Pyridine nucleotide-disulfide oxidoreductase

Overview
NamePyridine nucleotide-disulfide oxidoreductase
Smed IDSMED30033880
Length (bp)1172
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyridine nucleotide-disulfide oxidoreductase (SMED30033880) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyridine nucleotide-disulfide oxidoreductase (SMED30033880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyridine nucleotide-disulfide oxidoreductase (SMED30033880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyridine nucleotide-disulfide oxidoreductase (SMED30033880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Fly
Match: CG4199 (gene:FBgn0025628 transcript:FBtr0300254)

HSP 1 Score: 51.2174 bits (121), Expect = 1.095e-6
Identity = 26/87 (29.89%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  467 NTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFI 724
            +T+VLL++  + ++A   KC H GAPL  G +     G   ++CPWH   FNL+    +++P ++ +P      Y+  V + G++ +
Sbjct:   79 DTRVLLVKQNDRLLAVGAKCTHYGAPLQTGAL-----GLGRVRCPWHGACFNLENGDIEDFPGLDSLP-----CYRVEVGNEGQVML 155          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Fly
Match: CG4199 (gene:FBgn0025628 transcript:FBtr0070336)

HSP 1 Score: 51.2174 bits (121), Expect = 1.095e-6
Identity = 26/87 (29.89%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  467 NTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFI 724
            +T+VLL++  + ++A   KC H GAPL  G +     G   ++CPWH   FNL+    +++P ++ +P      Y+  V + G++ +
Sbjct:   79 DTRVLLVKQNDRLLAVGAKCTHYGAPLQTGAL-----GLGRVRCPWHGACFNLENGDIEDFPGLDSLP-----CYRVEVGNEGQVML 155          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Fly
Match: CG4199 (gene:FBgn0025628 transcript:FBtr0070334)

HSP 1 Score: 51.2174 bits (121), Expect = 1.095e-6
Identity = 26/87 (29.89%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  467 NTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFI 724
            +T+VLL++  + ++A   KC H GAPL  G +     G   ++CPWH   FNL+    +++P ++ +P      Y+  V + G++ +
Sbjct:   79 DTRVLLVKQNDRLLAVGAKCTHYGAPLQTGAL-----GLGRVRCPWHGACFNLENGDIEDFPGLDSLP-----CYRVEVGNEGQVML 155          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Fly
Match: CG4199 (gene:FBgn0025628 transcript:FBtr0300255)

HSP 1 Score: 51.2174 bits (121), Expect = 1.095e-6
Identity = 26/87 (29.89%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  467 NTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFI 724
            +T+VLL++  + ++A   KC H GAPL  G +     G   ++CPWH   FNL+    +++P ++ +P      Y+  V + G++ +
Sbjct:   79 DTRVLLVKQNDRLLAVGAKCTHYGAPLQTGAL-----GLGRVRCPWHGACFNLENGDIEDFPGLDSLP-----CYRVEVGNEGQVML 155          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Fly
Match: CG4199 (gene:FBgn0025628 transcript:FBtr0070335)

HSP 1 Score: 51.2174 bits (121), Expect = 1.095e-6
Identity = 26/87 (29.89%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  467 NTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFI 724
            +T+VLL++  + ++A   KC H GAPL  G +     G   ++CPWH   FNL+    +++P ++ +P      Y+  V + G++ +
Sbjct:   79 DTRVLLVKQNDRLLAVGAKCTHYGAPLQTGAL-----GLGRVRCPWHGACFNLENGDIEDFPGLDSLP-----CYRVEVGNEGQVML 155          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Zebrafish
Match: si:ch73-314g15.3 (si:ch73-314g15.3 [Source:ZFIN;Acc:ZDB-GENE-030616-19])

HSP 1 Score: 60.4622 bits (145), Expect = 1.201e-9
Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 2
Query:  509 ACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFI 724
            A ++ CPH+G PL +GDIE+L NG   L CPWH+F F+L+              +Q ++Y   V D G+++I
Sbjct:   57 AMDSSCPHEGGPLEQGDIEDLGNGKLALICPWHYFDFSLETGSSSS-------GLQNQVYDVRVLD-GKVYI 120          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Zebrafish
Match: si:ch73-314g15.3 (si:ch73-314g15.3 [Source:ZFIN;Acc:ZDB-GENE-030616-19])

