Slc15a-7

Overview
NameSlc15a-7
Smed IDSMED30033886
Length (bp)1606
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Slc15a-7 (SMED30033886) t-SNE clustered cells

Violin plots show distribution of expression levels for Slc15a-7 (SMED30033886) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Slc15a-7 (SMED30033886) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Slc15a-7 (SMED30033886) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033886

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30033886SMESG000009945.1 dd_Smed_v4_7909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033886SMESG000009945.1 dd_Smed_v4_7909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Slc15a-7 vs. TrEMBL
Match: A0A0H3YK61 (Slc15a-7 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc15a-7 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.936e-24
Identity = 86/256 (33.59%), Postives = 139/256 (54.30%), Query Frame = 3
Query:  627 WFLLIAYALCDSQILYSYEHQSKCLK--HLGENIIIKKYWPSVVDCTSTIIIMAVILVAY-----HKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRL------NSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQ 1355
            +FLLI Y +CDSQ  Y+YE QS  L   +L  N     +W + +   S   +MA +L+ +     ++N F    +Y N++ K+ILGN LMI++   C ALET RL      N+ T T   K ++ ++ T  +  +SV WM+P  IL   SE+L V TC EY+   S + TK++S   + S +  G I D++ M      +D +             + + ++++Y + +++ VSL VS+ +M RF+ YFST+K+ Q
Sbjct:  245 FFLLIPYGICDSQEFYAYEFQSNSLNQSNLLFNHFKSNFWCNTI---SAFTVMATLLILFAVRFCNENKF--DAIYSNIKTKIILGNSLMIISTLICGALETYRLSMLWTDNNSTLTPNYKNVIIDNTTYHVVDISVFWMVPQNILLSFSEVLIVPTCIEYVIDKSEKSTKYLSIVLVFSAVNIGGISDLISMS-----MDFKGLFRTEFDSPGKFIHRLDHVLYIISSISVVSLVVSVMLMTRFERYFSTSKNPQ 490          
BLAST of Slc15a-7 vs. TrEMBL
Match: A0A0H3YJ38 (Slc15a-8 OS=Schmidtea mediterranea OX=79327 GN=slc15a-8 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.175e-17
Identity = 71/260 (27.31%), Postives = 130/260 (50.00%), Query Frame = 3
Query:  627 WFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIK------KYWPSVVDCTSTII--IMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMT--------ESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQN 1358
            +FLLI Y +CDSQ  ++Y++QS  +K    N  +        +WP  ++C + I+   + ++L   +K+ F +Q L+ +++L++I GNILMI++      LE  RLN   S + +  + +         + T K + L+V  M+P I+L  ISE++   TC E++Y  S +  K++  A   +   +G   D+ F +    +  LE  +         N    +Y+ + L  +A  S  +SI ++ RF   F+  +  +N
Sbjct:  234 FFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQF-IQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDL---------NNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKN 483          
BLAST of Slc15a-7 vs. Planmine SMEST
Match: SMESG000009945.1 (SMESG000009945.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 274/275 (99.64%), Postives = 275/275 (100.00%), Query Frame = 3
Query:  558 RSERALTGEXXXXXXXXXXXXXXWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGNLP 1382
            +SERALTGEDKDIIVSISKSVIIWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGNLP
Sbjct:  147 QSERALTGEDKDIIVSISKSVIIWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGNLP 421          
BLAST of Slc15a-7 vs. Planmine SMEST
Match: SMESG000009945.1 (SMESG000009945.1)

HSP 1 Score: 529.25 bits (1362), Expect = 0.000e+0
Identity = 274/275 (99.64%), Postives = 275/275 (100.00%), Query Frame = 3
Query:  558 RSERALTGEXXXXXXXXXXXXXXWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGNLP 1382
            +SERALTGEDKDIIVSISKSVIIWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGNLP
Sbjct:   98 QSERALTGEDKDIIVSISKSVIIWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGNLP 372          
BLAST of Slc15a-7 vs. Planmine SMEST
Match: SMESG000009945.1 (SMESG000009945.1)

HSP 1 Score: 245.358 bits (625), Expect = 2.168e-79
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 3
Query:  558 RSERALTGEXXXXXXXXXXXXXXWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMT 962
            +SERALTGEDKDIIVSISKSVIIWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMT
Sbjct:  147 QSERALTGEDKDIIVSISKSVIIWFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNSDTSTEAEKILMT 281          

