pim-3

Overview
Namepim-3 (AFJ24845.1)
Smed IDSMED30033864
Length (bp)1467
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of pim-3 (SMED30033864) t-SNE clustered cells

Violin plots show distribution of expression levels for pim-3 (SMED30033864) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of pim-3 (SMED30033864) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for pim-3 (SMED30033864) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033864

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033864SMESG000014593.1 dd_Smed_v4_6420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033864SMESG000014593.1 dd_Smed_v4_6420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033864SMESG000014593.1 dd_Smed_v4_6420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033864SMESG000014593.1 dd_Smed_v4_6420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033864SMESG000014593.1 dd_Smed_v4_6420_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of pim-3 vs. Ensembl Human
Match: PIM1 (Pim-1 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8986])

HSP 1 Score: 234.958 bits (598), Expect = 4.851e-73
Identity = 114/261 (43.68%), Postives = 166/261 (63.60%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E  + +YQ   ++G GGFG V   IR SD   VAIK +   +I+ W        +VP+E+ L+ +      GVI++  +F  +    + ++++R E   DLFD IT  G + E+ A +F  Q++  + +CHN GV HRDIKDENI+IDL+  ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLGILLYDMVCG++P+++D+ I+   + FR+ +S  CQ LI+ CL   P +RP+   I  H W
Sbjct:   32 EPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWF--ERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPW 289          
BLAST of pim-3 vs. Ensembl Human
Match: PIM2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8987])

HSP 1 Score: 234.572 bits (597), Expect = 5.964e-73
Identity = 118/263 (44.87%), Postives = 164/263 (62.36%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKV---DGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+ EY+   ++G+GGFG V    R +D+ QVAIK I  +++  W   S  +   PLE+AL+ +        GVI++  +F  +E  G+ +V++R     DLFD+IT  G + E  +  F  Q++  + +CH+ GV HRDIKDENI+IDL      LIDFG+G +LHD  Y++FDGTRVYSPPEWI   +YHA+P  +WSLGILLYDMVCG++P++ D  I+   L F   +S  C  LI+ CL   P +RPSL  IL   W
Sbjct:   26 EAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSD-SVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQE--GFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPW 285          
BLAST of pim-3 vs. Ensembl Human
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:19310])

HSP 1 Score: 232.646 bits (592), Expect = 4.924e-72
Identity = 119/266 (44.74%), Postives = 165/266 (62.03%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVD------GVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R +D   VA+K +   ++T W   S     VPLE+ L+   RKV       GVI++  +F  +   G+ +V++R E   DLFD IT  G + E  A  F  Q++  + +CH+ GV HRDIKDEN+++DL + ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLG+LLYDMVCG++P++ D+ I+   L FRR +S  CQ LI+ CL   P  RPSL  I  H W
Sbjct:   34 ESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWG--SLGGATVPLEVVLL---RKVGAAGGARGVIRLLDWF--ERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPW 292          
BLAST of pim-3 vs. Ensembl Human
Match: PIM2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8987])

HSP 1 Score: 164.081 bits (414), Expect = 4.458e-48
Identity = 74/143 (51.75%), Postives = 99/143 (69.23%), Query Frame = 2
Query:  515 IVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPIS 943
            +V++R     DLFD+IT  G + E  +  F  Q++  + +CH+ GV HRDIKDENI+IDL      LIDFG+G +LHD  Y++FDGTRVYSPPEWI   +YHA+P  +WSLGILLYDMVCG++P++ D  I+   L F   +S
Sbjct:    2 LVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVS 144          
BLAST of pim-3 vs. Ensembl Human
Match: NUAK2 (NUAK family kinase 2 [Source:HGNC Symbol;Acc:HGNC:29558])

