Tetratricopeptide repeat

Overview
NameTetratricopeptide repeat
Smed IDSMED30033900
Length (bp)1134
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033900

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30033900SMESG000019784.1 Contig5005_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat vs. Ensembl Zebrafish
Match: si:dkey-206p8.1 (si:dkey-206p8.1 [Source:ZFIN;Acc:ZDB-GENE-131127-460])

HSP 1 Score: 88.1965 bits (217), Expect = 9.338e-20
Identity = 68/247 (27.53%), Postives = 124/247 (50.20%), Query Frame = 2
Query:  146 LLNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNC-NQIRHKFSSSNSAGDGGSHKQKVSPPSVPRYKQAKHKIKFVIYTLKELVRLSV 883
            +LN S RE LF    +    GD   A+  F++CL  L    +F SLP CL  ++  Y+++K+Y K++ F+QAE+M+YE AL+E   LQ      A      +     +    Q E     ++  + ER+++  +   +  +ALE + KA K++ +  G+++  T  SL  ++ +  EI K +    T++   C + +  +FS++ S  D  S    +S     R  + +H+ +   YTL++ ++  V
Sbjct:    1 MLNGS-REGLFELGRQLQQDGDSQAALHCFLSCLLGLTHVQSFHSLPNCLHQIAELYIDEKNYGKALQFIQAEKMFYEVALIELTSLQ------ASTGSQEDGTLGSSGCLSQEELSEQASQAQDLERLAQLCIMSKRPHLALEYSGKATKIHQRALGNDHPITARSLELLATVYAEIGKTE---YTNSLGECVSTLSKRFSATESFSDALS---SISYSHKDRNSELRHRKE--PYTLQDTLKTKV 232          
BLAST of Tetratricopeptide repeat vs. TrEMBL
Match: V4A9T9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_161619 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.976e-20
Identity = 66/226 (29.20%), Postives = 120/226 (53.10%), Query Frame = 2
Query:  155 KSEREN-LFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSSNSAGDGGSHKQKVSPPSVPRYKQAK 829
            K ER N LF +   +  +     A+  +++CL  L   + F  LP CLR+++  Y ++++Y K+I F+QAE++YYE+AL++   +Q  L  L     +P++   +N D ++ +         EYE ++K  M+  +  +ALE A KA K+  ++YG+++  TK+SL   + +  E+ +++ S         + + H   SS S  D     Q +SP S+ R ++ K
Sbjct:  154 KPERRNKLFQQGLDYEKASQTDSALKCYLSCLTGLRADTYFVLLPQCLRNIADIYFKKEEYEKAILFIQAEKLYYENALIDTTEIQNTLEKLRNDQSTPDTTEPINEDSVRAD---------EYENLAKLCMDQKQPHLALEYAGKATKIRQQIYGNDHQTTKDSLDYFATLYAEVGRKQYS---------DSMHH--LSSESDQDYKDDYQNISPTSILRQRRRK 359          
BLAST of Tetratricopeptide repeat vs. TrEMBL
Match: A0A5N5N4G0 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00015960 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.743e-17
Identity = 70/244 (28.69%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  164 RENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYL-QVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSS----NSAGDGGS---------HKQKVSPPS-VPRYKQAKHKIKFVI 850
            RE LF +  +F   GD   A+  F++CL  L    +F SLP CL  ++  ++++K+Y K++ F+QAE+M+YE AL+E   LQ   +       S E     +  +L Q E      +  + ER+++  +   +  +ALE + KA K++ + +G+++  T  SL  +  +  EI K + S   D+   C     K SS+    N+  +G +         H++   PPS  P+ K    KI   I