HSP 1 Score: 59.3066 bits (142), Expect = 2.907e-9
Identity = 27/70 (38.57%), Postives = 41/70 (58.57%), Query Frame = 2
Query:  515 ENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFI 724
            ++ CPH+G PL +GDIE+L NG   L CPWH+F F+L+              +Q ++Y   V D G+++I
Sbjct:    2 DSSCPHEGGPLEQGDIEDLGNGKLALICPWHYFDFSLETGSSSS-------GLQNQVYDVRVLD-GKVYI 63          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Zebrafish
Match: RFESD (Rieske domain-containing protein-like [Source:NCBI gene;Acc:559859])

HSP 1 Score: 55.0694 bits (131), Expect = 9.317e-9
Identity = 32/103 (31.07%), Postives = 50/103 (48.54%), Query Frame = 2
Query:  455 ETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVE-----LMPEMQLKLYK----TLVKDNGEIFITFND 736
            +++    VL++       A + +C H G PL EGDIE+  +G   + CPWH +K  L +       V+     L P    K  K    T+ + NG++F+T ND
Sbjct:   34 KSIGGRDVLVIYHQGHFYAIDARCYHSGGPLQEGDIEDF-DGRTCIVCPWHKYKITLAEGEGLYQAVDPTVKPLKPTWCSKGIKQRIHTVTESNGDLFLTLND 135          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Zebrafish
Match: aifm4 (apoptosis inducing factor mitochondria associated 4 [Source:ZFIN;Acc:ZDB-GENE-070112-2282])

HSP 1 Score: 51.6026 bits (122), Expect = 2.594e-7
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 2
Query:  452 EETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFITFNDFNL 745
            E  V+  K+LL+R   E  A    C H GAPL +G +     GDR+ +CP+H   FN      +E+P ++ +P+ ++K+      D G++++T +  NL
Sbjct:   26 EVLVDENKILLVRNNGEFTAVGGLCSHYGAPLIKGTL----IGDRV-RCPFHGACFNTKTGDIEEFPGLDCLPKFKVKV------DGGKVYVTSDQKNL 113          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Zebrafish
Match: aifm5 (apoptosis inducing factor mitochondria associated 5 [Source:ZFIN;Acc:ZDB-GENE-091118-96])

HSP 1 Score: 53.1434 bits (126), Expect = 3.398e-7
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  449 LEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKL 685
            +E  V +  VLL+R      A  N+C H GAPL+EG +    +G R+ +CPWH   FN+     +EYP ++ +P  ++K+
Sbjct:    3 MEVEVGDHNVLLVRCDGVYSAISNQCTHYGAPLSEGVL----SGCRV-RCPWHGSCFNVKTGDLEEYPGIDCLPCHKVKV 77          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Xenopus
Match: plag1 (PLAG1 zinc finger [Source:Xenbase;Acc:XB-GENE-868443])

HSP 1 Score: 60.8474 bits (146), Expect = 1.314e-9
Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  410 GTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLD 628
            G K +    CT    E   +  VL+    ++  A ++ CPH+G PL +GDIE L +G   L CPWH+F+F LD
Sbjct:   25 GEKRSFKATCTKLFSEDGEHL-VLIHTTDDKFYAMDSSCPHEGGPLEQGDIEELCDGRLALTCPWHYFEFCLD 96          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Xenopus
Match: plag1 (PLAG1 zinc finger [Source:Xenbase;Acc:XB-GENE-868443])

HSP 1 Score: 60.8474 bits (146), Expect = 1.583e-9
Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  410 GTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLD 628
            G K +    CT    E   +  VL+    ++  A ++ CPH+G PL +GDIE L +G   L CPWH+F+F LD
Sbjct:   25 GEKRSFKATCTKLFSEDGEHL-VLIHTTDDKFYAMDSSCPHEGGPLEQGDIEELCDGRLALTCPWHYFEFCLD 96          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Xenopus
Match: nelfb (negative elongation factor complex member B [Source:Xenbase;Acc:XB-GENE-5814644])