HSP 1 Score: 130.568 bits (327), Expect = 8.782e-32
Identity = 90/268 (33.58%), Postives = 143/268 (53.36%), Query Frame = 2
Query:  254 DFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSE-FDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDD------GIVNCCLAFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            + ++ Y+ LE +G+G +GKV+KA R S  + VAIK I   KI        I +    EI +M        +I I + F   E+    +++  + +  DL+D+I+   Q+SE++A +F  Q+++ +  CH   V HRD+K ENI++D + N I + DFG   + H G + + F G+ +Y+ PE +  K Y    ++ WSLG+LLY +V G +P+D  D       I N   A+R P   S  C  LI+  L  NP  R +L ++  H W
Sbjct:   48 NLRHRYEFLETLGKGTYGKVKKA-RESSGRLVAIKSIRKDKIKDEQDLMHIRR----EIEIMSSLNHPH-IIAIHEVF---ENSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGN-IKIADFGLSNLYHQGKFLQTFCGSPLYASPEIVNGKPYTGPEVDSWSLGVLLYILVHGTMPFDGHDHKILVKQISNG--AYREPPKPSDAC-GLIRWLLMVNPTRRATLEDVASHWW 302          
BLAST of pim-3 vs. Ensembl Celegans
Match: prk-2 (Serine/threonine-protein kinase prk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20443])

HSP 1 Score: 207.223 bits (526), Expect = 2.496e-61
Identity = 112/271 (41.33%), Postives = 152/271 (56.09%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKIN-KQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNC----CLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            + S     F+  Y+    +G GGFG V +A+R  D   VA+KFI  S +  W   ++IN +QVP+EI ++ +C KV GVI++  ++ I E  G+ IVM+R    ID+FD I   G+ISE  A     Q+   +  C    V HRD+KDENI+IDL T    LIDFGA  +L    YS+F GTR+Y PPEW  +  Y      +WSLG+LLY+ + G LP+ N+  I        L F  P+S   +DLI  CL  +P  R SL  IL H W
Sbjct:   19 ESSRGFSKFKKNYKLKAELGRGGFGVVYRAVRTCDNALVAVKFIERSNVKEW---ARINGEQVPMEICMLAKCSKVRGVIRLLDWYSIPE--GFLIVMERPYPCIDMFDFIKGQGKISEDMARFLFRQIAVTVHECVQNRVLHRDLKDENIVIDLVTGSTKLIDFGAATVLRRSQYSDFQGTRLYCPPEWFLHSLYLGREAAVWSLGVLLYNSLNGRLPFRNEKDICTAHLLGPLPFFVPVSAEVKDLISKCLTFDPFQRCSLEAILNHPW 284          
BLAST of pim-3 vs. Ensembl Celegans
Match: prk-2 (Serine/threonine-protein kinase prk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20443])

HSP 1 Score: 207.223 bits (526), Expect = 2.496e-61
Identity = 112/271 (41.33%), Postives = 152/271 (56.09%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKIN-KQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNC----CLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            + S     F+  Y+    +G GGFG V +A+R  D   VA+KFI  S +  W   ++IN +QVP+EI ++ +C KV GVI++  ++ I E  G+ IVM+R    ID+FD I   G+ISE  A     Q+   +  C    V HRD+KDENI+IDL T    LIDFGA  +L    YS+F GTR+Y PPEW  +  Y      +WSLG+LLY+ + G LP+ N+  I        L F  P+S   +DLI  CL  +P  R SL  IL H W
Sbjct:   19 ESSRGFSKFKKNYKLKAELGRGGFGVVYRAVRTCDNALVAVKFIERSNVKEW---ARINGEQVPMEICMLAKCSKVRGVIRLLDWYSIPE--GFLIVMERPYPCIDMFDFIKGQGKISEDMARFLFRQIAVTVHECVQNRVLHRDLKDENIVIDLVTGSTKLIDFGAATVLRRSQYSDFQGTRLYCPPEWFLHSLYLGREAAVWSLGVLLYNSLNGRLPFRNEKDICTAHLLGPLPFFVPVSAEVKDLISKCLTFDPFQRCSLEAILNHPW 284          
BLAST of pim-3 vs. Ensembl Celegans
Match: prk-1 (Pim (Mammalian oncogene) Related Kinase [Source:UniProtKB/TrEMBL;Acc:K8ESD7])