Sbjct:    6 REGLFEQGRRFQQEGDSRAALQCFLSCLLGLTHVQSFHSLPNCLHQIAELFIDEKNYEKALQFIQAEKMFYEVALIELTALQGSTVG------SQEDSTVGSPGWLSQEELSEQALQAQDLERLAQLCIMSKRPHLALEYSGKATKIHQRAFGNDHPITARSLELLGTVYAEIGKTEYS---DSLGQCVSALSKTSSAPESYNNTLNGFALSDKDSELWHRKDPHPPSDTPKPKVINSKIPISI 240          
BLAST of Tetratricopeptide repeat vs. TrEMBL
Match: A0A2T7NXY0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13690 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.866e-17
Identity = 54/170 (31.76%), Postives = 96/170 (56.47%), Query Frame = 2
Query:  149 LNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKL--IDLAYHHKSPESKF-KMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESL 649
            L+   R  LF +       G + +A+  ++NCL  L   + F  LP CLR+++  Y E ++Y K+IHF+QAE++YYE+AL+    +Q+KL  + L    + P ++   + A+ L+ E         E+E ++K  M+H +  +A+E A K +++  ++ G ++  TKESL
Sbjct:   99 LDAEGRNQLFAQGVMLDRQGKKEEALKHYLNCLFGLSRETRFVLLPQCLRNIAEIYYEMQEYDKAIHFIQAEKLYYENALINTEEIQKKLDEMQLTKRKEEPTTEVHDLTAEVLRAE---------EFEHLAKLCMDHKQPQLAMEYAGKCSQMRQQVLGEHHPKTKESL 259          
BLAST of Tetratricopeptide repeat vs. TrEMBL
Match: A0A1S3HJK1 (uncharacterized protein LOC106155754 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106155754 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.804e-17
Identity = 59/220 (26.82%), Postives = 111/220 (50.45%), Query Frame = 2
Query:  149 LNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSSNSAGDGG-SHKQKVSPPS 805
            L+   R  LF    ++ ++G    A+  ++ CL  L+  S F  LP CL  ++  Y ++++Y K+I F+QAE+MYYESAL++   L++++ D     +S ++   +       E+     R  EYE +SK  +  ++  +AL+   KA KL  +++G  +  T +SL   + +  E+ K++             ++     + S G+GG +H   +S P+
Sbjct:  119 LDGPGRNRLFERGRQYEDNGKAQLALKCYLGCLTGLEEGSGFTYLPQCLHSVADVYFKKEEYEKAIQFIQAEKMYYESALIDTMGLEKRVEDRKKEKESGDTSPPVTG-----EESLDALRATEYEELSKLCLERDQPRLALDYIAKATKLRQQVFGEQHPITVKSLDFFTVVYAEVGKQQYK---------ESLQKHTDRAVSPGEGGDAHSTPISEPA 324          
BLAST of Tetratricopeptide repeat vs. TrEMBL
Match: A0A1S3HL54 (uncharacterized protein LOC106155754 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155754 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.823e-17
Identity = 59/220 (26.82%), Postives = 111/220 (50.45%), Query Frame = 2
Query:  149 LNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSSNSAGDGG-SHKQKVSPPS 805
            L+   R  LF    ++ ++G    A+  ++ CL  L+  S F  LP CL  ++  Y ++++Y K+I F+QAE+MYYESAL++   L++++ D     +S ++   +       E+     R  EYE +SK  +  ++  +AL+   KA KL  +++G  +  T +SL   + +  E+ K++             ++     + S G+GG +H   +S P+
Sbjct:  120 LDGPGRNRLFERGRQYEDNGKAQLALKCYLGCLTGLEEGSGFTYLPQCLHSVADVYFKKEEYEKAIQFIQAEKMYYESALIDTMGLEKRVEDRKKEKESGDTSPPVTG-----EESLDALRATEYEELSKLCLERDQPRLALDYIAKATKLRQQVFGEQHPITVKSLDFFTVVYAEVGKQQYK---------ESLQKHTDRAVSPGEGGDAHSTPISEPA 325          
BLAST of Tetratricopeptide repeat vs. Ensembl Cavefish
Match: si:dkey-206p8.1 (si:dkey-206p8.1 [Source:ZFIN;Acc:ZDB-GENE-131127-460])