HSP 1 Score: 52.373 bits (124), Expect = 9.038e-7
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  473 KVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLV 700
            K LL++   E  A  +KCPH GAPL +G    LS G   ++CPWH   FN+     +++P ++ +P+ Q+K+ K  V
Sbjct:   92 KALLVKQNGEYYAMGHKCPHYGAPLVKG---VLSKGR--VRCPWHGACFNIATGDIEDFPGLDALPKFQVKIEKERV 163          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Xenopus
Match: nelfb (negative elongation factor complex member B [Source:Xenbase;Acc:XB-GENE-5814644])

HSP 1 Score: 52.373 bits (124), Expect = 9.054e-7
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  473 KVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLV 700
            K LL++   E  A  +KCPH GAPL +G    LS G   ++CPWH   FN+     +++P ++ +P+ Q+K+ K  V
Sbjct:   89 KALLVKQNGEYYAMGHKCPHYGAPLVKG---VLSKGR--VRCPWHGACFNIATGDIEDFPGLDALPKFQVKIEKERV 160          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Xenopus
Match: nelfb (negative elongation factor complex member B [Source:Xenbase;Acc:XB-GENE-5814644])

HSP 1 Score: 52.373 bits (124), Expect = 9.864e-7
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  473 KVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLV 700
            K LL++   E  A  +KCPH GAPL +G    LS G   ++CPWH   FN+     +++P ++ +P+ Q+K+ K  V
Sbjct:   92 KALLVKQNGEYYAMGHKCPHYGAPLVKG---VLSKGR--VRCPWHGACFNIATGDIEDFPGLDALPKFQVKIEKERV 163          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. TrEMBL
Match: V4AL65 (Rieske domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_152940 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 7.169e-14
Identity = 45/117 (38.46%), Postives = 62/117 (52.99%), Query Frame = 2
Query:  380 SRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITF 730
             + K  ++V  TK   + N   G     N  KV L R G  V A ++KCPH G PL+ GDIE L NG+  ++CPWH +KF+L+  G  E+P           Y+  V + GEI+I F
Sbjct:   25 QKCKHTTAVINTKGLLNNNEKNGHLVECNEEKVALFRHGNNVYAVKDKCPHAGGPLHLGDIEELPNGNLCVKCPWHSWKFDLE-TGHAEFPKG--QSKTAVTYRVKVTETGEIYIGF 138          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. TrEMBL
Match: A0A210PYV8 (Rieske domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18584 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.336e-13
Identity = 48/143 (33.57%), Postives = 67/143 (46.85%), Query Frame = 2
Query:  335 FFSSRKTAIKNKLDLS----RAKTDSSVYGTKNTK-DKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMP---EMQLKLYKTLVKDNGEIFITFNDF 739
            FF  ++   K   D +    R KT S     KN    +N   G     N  K+ L R GE V A + KCPH G PL+ GDIE +  G   ++CPWH ++F+LD           MP   ++ + +Y   V  +G I I F+ F
Sbjct:    7 FFPVKELTYKELFDWADPVQRYKTSSVSVPRKNGLLRQNSRTGSLVDCNKMKIALFRHGERVFAVDEKCPHAGGPLHLGDIEEIPGGGLCVRCPWHSWRFDLDTGK------STMPRGRDLLMAIYPVRVDQDGIISIGFDKF 143          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. TrEMBL
Match: A0A2G8KEW3 (Putative Rieske domain-containing protein-like OS=Stichopus japonicus OX=307972 GN=BSL78_16582 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.446e-13
Identity = 40/112 (35.71%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  416 KNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLK---LYKTLVKDNGEIFITFNDFN 742
            + T  +    G    VN  +V L R GEEV A + KCPH+G PL+ GDIE L +    ++CPWHH+  +L     +       P  + +   +Y T V D+G IF+ F  F+
Sbjct:   56 RETTGRKLKTGRAVKVNGEEVALFRLGEEVFAVKEKCPHQGGPLHLGDIEVLPDRSLCVRCPWHHWCVDLASGRVRR------PSGRTQTTNVYMTKVTDDGNIFVGFKHFS 161          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. TrEMBL
Match: K1PS30 (Rieske domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10006737 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.192e-13
Identity = 35/108 (32.41%), Postives = 59/108 (54.63%), Query Frame = 2
Query:  419 NTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFN 742
              + +N   G   + N  ++ + R+ + V A + KCPH G PL+ GDIE L      ++CPWH +KF+LD    K+      P +   +Y  +VK++G++ I F+ F+
Sbjct:   42 GLRRQNSKTGTLVSCNEQQIAVFRYHDRVYAIKEKCPHLGGPLHLGDIEELPGNTLCVRCPWHSWKFDLDTGLLKQ---PKRPGVSSVVYPVIVKEDGKLMIGFDQFD 146          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. TrEMBL
Match: A0A1S3H7W7 (Rieske domain-containing protein OS=Lingula unguis OX=7574 GN=LOC106152883 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 9.359e-13
Identity = 46/145 (31.72%), Postives = 72/145 (49.66%), Query Frame = 2
Query:  314 STSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGT--KNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFN 742
            S++ D  FF  +        D S A+    +  T  +  + ++   G+   VN TK+ L R+G+++ A   KCPH G PL+ GDIE L +    ++CPWH +KF+L K G  ++P     +    +Y   V   G I I F  F+
Sbjct:    2 SSNGDKIFFPVKGVNFYELFDWSNAEERCKLTATDARKLRRQSSQSGVRVEVNETKIALFRYGDQLHAVNEKCPHAGGPLHIGDIEELPDFSVCVRCPWHGWKFDL-KTGRCKHPS--GEQRCTIVYAVRVDTQGNIEIGFESFS 143          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Cavefish
Match: si:ch73-314g15.3 (uncharacterized protein HI_0077-like [Source:NCBI gene;Acc:103033616])