HSP 1 Score: 180.259 bits (456), Expect = 1.017e-51
Identity = 96/263 (36.50%), Postives = 151/263 (57.41%), Query Frame = 2
Query:  248 LEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQ-VAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNL-GVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +++F+ +Y+ L+ IG GGFG V +A  R D +Q VA+KF+ +  + SW    +  + +P E+  +  C  + GVIKI  +F     KG+ IVM+R  N +DLFD ++  G ++E        Q+IT + N ++  G+ HRDIKDEN+I++++T ++ L+DFGA          EF GTR Y PPEW + + Y  +    WSLG+LL+ ++ G LP+ N+  I    + F   +S     L+K+CL  +   R SL+ I  H W
Sbjct:   27 VKEFKRKYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSWTMTCR--QLIPSEVCHLETCEDIPGVIKILDWF--ANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKATKKEFQGTRSYCPPEWFRDQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARASLAQIAAHPW 285          
BLAST of pim-3 vs. Ensembl Celegans
Match: prk-1 (Pim (Mammalian oncogene) Related Kinase [Source:UniProtKB/TrEMBL;Acc:K8ESD7])

HSP 1 Score: 182.57 bits (462), Expect = 6.483e-51
Identity = 96/263 (36.50%), Postives = 151/263 (57.41%), Query Frame = 2
Query:  248 LEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQ-VAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNL-GVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +++F+ +Y+ L+ IG GGFG V +A  R D +Q VA+KF+ +  + SW    +  + +P E+  +  C  + GVIKI  +F     KG+ IVM+R  N +DLFD ++  G ++E        Q+IT + N ++  G+ HRDIKDEN+I++++T ++ L+DFGA          EF GTR Y PPEW + + Y  +    WSLG+LL+ ++ G LP+ N+  I    + F   +S     L+K+CL  +   R SL+ I  H W
Sbjct:   27 VKEFKRKYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSWTMTCR--QLIPSEVCHLETCEDIPGVIKILDWF--ANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKATKKEFQGTRSYCPPEWFRDQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARASLAQIAAHPW 285          
BLAST of pim-3 vs. Ensembl Celegans
Match: prk-1 (Pim (Mammalian oncogene) Related Kinase [Source:UniProtKB/TrEMBL;Acc:K8ESD7])

HSP 1 Score: 182.185 bits (461), Expect = 1.000e-50
Identity = 96/263 (36.50%), Postives = 151/263 (57.41%), Query Frame = 2
Query:  248 LEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQ-VAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNL-GVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +++F+ +Y+ L+ IG GGFG V +A  R D +Q VA+KF+ +  + SW    +  + +P E+  +  C  + GVIKI  +F     KG+ IVM+R  N +DLFD ++  G ++E        Q+IT + N ++  G+ HRDIKDEN+I++++T ++ L+DFGA          EF GTR Y PPEW + + Y  +    WSLG+LL+ ++ G LP+ N+  I    + F   +S     L+K+CL  +   R SL+ I  H W
Sbjct:   50 VKEFKRKYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSWTMTCR--QLIPSEVCHLETCEDIPGVIKILDWF--ANSKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKATKKEFQGTRSYCPPEWFRDQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARASLAQIAAHPW 308          
BLAST of pim-3 vs. Ensembl Fly
Match: Sik2 (gene:FBgn0025625 transcript:FBtr0070340)

HSP 1 Score: 128.642 bits (322), Expect = 3.714e-31
Identity = 83/256 (32.42%), Postives = 136/256 (53.12%), Query Frame = 2
Query:  284 IIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDG-LYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDND--DGIVNCCLA--FRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
             IG+G F  V+ A  R  K +VAIK I  S++   +      ++V  E+ +M R +       I K + + E K    ++  + +  ++FD+I   G++SE  A     Q+I+ +  CH  G+ HRD+K EN+++DL+ N I + DFG       G L + + G+  Y+ PE  + K+Y    ++IWSLG++LY +VCG LP+D      + +  L+  FR P  +S  C+ LI+  L   P  R ++  I +HRW
Sbjct:  146 TIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNL-----QKVYREVEIMKRLKHP----HIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMN-IKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRMLVLEPTRRYTIDQIKRHRW 391          
BLAST of pim-3 vs. Ensembl Fly
Match: KP78a (gene:FBgn0026064 transcript:FBtr0301426)