HSP 1 Score: 75.485 bits (184), Expect = 1.877e-15
Identity = 58/200 (29.00%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  164 RENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYL-QVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSSNS 760
            RE LF    +F   GD   A+  F++CL  L    +F SLP CL  ++  ++++K+  K++ F+QAE+M+YE AL+E   LQ           S E     +  +L Q E     ++  + ER+++  +  +K  +ALE + KA K++ + +G+++  T  SL  ++ +  EI K + S +    S    +  +FS++ S
Sbjct:    6 REGLFELGRQFQQEGDSQAALHCFLSCLLGLTHVQSFNSLPNCLHQIAELFIDEKNE-KALKFIQAEKMFYEVALIELTALQGS--------TSLEDGSLGSPGWLSQEELSEQASQAQDLERLAQLCIM-SKPHLALEYSGKATKIHQRAFGNDHPITARSLELLATVYAEIGKTEYSSLGQCVS---ALSKRFSAAES 192          
BLAST of Tetratricopeptide repeat vs. Ensembl Medaka
Match: si:dkey-206p8.1 (chromosome 22 C14orf180 homolog [Source:NCBI gene;Acc:101162410])

HSP 1 Score: 67.0106 bits (162), Expect = 1.950e-12
Identity = 59/218 (27.06%), Postives = 114/218 (52.29%), Query Frame = 2
Query:  164 RENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKM-NADYLQVEKQNYETRIFEY-ERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSSNSAGDGG-----SHKQKVS 796
            RE LF   ++    G+   A+  F++CL  L    +F SLP CL  ++  ++ +K+  K++ F+QAE+M+YE AL+E   LQ           +P+ +  + +A +   E+ + +    ++ ER+++  +  +K  +ALE + KA K++ + +G+++  T  SL  ++ +  EI K + S +    S    +  +F+++ S  D       SH+QK S
Sbjct:    6 REGLFELGQQLQQQGEYQAALHCFLSCLLGLTHIQSFTSLPNCLHQIAELFITEKN-GKALQFIQAEKMFYEVALIELTALQG---------STPQEEATLGSARWTTPEELSEQASQGQHLERLAQLCIM-SKPHLALEYSGKATKIHQRAFGNDHPITARSLELMATVYAEIGKTEYSSLGQCVSA---LSKRFTTTESLTDNSSCVPHSHRQKHS 209          
BLAST of Tetratricopeptide repeat vs. Planmine SMEST
Match: SMESG000019784.1 (SMESG000019784.1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 334/335 (99.70%), Postives = 334/335 (99.70%), Query Frame = 2
Query:  101 MNHQGELEVPPSQQKLLNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSLVTDAESNCNQIRHKFSSSNSAGDGGSHKQKVSPPSVPRYKQAKHKIKFVIYTLKELVRLSVIWSVFLAFGXXXXXXXXXXXXXXHNYMMHSFTFIEMLPFLGNXXXXXXXXXXXXXXXFGKTFSSLSDLALEYFD 1105
            MNHQGELEVPPSQQKLLNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIK KNSLVTDAESNCNQIRHKFSSSNSAGDGGSHKQKVSPPSVPRYKQAKHKIKFVIYTLKELVRLSVIWSVFLAFGFLVLILLYFLLVILHNYMMHSFTFIEMLPFLGNLVSLLLKMLDFLLKLFGKTFSSLSDLALEYFD
Sbjct:    1 MNHQGELEVPPSQQKLLNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKGKNSLVTDAESNCNQIRHKFSSSNSAGDGGSHKQKVSPPSVPRYKQAKHKIKFVIYTLKELVRLSVIWSVFLAFGFLVLILLYFLLVILHNYMMHSFTFIEMLPFLGNLVSLLLKMLDFLLKLFGKTFSSLSDLALEYFD 335          
BLAST of Tetratricopeptide repeat vs. Planmine SMEST
Match: SMESG000022965.1 (SMESG000022965.1)

HSP 1 Score: 120.939 bits (302), Expect = 4.662e-31
Identity = 68/168 (40.48%), Postives = 106/168 (63.10%), Query Frame = 2
Query:  146 LLNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLA---YHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTK 640
            +L K ERE LF EAE     G    +++L++ CLQ+L+ +S F SLP CLR L++++L +K+Y KS+HF+QAER+YYESAL++ +  Q+KL +L+   Y H         N D L+  K+    R  EYE +  YF   N++ +A+  A+K  K+  K+YG++++ TK
Sbjct:    7 ILTKFEREELFQEAEILNAEGHEEASIALYLRCLQNLEINSTFGSLPKCLRALANYFLRKKEYDKSVHFIQAERLYYESALLDTSSFQKKLNELSGDKYSHAFQGD--NENVDNLEYSKE----RASEYEYLVNYFKEKNQYDLAIFYAEKCFKVKSKIYGASHHSTK 168          
BLAST of Tetratricopeptide repeat vs. Planmine SMEST
Match: SMESG000047424.1 (SMESG000047424.1)