HSP 1 Score: 60.8474 bits (146), Expect = 9.584e-10
Identity = 27/72 (37.50%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  509 ACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFI 724
            A ++ CPH+G PL++GDIE+L +G   L CPWH+F F+L+              +Q ++Y   V D G+++I
Sbjct:   85 AMDSSCPHEGGPLDQGDIEDLGDGKLALVCPWHYFDFSLETGASSS-------GLQNQVYDVRVVD-GKVYI 148          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Cavefish
Match: ENSAMXT00000043267.1 (Rieske domain-containing protein-like [Source:NCBI gene;Acc:107197454])

HSP 1 Score: 51.6026 bits (122), Expect = 1.391e-7
Identity = 34/102 (33.33%), Postives = 46/102 (45.10%), Query Frame = 2
Query:  458 TVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVE-----LMPEMQLKLYKTLVKD----NGEIFITFND 736
            +VN   VL+L     + A +  C H G PL  GDIE   +G   + CPWH +K  L +       V+     L P    K  K  V      +GE+F+T ND
Sbjct:   30 SVNGRDVLVLHHQGSLHALDLHCYHSGGPLQCGDIEEF-DGRLCIVCPWHKYKITLAEGEGLYQAVDPSIRPLRPVWSSKGVKQRVHRVTEVDGEVFVTLND 130          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Cavefish
Match: aifm5 (apoptosis inducing factor mitochondria associated 5 [Source:ZFIN;Acc:ZDB-GENE-091118-96])

HSP 1 Score: 52.7582 bits (125), Expect = 3.872e-7
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 2
Query:  449 LEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFN 733
            +E  V +  +LL++   E  A  N+C H GAPLN      + +G+R+ +CPWH   FN+     +EYP        L+ +K  V+D  ++++T N
Sbjct:   25 MEVDVGDHNILLVKCEGEYSAIGNQCTHYGAPLN-----TVLSGNRV-RCPWHGACFNVKTGDMEEYP----AMDSLRCHKVKVQDK-KVYVTVN 108          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Sea Lamprey
Match: si:ch73-314g15.3 (si:ch73-314g15.3 [Source:ZFIN;Acc:ZDB-GENE-030616-19])

HSP 1 Score: 57.3806 bits (137), Expect = 1.891e-9
Identity = 22/42 (52.38%), Postives = 28/42 (66.67%), Query Frame = 2
Query:  509 ACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKN 634
            A ++ CPH+G PL  GDIE+L +G   L CPWHHF F L+  
Sbjct:   22 AMDSACPHEGGPLELGDIEDLGSGKLALICPWHHFDFCLNTG 63          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Sea Lamprey
Match: si:ch211-212d10.2 (si:ch211-212d10.2 [Source:ZFIN;Acc:ZDB-GENE-050208-516])

