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFCQNKDMPHLQHLGVGGNLISNIDMLSASMLKKSVVSLDLSKNKLSNLSKTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSVRNMAKISEPMKNLCKFKIEILSIGNIPFKEKSENAPEEPVIKTDYYAKFWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMSEDIEIKNITRFCEFLNERIKIEIIEENKYFYSPENLPVKAPSRMDSQSSKRRQLTKSANKHTSNNPPKAKETGKKKKIDESKLIMFSKFSQKLAEYKIDLINFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKG 495          
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Planmine SMEST
Match: SMESG000021671.1 (SMESG000021671.1)

HSP 1 Score: 50.447 bits (119), Expect = 4.143e-6
Identity = 50/159 (31.45%), Postives = 72/159 (45.28%), Query Frame = 2
Query:  362 GNDISL------FLNLEELTLSANFIKSI--DSKILPKNLKVLELYANELESLEFCQNK-DMPHLQHLGVGGNLISNIDMLSASMXXXXXXXXXXXXXXXXXXXXTAVIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERFSV 811
            GNDIS+        NL+E+ L  N IKSI  +S I   NLK + L  N L++   C N   + HL+   VG N IS++  L                           +     +L ++ L GNP+S    +R Y+I  I TL+++D   I+ DER  V
Sbjct: 1151 GNDISMIDGLDYLSNLKEIVLDQNRIKSISENSFIHSGNLKEIHLDDNRLKN---CTNVFHLKHLKRFYVGNNKISDLHDLD--------------------------LFYSFESLIDVSLFGNPVSRRHQHRQYLIHMIPTLLMIDGIEISEDERLRV 1280          
The following BLAST results are available for this feature:
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LRRC431.363e-1829.54leucine rich repeat containing 43 [Source:HGNC Sym... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LRRC432.838e-2331.92leucine rich repeat containing 43 [Source:NCBI gen... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lrrc436.402e-2132.23leucine rich repeat containing 43 [Source:MGI Symb... [more]
Lrrc436.533e-2132.23leucine rich repeat containing 43 [Source:MGI Symb... [more]
Lrrc437.090e-2132.23leucine rich repeat containing 43 [Source:MGI Symb... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q3V0L5|LRC43_MOUSE4.960e-2032.23Leucine-rich repeat-containing protein 43 OS=Mus m... [more]
sp|Q8N309|LRC43_HUMAN6.547e-1829.54Leucine-rich repeat-containing protein 43 OS=Homo ... [more]
sp|Q95JT3|LRC43_MACFA1.283e-1728.61Leucine-rich repeat-containing protein 43 OS=Macac... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3ISY06.740e-3141.98leucine-rich repeat-containing protein 43 isoform ... [more]
A0A1S3ISJ57.686e-3141.98leucine-rich repeat-containing protein 43 isoform ... [more]
A0A1S3ITC67.828e-3141.98leucine-rich repeat-containing protein 43 isoform ... [more]
A0A210QTV41.909e-2840.09Leucine-rich repeat-containing protein 43 OS=Mizuh... [more]
A0A267H0G32.278e-2840.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445819.976e-1928.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LRRC431.015e-2330.87leucine rich repeat containing 43 [Source:NCBI gen... [more]
LRRC433.717e-1236.36leucine rich repeat containing 43 [Source:NCBI gen... [more]
back to top
BLAST of UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000066601.10.000e+098.86SMESG000066601.1[more]
SMESG000066601.10.000e+098.96SMESG000066601.1[more]
SMESG000021671.14.143e-631.45SMESG000021671.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033909 ID=SMED30033909|Name=UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1763bp
TTTGTATTTTGTTTAAATAATTTATTTCTATAGTTACACACATTTTATTT
TCGAAATGTCAAATTTATCAAATATTTCTCAATCAATCATAAATAACTTT
AAATTTCACAATTTTCCTTGTGGAAACGGATCATGGAATATTTCTGATGA
TTACAACGAAAACCCTGCCTTATTTAAAATTGATGATTTAATTGATTTGT
TAAAGGATAGATTATCGCCATGGGTAGAAGAAGAAATTCTTCAAAATGAA
ATAATGGAAATTAAAAAGAGTTTAATTATTAATAAAGAGGTTCCATCTAT
CAAAGCTTTGTTTAAAAAGTTTAAAATTTTGAAACTTGTGGATAAAAATA
TACACGAAGTCGGTAACGACATTAGCTTATTTTTGAATTTAGAAGAACTA
ACATTATCTGCAAATTTTATCAAGTCAATTGATTCAAAAATATTGCCAAA
AAATTTAAAGGTTTTAGAATTATATGCAAATGAATTGGAATCGCTTGAAT
TTTGCCAGAATAAAGATATGCCACATTTACAGCATTTAGGAGTGGGAGGA
AATCTAATTTCAAACATTGACATGTTATCTGCTTCCATGTTGAAAAAAAG
TGTTGTGTCATTAGACCTCAGCAAAAACAAATTATCAAATTTATCAAAAA
CTGCTGTAATCATCTCAGAAATATCAAATTTGAAAAATCTAATTCTTTCT
GGAAATCCATTATCATTGTTTGCTGCATATCGTGCTTATATAATCGATTC
AATTAAAACCTTGATCGTTCTGGATGACTTCCCAATCACTGCTGATGAAA
GATTTTCTGTTAGAAATATGGCGAAAATTTCAGAACCGATGAAAAACCTT
TGCAAATTCAAAATAGAAATACTTTCAATTGGTAATATTCCTTTTAAAGA
AAAACCAGAAAATTCTCCAGAAGAACCCGTAATTAAAACCGATTACTATG
CCAAATTTTGGTTTCCCTTTCAATACCAAAACAATGCAAGCGCTGAAAAT
ACCGAGGAACTTACTAATGACAATAAAATCGAGGATGAAATAATGCACTT
ACATACTTCAGCAAAACTACCAAGAATAAATCCAGATATTCCATTGAATA
TGTCAGAAGACATTGAAATAAAAAATATTACTCGGTTTTGCGAATTCCTA
AATGAAAGGATTAAAATAGAAATAATTGAAGAAAATAAATATCTTTATTC
GCCGGAAAACCTACCAGTAAAAGCACCATCTAGGATGGATAGTCAAAGTA
GTAAAAGAAGACAACCCACTAAATCGGCAAATAAACATACAAGTAATAAT
CCTCCAAAGGCTAAAGAAACAGGAAAAAAGAAAAAAATTGATGAATCAAA
GTTGATAATGTTCTCGAAATTCAGCCAAAAGCTTGCAGAATATAAAATAG
ATTTGATAAATTTTAAAAATGGAGAAATCTTTTTTGATCAAATTTTAAAA
TATGAAATCAAGACTAATTCAAAAAATAATGAAAATTTGAAAATACCACA
AGAAAAAGAAAGTAAAAATAAAAAAATAAGCGCTAAAGGTGATCAAAAAA
AATTAATTGACAAAAACACTCTTAAAGATGGAAAATCACCTTCTACTCAA
ATGGAGCAGCCAATACCGATCGAGTGCCATGTCGTATTAAAACTACTTAC
AATAACAAACACAACGGGAATTTATTGAGTAAATTGAAACAGATTTGTCA
TATATATTTCAAATATAAATTTTTATTATTAACAAGATGAGGATGATGTT
AATAATTTGGATG
back to top