HSP 1 Score: 73.559 bits (179), Expect = 1.682e-15
Identity = 36/92 (39.13%), Postives = 59/92 (64.13%), Query Frame = 2
Query:  149 LNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLID 424
            L+K ERE LF +AEK   +G    +      CL++L  +  FPSLP CL+ L+ ++ E+++YM +I  + A + YY+SAL EAA++  K+++
Sbjct:   19 LSKEEREILFSKAEKLKENGLTEDSAFQCYKCLRNLTCNEVFPSLPKCLKLLTLYFFEKQNYMIAIQLINALKSYYKSALDEAALIHSKIVE 110          
BLAST of Tetratricopeptide repeat vs. Planmine SMEST
Match: SMESG000047424.1 (SMESG000047424.1)

HSP 1 Score: 73.559 bits (179), Expect = 9.156e-15
Identity = 38/103 (36.89%), Postives = 64/103 (62.14%), Query Frame = 2
Query:  149 LNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQEKLIDLAYHHKSPESK 457
            L+K ERE LF +AEK   +G    +      CL++L  +  FPSLP CL+ L+ ++ E+++YM +I  + A + YY+SAL EAA++  K+++ +  +   E+K
Sbjct:   19 LSKEEREILFSKAEKLKENGLTEDSAFQCYKCLRNLTCNEVFPSLPKCLKLLTLYFFEKQNYMIAIQLINALKSYYKSALDEAALIHSKIVEYSQLNDEYENK 121          
BLAST of Tetratricopeptide repeat vs. Planmine SMEST
Match: SMESG000057093.1 (SMESG000057093.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.333e-12
Identity = 58/210 (27.62%), Postives = 100/210 (47.62%), Query Frame = 2
Query:  149 LNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQSLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAAMLQ---------------EKLIDLAYHHKSPE--SKFKMNADYLQVEKQNYETRIFEYERMSK-----------YFMNHNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKI--SDIQGEIIKE 688
            +  SERE  F +AEK+   G   K+V  +  CLQ L+  + F ++P CLR L++ Y  +    KS+ F++AE +YY + L E  +LQ               E+L+D +  H   E  S F+ +  +L  ++ N  ++ F  +R+ +           YFM+ N   M L  ++   K+   +  S  +   ++L ++   DI G+I  E
Sbjct:    1 MTTSEREINFQKAEKYQKIGLLDKSVVYYRRCLQDLEEDTEFSNIPKCLRSLANFYWIKGKTKKSLSFLEAEELYYSNILKEIKILQNKLSKKSKFSNLFNKEELVDKSQDHDLIEDSSTFEASYYFLTSDQYNNLSKNFNDKRIEQSSLRRTRSDGSYFMSTNLNPMPLHESKDILKIEKTVQTSYISAYSQTLPRVESGDINGQISDE 210          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-206p8.19.338e-2027.53si:dkey-206p8.1 [Source:ZFIN;Acc:ZDB-GENE-131127-4... [more]
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A9T92.976e-2029.20Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A5N5N4G01.743e-1728.69Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A2T7NXY01.866e-1731.76Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3HJK12.804e-1726.82uncharacterized protein LOC106155754 isoform X2 OS... [more]
A0A1S3HL542.823e-1726.82uncharacterized protein LOC106155754 isoform X1 OS... [more]
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-206p8.11.877e-1529.00si:dkey-206p8.1 [Source:ZFIN;Acc:ZDB-GENE-131127-4... [more]