HSP 1 Score: 52.373 bits (124), Expect = 7.510e-9
Identity = 28/69 (40.58%), Postives = 44/69 (63.77%), Query Frame = 2
Query:  524 CPH--KGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFI 724
            CPH  KG PLNEGDIE++  GD  + CPWH+++F++ K G  +        +Q ++Y+  V+D G +F+
Sbjct:   53 CPHQDKGGPLNEGDIEDIG-GDLKITCPWHYYQFDV-KTGKSD------TGLQQRVYEVKVED-GLVFV 112          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Medaka
Match: aifm5 (apoptosis-inducing factor 3 [Source:NCBI gene;Acc:101161742])

HSP 1 Score: 51.9878 bits (123), Expect = 6.003e-7
Identity = 30/99 (30.30%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  452 EETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFITFNDFNL 745
            E  + +  VLL R   +  A  N+C H GAPL++G +    +G+R+ +CPWH   FN+     +E+P ++ +P  ++K+       N ++++T N  +L
Sbjct:   33 EVEIGHHSVLLTRHEGKYSALGNQCTHYGAPLSQGVV----SGNRV-RCPWHGSCFNICTGDLEEFPGIDSLPCHKVKI------QNSKVYVTVNRKDL 120          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Medaka
Match: aifm3 (apoptosis inducing factor mitochondria associated 3 [Source:NCBI gene;Acc:101158534])

HSP 1 Score: 50.0618 bits (118), Expect = 2.754e-6
Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 2
Query:  452 EETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYK 691
            E  + + + LL++   E  A  +KCPH GAPL +G    LS G   ++CPWH   FN+     +++P ++ +P  Q+++ K
Sbjct:   85 EVDLGSGRALLIKEHGEFFAMGHKCPHYGAPLVKG---VLSKGH--VRCPWHGACFNVATGDIEDFPGLDSLPVFQVRVEK 160          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Medaka
Match: aifm3 (apoptosis inducing factor mitochondria associated 3 [Source:NCBI gene;Acc:101158534])

HSP 1 Score: 50.0618 bits (118), Expect = 2.767e-6
Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 2
Query:  452 EETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYK 691
            E  + + + LL++   E  A  +KCPH GAPL +G    LS G   ++CPWH   FN+     +++P ++ +P  Q+++ K
Sbjct:   85 EVDLGSGRALLIKEHGEFFAMGHKCPHYGAPLVKG---VLSKGH--VRCPWHGACFNVATGDIEDFPGLDSLPVFQVRVEK 160          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Medaka
Match: aifm4 (apoptosis-inducing factor 3 [Source:NCBI gene;Acc:101169960])

HSP 1 Score: 49.2914 bits (116), Expect = 5.295e-6
Identity = 28/101 (27.72%), Postives = 56/101 (55.45%), Query Frame = 2
Query:  452 EETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYP-VELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF 751
            E TV + KVL++R   +  A   +C H  APL +G +     G+R+ +CP+H   FN+     ++YP ++ +P  ++K+      ++G+++++ N  +L  
Sbjct:   33 EVTVQDQKVLVVRTQGQYFAVGGRCSHYNAPLIKGAL----VGERV-RCPFHGACFNVRTGDIEDYPGLDSLPTYKVKV------EDGKVYVSINQKSLKL 122          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Medaka
Match: ENSORLT00000007386.2 (Rieske domain-containing protein [Source:NCBI gene;Acc:101157781])

HSP 1 Score: 47.3654 bits (111), Expect = 7.445e-6
Identity = 29/97 (29.90%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  476 VLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNL-DKNGFKEY---PVELMPEMQL-------KLYKTLVKDNGEIFITFN 733
            VL+L    ++ A + +C H G  L  GDIE   NG   + CPWH +K  L +  G  +    P +  P           +++K + + NG++F+T N
Sbjct:   81 VLILYHDRQLYAMDKRCYHSGGELQHGDIEEF-NGRLCIVCPWHSYKITLAEGEGLYQAVDDPTKKPPRTHWRSKGVKQRIHK-VTEINGDVFVTLN 175          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Planmine SMEST
Match: SMESG000046042.1 (SMESG000046042.1)