HSP 1 Score: 127.872 bits (320), Expect = 3.717e-31
Identity = 79/263 (30.04%), Postives = 142/263 (53.99%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSE-FDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCL------AFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+ ++ +G+G F KV+ AI     ++VAIK I  +++ +        +++  E+ +M +      ++++F+   I+  +  Y+VM+ + +  +LFDH+   G++ E+DA     QL++ +  CH+  V HRD+K EN+++D   N I + DFG G         E F G+  Y+ PE    ++Y    ++ WSLG++LY +V G+LP+D   G +           +R P  IS  C++L++  L  NP  R SLS ++  +W
Sbjct:   98 YKIIKTLGKGNFAKVKLAIHVPTGREVAIKVIDKTQLNT-----SARQKLYREVKIM-KLLNHPNIVRLFQV--IESERTLYLVME-YASRGELFDHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRDLKAENLLLDQHMN-IKIADFGFGNTFDPNAQLETFCGSPPYAAPELFMGRKYAGPEVDAWSLGVVLYTLVSGSLPFDG--GTLKELRERVLRGKYRVPYYISMDCENLMRKFLVLNPAKRTSLSAVMSDKW 348          
BLAST of pim-3 vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0304024)

HSP 1 Score: 126.331 bits (316), Expect = 1.477e-30
Identity = 83/261 (31.80%), Postives = 133/261 (50.96%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGL-YSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGI---VNCCLA-FRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+  + IG+G F  V+ A     K +VAIK I  + +   +    +NK    EIA++   R       I + + + E +    ++  +  + ++FDH+   G++ E +A+    QL++ +  CH  GV HRD+K EN+++D   N I L DFG      +G     + G+  Y+ PE  Q   Y     +IWSLG++LY +VCG LP+D    +       L  FR P  +S  C+ LI+N L   P+ R ++  I+KHRW
Sbjct:   41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEY----LNKTF-REIAILKSLRHP----HITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMN-IKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRW 291          
BLAST of pim-3 vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344259)

HSP 1 Score: 125.176 bits (313), Expect = 5.553e-30
Identity = 83/261 (31.80%), Postives = 133/261 (50.96%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGL-YSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGI---VNCCLA-FRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+  + IG+G F  V+ A     K +VAIK I  + +   +    +NK    EIA++   R       I + + + E +    ++  +  + ++FDH+   G++ E +A+    QL++ +  CH  GV HRD+K EN+++D   N I L DFG      +G     + G+  Y+ PE  Q   Y     +IWSLG++LY +VCG LP+D    +       L  FR P  +S  C+ LI+N L   P+ R ++  I+KHRW
Sbjct:   41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEY----LNKTF-REIAILKSLRHP----HITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMN-IKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRW 291          
BLAST of pim-3 vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344258)

HSP 1 Score: 125.176 bits (313), Expect = 5.558e-30
Identity = 83/261 (31.80%), Postives = 133/261 (50.96%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGL-YSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGI---VNCCLA-FRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+  + IG+G F  V+ A     K +VAIK I  + +   +    +NK    EIA++   R       I + + + E +    ++  +  + ++FDH+   G++ E +A+    QL++ +  CH  GV HRD+K EN+++D   N I L DFG      +G     + G+  Y+ PE  Q   Y     +IWSLG++LY +VCG LP+D    +       L  FR P  +S  C+ LI+N L   P+ R ++  I+KHRW
Sbjct:   41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEY----LNKTF-REIAILKSLRHP----HITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMN-IKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRW 291          
BLAST of pim-3 vs. Ensembl Zebrafish
Match: pim1 (Pim-1 proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-061013-139])

HSP 1 Score: 249.595 bits (636), Expect = 8.294e-79
Identity = 126/267 (47.19%), Postives = 170/267 (63.67%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRC-RKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Q+ EK E F   YQ   ++G GGFG V   +R +D   VAIK ++  ++T W        +VP+EI L+ +      GVIK+  ++  +    + IVM+R E   DLFD IT  G + E+ A NF  Q++  + +CHN GV HRDIKDENI+IDL T  + LIDFG+G +L D +Y++FDGTRVYSPPEWI++ RYH     +WSLGILLYDMVCG++P++ D+ IV   + FRR IS  CQ LIK CL   P +RPS  +I+ H W
Sbjct:   24 QVKEK-EPFDKVYQVGTVLGSGGFGTVYAGLRIADGAPVAIKHVAKDRVTEWGELPN-GARVPMEIVLLKKVGTGFRGVIKMLDWY--ERPDSFIIVMERPEVVKDLFDFITEKGALPEELARNFFRQVLEAVRHCHNSGVVHRDIKDENILIDLRTGDLKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIKFHRYHGRSATVWSLGILLYDMVCGDIPFEQDEEIVRGQVLFRRRISTECQQLIKWCLALRPADRPSFEDIINHDW 286          
BLAST of pim-3 vs. Ensembl Zebrafish
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-050809-111])