protein sequence of SMED30033909-orf-1

>SMED30033909-orf-1 ID=SMED30033909-orf-1|Name=SMED30033909-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MSNLSNISQSIINNFKFHNFPCGNGSWNISDDYNENPALFKIDDLIDLLK
DRLSPWVEEEILQNEIMEIKKSLIINKEVPSIKALFKKFKILKLVDKNIH
EVGNDISLFLNLEELTLSANFIKSIDSKILPKNLKVLELYANELESLEFC
QNKDMPHLQHLGVGGNLISNIDMLSASMLKKSVVSLDLSKNKLSNLSKTA
VIISEISNLKNLILSGNPLSLFAAYRAYIIDSIKTLIVLDDFPITADERF
SVRNMAKISEPMKNLCKFKIEILSIGNIPFKEKPENSPEEPVIKTDYYAK
FWFPFQYQNNASAENTEELTNDNKIEDEIMHLHTSAKLPRINPDIPLNMS
EDIEIKNITRFCEFLNERIKIEIIEENKYLYSPENLPVKAPSRMDSQSSK
RRQPTKSANKHTSNNPPKAKETGKKKKIDESKLIMFSKFSQKLAEYKIDL
INFKNGEIFFDQILKYEIKTNSKNNENLKIPQEKESKNKKISAKGDQKKL
IDKNTLKDGKSPSTQMEQPIPIECHVVLKLLTITNTTGIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005575cellular_component
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 67..257
e-value: 1.0E-22
score: 82.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 401..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 478..501
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..426
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 477..501
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 32..321
NoneNo IPR availablePANTHERPTHR45973:SF6LEUCINE-RICH REPEAT-CONTAINING PROTEIN 43coord: 32..321
NoneNo IPR availableSUPERFAMILYSSF52075Outer arm dynein light chain 1coord: 80..255
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 157..178
score: 6.618
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 182..203
score: 5.525
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 111..132
score: 7.173
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 133..154
score: 5.948
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 208..229
score: 5.579