HSP 2 Score: 70.4774 bits (171), Expect = 2.168e-79
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 2
Query:  965 ISNNKDLKIICIMDDSLHHFRNNQRDSRSSNVL 1063
            ISNNKDLKIICIMDDSLHHFRNNQRDSRSSNVL
Sbjct:  291 ISNNKDLKIICIMDDSLHHFRNNQRDSRSSNVL 323          
BLAST of Slc15a-7 vs. Planmine SMEST
Match: SMESG000023324.1 (SMESG000023324.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.279e-31
Identity = 85/254 (33.46%), Postives = 136/254 (53.54%), Query Frame = 3
Query:  627 WFLLIAYALCDSQILYSYEHQSKCLK--HLGENIIIKKYWPSVVDCTSTIIIMAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNS-----DTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAE 1367
            + LLI Y +CDSQ LY+Y +QS  L+  H G       +W + +     I+ + ++L A   N     +LY  M+ K+ILGNI MI++   C ALET RL++     ++S  +    MT    T I+ +SVL MIP  IL   SEIL + TC EY+ L S + TK+ + A I S++  G I D + ++     ++ +   P     +     + +YL+Y + +++ +SL +SI +M RF+ YF T   +  + E
Sbjct:  239 FLLLIPYGICDSQQLYAYAYQSNSLRPPH-GNRYFTSDFWSNTITSMIVIMTLLILLSARFLNEKAFDKLYSKMKAKIILGNIFMIISTLICGALETFRLSTRWTANNSSVTSNYKNMTIDKKTYIN-MSVLCMIPQSILLSFSEILVIPTCIEYVILESEKSTKYFAVALIVSVVNIGGISDFLTVI-----MEFKNITPSDFDSNKKATIRLDYLMYIISSVSVISLVISILLMVRFKKYF-TLDEFNKMEE 484          
BLAST of Slc15a-7 vs. Planmine SMEST
Match: SMESG000023325.1 (SMESG000023325.1)