HSP 1 Score: 239.58 bits (610), Expect = 5.687e-75
Identity = 121/262 (46.18%), Postives = 169/262 (64.50%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQ-VPLEIALMCRCRKV-DGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  Y    ++G GGFG V    R SD   VAIK ++  ++T W     IN   +PLEI L+ +      GVIK+  ++  +   GW I+M+R E   DLFD+IT  G + E  A  F  Q++  + +C++ GV HRDIKDEN+++DL T  + LIDFG+G IL D +Y++FDGTRVYSPPEWI+Y RYH     +WSLG+LLYDMVCG++P+++D+ I+   L FRR +S +CQ LIK CL   P +RP+L  I +H+W
Sbjct:   35 EPFEKVYHVGSVLGSGGFGTVYAGTRISDALPVAIKHVAKERVTEW---GTINGSLIPLEIVLLKKVGSTFQGVIKLIDWY--ERPDGWLIIMERPEMVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAILKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEHDEEILRGRLFFRRRVSPVCQQLIKWCLCLRPSDRPTLEQIFEHQW 291          
BLAST of pim-3 vs. Ensembl Zebrafish
Match: pim2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:58054])

HSP 1 Score: 235.728 bits (600), Expect = 1.721e-73
Identity = 119/267 (44.57%), Postives = 166/267 (62.17%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDG-------VIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+ +Y    ++G GGFG V    R SD ++VAIK IS  +I  W         VP EIAL+       G       +I++  +F I   + + IV ++ ++  DLFD IT  G + E  A  F+ Q+I  +  CH+ G+ HRDIKDENI++D  T  I +IDFG+G  L D +Y++F+GTRVYSPPEWI Y +YHA+PL +WSLG+LLYDMVCG++P++ D  IV    +F + IS+ C+ LI +CL  NP +RPSL  IL+H W
Sbjct:   24 EHFEKQYTMGNLLGSGGFGSVYSGHRISDGQKVAIKQISRDRIQQWSKMPGEVNPVPNEIALLQSLGGGSGSVPGHRGIIRMLDWFEIPGQE-YLIVFEKPQHCQDLFDFITERGALDESLARRFLKQVIEAVQFCHSKGIVHRDIKDENILVDTRTGDIKVIDFGSGATLKDSMYTDFEGTRVYSPPEWILYHKYHALPLTVWSLGVLLYDMVCGDIPFEQDTDIVKAKPSFNKRISNDCRSLICSCLSFNPGDRPSLEQILQHPW 289          
BLAST of pim-3 vs. Ensembl Zebrafish
Match: pimr26 (Pim proto-oncogene, serine/threonine kinase, related 26 [Source:ZFIN;Acc:ZDB-GENE-131120-6])

HSP 1 Score: 179.874 bits (455), Expect = 6.499e-52
Identity = 90/256 (35.16%), Postives = 136/256 (53.12%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYF-YIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVN-CCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            YQ   ++G GGFG V   +RRSD   VAIK++S  + T          ++PLE+ALM R         + +   +    + + ++++R +   DL       G + E+ A   + QLI  L +C + GV HRD+K EN++I   +  I L+DFG G +L    Y  F GT  Y+PPEW +  RYHA P  +WS+G+ LY+++C   P+     + +   L F R +S  C+ LI+ CL   P +RPSL +I  H W
Sbjct:   66 YQKGPLLGRGGFGSVFAGMRRSDGLPVAIKYVSKDR-TPERLKVDGQGRLPLEVALMTRVTSAPACPSVLQLLDWFDRPRRYILILERLDPCQDLQSFCEENGCLDERLAKKVLVQLIAALKHCESRGVLHRDVKPENLLISTESQDIKLLDFGCGDLLKRSAYKYFAGTPAYAPPEWFRRHRYHATPATVWSVGVTLYNILCDRFPFRGAQRVTSRSRLTFPRSLSTECRQLIRWCLSAAPADRPSLDDIESHPW 320          
BLAST of pim-3 vs. Ensembl Zebrafish
Match: pimr27 (Pim proto-oncogene, serine/threonine kinase, related 27 [Source:ZFIN;Acc:ZDB-GENE-131119-75])