HSP 1 Score: 470.7 bits (1210), Expect = 1.677e-168
Identity = 231/232 (99.57%), Postives = 231/232 (99.57%), Query Frame = 2
Query:   56 MSRNMIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKKYKKTDNSKSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF 751
            MSRNMIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKKYKKTDN KSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF
Sbjct:    1 MSRNMIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKKYKKTDNRKSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF 232          
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Planmine SMEST
Match: SMESG000046042.1 (SMESG000046042.1)

HSP 1 Score: 461.84 bits (1187), Expect = 4.065e-165
Identity = 227/228 (99.56%), Postives = 227/228 (99.56%), Query Frame = 2
Query:   68 MIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKKYKKTDNSKSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF 751
            MIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKKYKKTDN KSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF
Sbjct:    1 MIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKKYKKTDNRKSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKTAIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEVIACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPVELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF 228          
The following BLAST results are available for this feature:
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG41991.095e-629.89gene:FBgn0025628 transcript:FBtr0300254[more]
CG41991.095e-629.89gene:FBgn0025628 transcript:FBtr0070336[more]
CG41991.095e-629.89gene:FBgn0025628 transcript:FBtr0070334[more]
CG41991.095e-629.89gene:FBgn0025628 transcript:FBtr0300255[more]
CG41991.095e-629.89gene:FBgn0025628 transcript:FBtr0070335[more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-314g15.31.201e-938.89si:ch73-314g15.3 [Source:ZFIN;Acc:ZDB-GENE-030616-... [more]
si:ch73-314g15.32.907e-938.57si:ch73-314g15.3 [Source:ZFIN;Acc:ZDB-GENE-030616-... [more]
RFESD9.317e-931.07Rieske domain-containing protein-like [Source:NCBI... [more]
aifm42.594e-732.32apoptosis inducing factor mitochondria associated ... [more]
aifm53.398e-736.25apoptosis inducing factor mitochondria associated ... [more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plag11.314e-939.73PLAG1 zinc finger [Source:Xenbase;Acc:XB-GENE-8684... [more]
plag11.583e-939.73PLAG1 zinc finger [Source:Xenbase;Acc:XB-GENE-8684... [more]
nelfb9.038e-737.66negative elongation factor complex member B [Sourc... [more]
nelfb9.054e-737.66negative elongation factor complex member B [Sourc... [more]
nelfb9.864e-737.66negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AL657.169e-1438.46Rieske domain-containing protein OS=Lottia gigante... [more]
A0A210PYV81.336e-1333.57Rieske domain-containing protein OS=Mizuhopecten y... [more]
A0A2G8KEW31.446e-1335.71Putative Rieske domain-containing protein-like OS=... [more]
K1PS304.192e-1332.41Rieske domain-containing protein OS=Crassostrea gi... [more]
A0A1S3H7W79.359e-1331.72Rieske domain-containing protein OS=Lingula unguis... [more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-314g15.39.584e-1037.50uncharacterized protein HI_0077-like [Source:NCBI ... [more]
ENSAMXT00000043267.11.391e-733.33Rieske domain-containing protein-like [Source:NCBI... [more]
aifm53.872e-732.63apoptosis inducing factor mitochondria associated ... [more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch73-314g15.31.891e-952.38si:ch73-314g15.3 [Source:ZFIN;Acc:ZDB-GENE-030616-... [more]
si:ch211-212d10.27.510e-940.58si:ch211-212d10.2 [Source:ZFIN;Acc:ZDB-GENE-050208... [more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aifm56.003e-730.30apoptosis-inducing factor 3 [Source:NCBI gene;Acc:... [more]
aifm32.754e-633.33apoptosis inducing factor mitochondria associated ... [more]
aifm32.767e-633.33apoptosis inducing factor mitochondria associated ... [more]
aifm45.295e-627.72apoptosis-inducing factor 3 [Source:NCBI gene;Acc:... [more]
ENSORLT00000007386.27.445e-629.90Rieske domain-containing protein [Source:NCBI gene... [more]
back to top
BLAST of Pyridine nucleotide-disulfide oxidoreductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000046042.11.677e-16899.57SMESG000046042.1[more]
SMESG000046042.14.065e-16599.56SMESG000046042.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033880 ID=SMED30033880|Name=Pyridine nucleotide-disulfide oxidoreductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1172bp
AAAGATTTAATATATTGTTATTAATTTCTTCTAAATCTTACTATTTAATA
TATAAATGTCACGGAATATGATATATGTTCCAAAAACATTGTTAAAGCCA
TACGGCTTAAATGAAGTATGTATTCCATTTAAAATGGATAAAAACAGAGT
TAGAAACCATATAATAATCAATGATGAAAATAGTAATCAAATTCCAACTA
AAAAGTATAAAAAGACAGATAACAGTAAATCGGAATCACCCGAGTTTATT
TTTAAAGTCCCAAACCTTAAATTTAATGATCTTAAAGATATTAATAAAAT
GATTCAATCAAAATCCACTTCCATTGATAATAGTTTTTTCTCATCTCGTA
AGACGGCAATAAAAAATAAGTTAGATCTTTCTCGCGCAAAAACGGATAGT
TCTGTTTATGGAACAAAAAATACTAAAGATAAAAATTGCACAGTCGGTTT
AGAAGAAACTGTTAATAATACAAAGGTTTTACTGTTGCGTTTCGGAGAAG
AAGTGATTGCTTGTGAAAATAAATGCCCACATAAAGGGGCTCCTCTTAAT
GAAGGTGACATTGAAAATCTATCAAATGGTGATCGCATATTGCAATGTCC
ATGGCACCATTTCAAATTCAATCTTGATAAAAATGGGTTTAAGGAATATC
CCGTTGAATTAATGCCAGAAATGCAATTGAAATTGTATAAAACTCTAGTC
AAAGATAACGGAGAAATCTTTATAACTTTCAATGACTTCAATTTAAATTT
TTGAATATTCTGTATTTTATATAGCGTATTTCTGTTTTTTTGTTGTGATT
CGGAGTTGTTGACTTTTGCAATTTATCGCTTTTGAATTTAAAATGTATTT
ACATAATCTGAACGGTTTCATTGGAGGCATGTTTATTTATTATTTTATTG
ATTTATGTGCATTTTTATGGTGTTTCTCGCAATAGGGTTTTTTAAATATA
ACTAACAATTACAACAATTGGGATTAGTCCCAATAAGATATTGTATATAT
CGGTTTTCTTAACTGGAGAGTAAAATTTAATTAATAAAACTCACGTAATC
AAAAAGTGCTGATATTTTAAGTATAAATCATACAAGAAATCAAGAATATT
GAAAAATAATAAATTAAACCGGTACGACATTGTTACTTATTGAATACGTA
TTAGATATAATCAGTGCGTGAT
back to top