HSP 1 Score: 117.087 bits (292), Expect = 4.894e-28
Identity = 86/256 (33.59%), Postives = 139/256 (54.30%), Query Frame = 3
Query:  627 WFLLIAYALCDSQILYSYEHQSKCLK--HLGENIIIKKYWPSVVDCTSTIIIMAVILVAY-----HKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRL------NSDTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIYLHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPSIGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQ 1355
            +FLLI Y +CDSQ  Y+YE QS  L   +L  N     +W + +   S   +MA +L+ +     ++N F    +Y N++ K+ILGN LMI++   C ALET RL      N+ T T   K ++ ++ T  +  +SV WM+P  IL   SE+L V TC EY+   S + TK++S   + S +  G I D++ M      +D +             + + ++++Y + +++ VSL VS+ +M RF+ YFST+K+ Q
Sbjct:  202 FFLLIPYGICDSQEFYAYEFQSNSLNQSNLLFNHFKSNFWCNTI---SAFTVMAALLILFAVRFCNENKF--DAIYSNIKTKIILGNSLMIISTLICGALETYRLSMLWTDNNSTLTPNYKNVIIDNTTYHVVDISVFWMVPQNILLSFSEVLIVPTCIEYVIDKSEKSTKYLSIVLVFSAVNIGGISDLISMS-----MDFKGLFRTEFDSPGKFIHRLDHVLYIISSISVVSLVVSVMLMTRFERYFSTSKNPQ 447          
The following BLAST results are available for this feature:
BLAST of Slc15a-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A0H3YK612.936e-2433.59Slc15a-7 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YJ385.175e-1727.31Slc15a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
back to top
BLAST of Slc15a-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc15a-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009945.10.000e+099.64SMESG000009945.1[more]
SMESG000009945.10.000e+099.64SMESG000009945.1[more]
SMESG000009945.12.168e-7999.26SMESG000009945.1[more]
SMESG000023324.11.279e-3133.46SMESG000023324.1[more]
SMESG000023325.14.894e-2833.59SMESG000023325.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033886 ID=SMED30033886|Name=Slc15a-7|organism=Schmidtea mediterranea sexual|type=transcript|length=1606bp
CTTCCGATCTCAACGTTTCTCAATAATTATTAAAAATTTTATAACCAGAC
ATGCCTATTTCGCTCATACAGCACTTATTGTGTTGGCTAATATTGGTCAA
TCCTTTCGGTCGACAATGTTCAGTGATAAAAATTAACCATACCAAAAACC
TTCTAAATTAAAGTTTTGTTTTAGTTTTTAGAATATCCATGATAAGTGAA
CCCTTTATGAAAGTGGTCGCAAGGATTTGTGCTTTATAATTTTCAATTTT
TCTATACCGGTATTTTTCATTTGTGACTTTAATTATTGAAATATCAGTGA
TGGTTTATCATTTCCGACCAAATCATAAATAAATAGTTCCTCAAATGCAC
ATGTATAGGATTTCTGATGATTTGACATTATGTCTTCTTTGAGCTTCTTA
CATCAAACTCGTTATGGAGCTAGACTCTTGCTGATAGGGAGTTGCATATG
AAAATAAAGTTTAGGAGGCGTAACTTATGATGACTAAATTTATTTTCAAC
CAAAGAATGCTGTTATTAAACTTTGTTCAAACTCAACCAATCTCGGCATT
ATATTTTAGGTCTGAAAGAGCTTTGACAGGAGAAGACAAAGATATAATAG
TTTCAATTTCCAAGTCAGTGATAATATGGTTCTTGCTTATAGCATATGCA
TTGTGTGATTCTCAGATATTATATTCATATGAGCACCAATCTAAATGCTT
GAAACATTTAGGAGAAAATATTATAATAAAAAAGTATTGGCCATCGGTAG
TGGACTGTACGTCGACAATCATAATAATGGCAGTAATATTGGTGGCTTAC
CATAAAAATGTTTTCGGATTACAAAGACTTTATAAAAATATGCAATTGAA
AGTAATTCTTGGAAACATTTTAATGATTGTTGCGGTATTTTTTTGCGCGG
CCTTAGAAACCATTCGACTAAACTCGGATACGTCAACGGAGGCTGAAAAG
ATCTTGATGACTGAATCTCCAACAACAAAGATCTCAAAATTATCTGTATT
ATGGATGATTCCTTACATCATTTTAGGAATAATCAGCGAGATTCTCGCAG
TTCTAACGTGTTATGAATACATTTATTTACACTCAACCGAATATACAAAG
TTTATGTCAAATGCATTCATTTCCAGCCTAATCTGCACAGGTTGTATCCC
TGATGTAGTGTTCATGGTGGTGAACAGTAATTATCTCGACTTAGAAGCTT
GTATTCCTAAAAGAAGATCACCAAGTATCGGGAACTTATCGAAATATGAG
TACCTCATTTATTCTCTCGGCGCACTTGCAACTGTCTCACTTTTTGTGAG
CATTTTTATGATGAAAAGATTTCAAGTTTATTTTTCAACTACTAAACATT
ATCAGAATTTAGCAGAAAGCGGAAATTTACCATGAAAACTGAATGTGAAT
ATCATTTGTTCTAATATTTTGGCCAATATTTATTATAAGATTTGTCACCC
ATTAAAACAAACAATTTTTATAAGATTTTTCATCTATTACTGTGACTTTG
AAATTTAATATGGTTTCATTTTGATTTGATTTTGCTAATTTTATATTTTA
ATTTTTGTTAAACTTTTGCTGTAAATATAATGTAAATAAAGTTCGGTAAT
TCTTGG
back to top

protein sequence of SMED30033886-orf-1

>SMED30033886-orf-1 ID=SMED30033886-orf-1|Name=SMED30033886-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MMTKFIFNQRMLLLNFVQTQPISALYFRSERALTGEDKDIIVSISKSVII
WFLLIAYALCDSQILYSYEHQSKCLKHLGENIIIKKYWPSVVDCTSTIII
MAVILVAYHKNVFGLQRLYKNMQLKVILGNILMIVAVFFCAALETIRLNS
DTSTEAEKILMTESPTTKISKLSVLWMIPYIILGIISEILAVLTCYEYIY
LHSTEYTKFMSNAFISSLICTGCIPDVVFMVVNSNYLDLEACIPKRRSPS
IGNLSKYEYLIYSLGALATVSLFVSIFMMKRFQVYFSTTKHYQNLAESGN
LP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 18..291
e-value: 5.8E-17
score: 62.9
NoneNo IPR availableCDDcd17351MFS_NPFcoord: 50..281
e-value: 4.58836E-6
score: 45.6909
NoneNo IPR availableTMHMMTMhelixcoord: 48..67
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 259..278
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 209..231