HSP 1 Score: 179.489 bits (454), Expect = 7.729e-52
Identity = 90/256 (35.16%), Postives = 136/256 (53.12%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYF-YIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVN-CCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            YQ   ++G GGFG V   +RRSD   VAIK++S  + T          ++PLE+ALM R         + +   +    + + ++++R +   DL       G + E+ A   + QLI  L +C + GV HRD+K EN++I   +  I L+DFG G +L    Y  F GT  Y+PPEW +  RYHA P  +WS+G+ LY+++C   P+     + +   L F R +S  C+ LI+ CL   P +RPSL +I  H W
Sbjct:   69 YQKGPLLGRGGFGSVFAGMRRSDGLPVAIKYVSKDR-TPERLKVDGQGRLPLEVALMTRVTSAPACPSVLQLLDWFDRPRRYILILERLDPCQDLQSFCEENGCLDERLAKKVLVQLIAALKHCESRGVLHRDVKPENLLISTESQDIKLLDFGCGDLLKRSAYKYFAGTPAYAPPEWFRRHRYHATPATVWSVGVTLYNILCDRFPFRGAQRVTSRSRLTFPRSLSTECRQLIRWCLSAAPADRPSLDDIESHPW 323          
BLAST of pim-3 vs. Ensembl Xenopus
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:100497723])