protein sequence of SMED30033880-orf-1

>SMED30033880-orf-1 ID=SMED30033880-orf-1|Name=SMED30033880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MSRNMIYVPKTLLKPYGLNEVCIPFKMDKNRVRNHIIINDENSNQIPTKK
YKKTDNSKSESPEFIFKVPNLKFNDLKDINKMIQSKSTSIDNSFFSSRKT
AIKNKLDLSRAKTDSSVYGTKNTKDKNCTVGLEETVNNTKVLLLRFGEEV
IACENKCPHKGAPLNEGDIENLSNGDRILQCPWHHFKFNLDKNGFKEYPV
ELMPEMQLKLYKTLVKDNGEIFITFNDFNLNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036922Rieske_2Fe-2S_sf
IPR017941Rieske_2Fe-2S
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0045454cell redox homeostasis
Vocabulary: molecular function
TermDefinition
GO:00515372 iron, 2 sulfur cluster binding
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017941Rieske [2Fe-2S] iron-sulphur domainPFAMPF00355Rieskecoord: 135..192
e-value: 1.4E-9
score: 37.8
IPR017941Rieske [2Fe-2S] iron-sulphur domainPROSITEPS51296RIESKEcoord: 135..222
score: 16.405
IPR036922Rieske [2Fe-2S] iron-sulphur domain superfamilyGENE3DG3DSA:2.102.10.10coord: 102..231
e-value: 3.5E-19
score: 70.9
IPR036922Rieske [2Fe-2S] iron-sulphur domain superfamilySUPERFAMILYSSF50022ISP domaincoord: 135..228
NoneNo IPR availablePANTHERPTHR21496FERREDOXIN-RELATEDcoord: 135..226