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-206p8.11.950e-1227.06chromosome 22 C14orf180 homolog [Source:NCBI gene;... [more]
back to top
BLAST of Tetratricopeptide repeat vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019784.10.000e+099.70SMESG000019784.1[more]
SMESG000022965.14.662e-3140.48SMESG000022965.1[more]
SMESG000047424.11.682e-1539.13SMESG000047424.1[more]
SMESG000047424.19.156e-1536.89SMESG000047424.1[more]
SMESG000057093.12.333e-1227.62SMESG000057093.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033900 ID=SMED30033900|Name=Tetratricopeptide repeat|organism=Schmidtea mediterranea sexual|type=transcript|length=1134bp
ATCTATGAATTTTGCATTTGAAAAATATCAATCTGTAAAATCGTTTGAAT
AGTTCAAGAAAACAGTAAATATTTCCCCCTTCAAGGCTTGGCAGGTTCCC
ATGAATCATCAAGGAGAGCTAGAAGTTCCTCCCAGTCAGCAAAAGCTATT
AAATAAATCTGAAAGAGAAAATCTGTTTCACGAAGCTGAAAAATTTTACA
ACTCTGGTGACAGAGCCAAAGCAGTTTCCTTGTTCATGAATTGTCTCCAA
AGTTTGGATACTCATTCCGCTTTTCCAAGTCTTCCAATGTGTTTAAGAGA
TTTATCTAGTCATTACTTGGAGCAGAAGGACTACATGAAATCCATTCATT
TTGTACAAGCTGAAAGGATGTATTATGAATCTGCATTGGTGGAGGCTGCT
ATGTTGCAGGAAAAACTGATCGATCTCGCCTATCATCATAAAAGTCCCGA
GAGCAAGTTCAAGATGAATGCTGATTACCTTCAAGTGGAAAAGCAAAATT
ATGAAACTCGAATATTCGAATACGAGCGCATGAGCAAATATTTCATGAAT
CACAACAAATTCGGCATGGCGTTGGAATTGGCACAGAAAGCTGCGAAGCT
TAACTATAAGCTTTACGGATCCAATAACAATTTTACCAAGGAGAGTTTAT
GCAAGATTAGTGATATTCAGGGAGAAATAATTAAAGAAAAAAACAGTTTA
GTCACAGATGCAGAATCCAATTGCAACCAGATTCGTCATAAATTTTCATC
GTCCAATTCTGCGGGAGACGGAGGGAGTCACAAACAAAAAGTCTCACCTC
CCTCGGTTCCCAGATATAAACAGGCGAAACATAAAATAAAATTTGTAATT
TACACATTGAAAGAACTTGTGAGACTCAGTGTAATATGGAGTGTGTTCTT
AGCGTTTGGTTTTCTTGTTTTAATATTGCTCTATTTTCTGCTGGTAATTC
TGCACAATTATATGATGCACTCTTTCACATTCATCGAAATGCTGCCGTTC
TTGGGCAACCTTGTCAGTTTATTGTTGAAAATGCTCGACTTTCTATTAAA
GCTTTTCGGCAAGACATTCAGCAGCTTATCCGATCTGGCTCTGGAGTATT
TTGATTAAGGAAATAAAGTGTATTGTTTCAAAAA
back to top

protein sequence of SMED30033900-orf-1

>SMED30033900-orf-1 ID=SMED30033900-orf-1|Name=SMED30033900-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MNHQGELEVPPSQQKLLNKSERENLFHEAEKFYNSGDRAKAVSLFMNCLQ
SLDTHSAFPSLPMCLRDLSSHYLEQKDYMKSIHFVQAERMYYESALVEAA
MLQEKLIDLAYHHKSPESKFKMNADYLQVEKQNYETRIFEYERMSKYFMN
HNKFGMALELAQKAAKLNYKLYGSNNNFTKESLCKISDIQGEIIKEKNSL
VTDAESNCNQIRHKFSSSNSAGDGGSHKQKVSPPSVPRYKQAKHKIKFVI
YTLKELVRLSVIWSVFLAFGFLVLILLYFLLVILHNYMMHSFTFIEMLPF
LGNLVSLLLKMLDFLLKLFGKTFSSLSDLALEYFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005802trans-Golgi network
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0071253connexin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR042318Consortin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..237
NoneNo IPR availableTMHMMTMhelixcoord: 260..282
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
IPR042318ConsortinPANTHERPTHR28581FAMILY NOT NAMEDcoord: 14..227