HSP 1 Score: 242.662 bits (618), Expect = 6.037e-76
Identity = 120/264 (45.45%), Postives = 168/264 (63.64%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVD----GVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R +D   VA+K ++  ++T W   + +   VPLEI L+   +KV     GVIK+  ++  +   G+ IVM+R E   DLFD+IT  G + E  A  F  Q++  + +C++ GV HRDIKDEN+++DL   ++ LIDFG+G +L D +Y++FDGTRVYSPPEW++Y RYH     +WSLG+LLYDMVCG++P++ D+ IV   L FRR IS  CQ LIK CL   P +RP+L  I  H W
Sbjct:   34 EPFEKVYQVGSVLGSGGFGTVYSGSRIADGLPVAVKHVAKERVTDWGTLNGV--MVPLEIVLL---KKVGTGFRGVIKLLDWY--ERADGFLIVMERPEPVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRNGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWVRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEIVRVRLYFRRRISTECQQLIKWCLSLRPSDRPTLEQIFDHPW 290          
BLAST of pim-3 vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 242.276 bits (617), Expect = 1.593e-75
Identity = 123/269 (45.72%), Postives = 173/269 (64.31%), Query Frame = 2
Query:  236 MSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCR----CRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            + E  E F+  YQ   +IG GGFG V   +R SDK  VAIK +S  +I      +     VPLEI L+ +    CR   GVI++  ++  +   G+ I+M+R E   DLFD IT  G + E+ A+NF  Q++  + +CH+  V HRDIKDENI++DL T ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI++ +YH     +WSLGILLYDMVCG++P+++DD I+   + +R  +S  CQ LI+ CL + P +RPSL  IL H W
Sbjct:   45 LCEVKEPFENCYQVGPVIGTGGFGTVYSGVRISDKLPVAIKHVSRDRIGEMKHMN--GTLVPLEIYLLKKVSNGCR---GVIRLLDWY--ERPDGFIIIMERPEPVQDLFDFITERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFDGTRVYSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPW 306          
BLAST of pim-3 vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 240.736 bits (613), Expect = 3.603e-75
Identity = 129/310 (41.61%), Postives = 186/310 (60.00%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCR----CRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRWXXXXXXXXXXXXXXXTIQLNSFLHSKTNINQTKTLTQAFSYSPESS 1168
            E F+  YQ   +IG GGFG V   +R SDK  VAIK +S  +I      +     VPLEI L+ +    CR   GVI++  ++  +   G+ I+M+R E   DLFD IT  G + E+ A+NF  Q++  + +CH+  V HRDIKDENI++DL T ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI++ +YH     +WSLGILLYDMVCG++P+++DD I+   + +R  +S  CQ LI+ CL + P +RPSL  IL H W                +  ++FL  K N   ++ L Q  + + + S
Sbjct:   31 EPFENCYQVGPVIGTGGFGTVYSGVRISDKLPVAIKHVSRDRIGEMKHMN--GTLVPLEIYLLKKVSNGCR---GVIRLLDWY--ERPDGFIIIMERPEPVQDLFDFITERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFDGTRVYSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPW----------------MSQDNFLDKKDNGKVSRKLDQEATTTSKDS 317          
BLAST of pim-3 vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 134.035 bits (336), Expect = 2.471e-33
Identity = 93/264 (35.23%), Postives = 141/264 (53.41%), Query Frame = 2
Query:  257 FQYEYQSLEIIGEGGFGKVRKAIRR-SDKKQVAIKFISNSKITS--WHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIII--DLSTNKIYLIDFGAGGILHDG-LYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +  +YQ++  +G+G FG V  A  R S K++V +KFI   ++    W    ++ K V  EIA++ R +  + +I++   F  +    + +VM+   + +DLFD I +   + E  AS    QL++ +   HN  + HRDIKDENIII  D S   I L+DFG+   LH G L+S F GT  Y  PE +    Y    LE+WSLG+ LY ++ G  P+   D I+   L     +S   Q LI   L+R+PE R +L  +L+  W
Sbjct:  234 YALKYQTVSPLGKGAFGFVWSACGRDSAKEEVVVKFIRKDRVLDDCWVQDPELGK-VTQEIAILSRVQHPN-IIRVVDVF--ENDTFFQLVMELHGDGLDLFDFIDSQPSLDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAPDFS---IKLVDFGSAAHLHQGTLFSTFCGTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPW 490          
BLAST of pim-3 vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 134.806 bits (338), Expect = 6.961e-33
Identity = 93/264 (35.23%), Postives = 141/264 (53.41%), Query Frame = 2
Query:  257 FQYEYQSLEIIGEGGFGKVRKAIRR-SDKKQVAIKFISNSKITS--WHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIII--DLSTNKIYLIDFGAGGILHDG-LYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +  +YQ++  +G+G FG V  A  R S K++V +KFI   ++    W    ++ K V  EIA++ R +  + +I++   F  +    + +VM+   + +DLFD I +   + E  AS    QL++ +   HN  + HRDIKDENIII  D S   I L+DFG+   LH G L+S F GT  Y  PE +    Y    LE+WSLG+ LY ++ G  P+   D I+   L     +S   Q LI   L+R+PE R +L  +L+  W
Sbjct:  885 YALKYQTVSPLGKGAFGFVWSACGRDSAKEEVVVKFIRKDRVLDDCWVQDPELGK-VTQEIAILSRVQHPN-IIRVVDVF--ENDTFFQLVMELHGDGLDLFDFIDSQPSLDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAPDFS---IKLVDFGSAAHLHQGTLFSTFCGTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPW 1141          
BLAST of pim-3 vs. Ensembl Mouse
Match: Pim2 (proviral integration site 2 [Source:MGI Symbol;Acc:MGI:97587])

HSP 1 Score: 241.506 bits (615), Expect = 6.624e-75
Identity = 118/261 (45.21%), Postives = 167/261 (63.98%), Query Frame = 2
Query:  257 FQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDG---VIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            F+ EY+   ++G+GGFG V    R +D++QVAIK IS +++  W   S  +   PLE+AL+ +  + +G   VI++  +F   E  G+ +V++R     DLFD+IT  G + E  + +F  Q++  + +CH  GV HRDIKDENI+IDL    I LIDFG+G +LHD  Y++FDGTRVYSPPEWI   +YHA+P  +WSLG+LLYDMVCG++P++ D  I+   L F   +S  C  LI+ CL   P +RPSL  IL   W
Sbjct:   87 FEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWSTVSD-SVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPE--GFMLVLERPMPAQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPW 344          
BLAST of pim-3 vs. Ensembl Mouse
Match: Pim2 (proviral integration site 2 [Source:MGI Symbol;Acc:MGI:97587])

HSP 1 Score: 241.506 bits (615), Expect = 7.715e-75
Identity = 118/261 (45.21%), Postives = 167/261 (63.98%), Query Frame = 2
Query:  257 FQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDG---VIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            F+ EY+   ++G+GGFG V    R +D++QVAIK IS +++  W   S  +   PLE+AL+ +  + +G   VI++  +F   E  G+ +V++R     DLFD+IT  G + E  + +F  Q++  + +CH  GV HRDIKDENI+IDL    I LIDFG+G +LHD  Y++FDGTRVYSPPEWI   +YHA+P  +WSLG+LLYDMVCG++P++ D  I+   L F   +S  C  LI+ CL   P +RPSL  IL   W
Sbjct:   93 FEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWSTVSD-SVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPE--GFMLVLERPMPAQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPW 350          
BLAST of pim-3 vs. Ensembl Mouse
Match: Pim1 (proviral integration site 1 [Source:MGI Symbol;Acc:MGI:97584])

HSP 1 Score: 237.654 bits (605), Expect = 2.901e-74
Identity = 117/261 (44.83%), Postives = 164/261 (62.84%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E  + +YQ   ++G GGFG V   IR +D   VAIK +   +I+ W        +VP+E+ L+ +      GVI++  +F  +    + ++++R E   DLFD IT  G + E  A  F  Q++  + +CHN GV HRDIKDENI+IDLS  +I LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLGILLYDMVCG++P+++D+ I+   + FR+ +S  CQ LIK CL   P +RPS   I  H W
Sbjct:   32 EPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSDFSGVIRLLDWF--ERPDSFVLILERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGEIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPW 289          
BLAST of pim-3 vs. Ensembl Mouse
Match: Pim3 (proviral integration site 3 [Source:MGI Symbol;Acc:MGI:1355297])

HSP 1 Score: 233.802 bits (595), Expect = 1.652e-72
Identity = 119/266 (44.74%), Postives = 165/266 (62.03%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVD------GVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R +D   VA+K +   ++T W     +   VPLE+ L+   RKV       GVI++  +F  +   G+ +V++R E   DLFD IT  G + E  A  F  Q++  + +CHN GV HRDIKDEN+++DL + ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLG+LLYDMVCG++P++ D+ I+   L FRR +S  CQ LI+ CL   P  RPSL  I  H W
Sbjct:   34 ESFEKVYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGV--AVPLEVVLL---RKVGAAGGARGVIRLLDWF--ERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPW 292          
BLAST of pim-3 vs. Ensembl Mouse
Match: Pim1 (proviral integration site 1 [Source:MGI Symbol;Acc:MGI:97584])

HSP 1 Score: 140.969 bits (354), Expect = 7.253e-39
Identity = 75/187 (40.11%), Postives = 107/187 (57.22%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQY 808
            E  + +YQ   ++G GGFG V   IR +D                         +VP+E+ L+ +      GVI++  +F  +    + ++++R E   DLFD IT  G + E  A  F  Q++  + +CHN GV HRDIKDENI+IDLS  +I LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y
Sbjct:   28 EPLESQYQVGPLLGSGGFGSVYSGIRVADN------------------LPPNGTRVPMEVVLLKKVSSDFSGVIRLLDWF--ERPDSFVLILERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGEIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRY 194          
BLAST of pim-3 vs. UniProt/SwissProt
Match: sp|Q9PU85|PIM3_COTJA (Serine/threonine-protein kinase pim-3 OS=Coturnix japonica OX=93934 GN=PIM3 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 5.180e-75
Identity = 119/261 (45.59%), Postives = 163/261 (62.45%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRC-RKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F   YQ   ++G GGFG V    R +D   VA+K +   ++T W     +   VPLEI L+ +      GVIK+  ++  +   G+ IVM+R E   DLFD IT  G + E  A  F  Q++  + +C+  GV HRDIKDEN+++DL T ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLG+LLYDMVCG++P++ D+ I+   L FRR IS  CQ LIK CL   P +RP+L  I  H+W
Sbjct:   34 EPFDKVYQVGSVLGSGGFGTVYAGSRTADGLPVAVKHVVKERVTEWGTIGGV--MVPLEIVLLKKVGSGFRGVIKLLDWY--ERPDGFLIVMERPELVKDLFDFITEKGALDEDTARGFFRQVLEAVRHCYGCGVVHRDIKDENLLVDLRTGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLYFRRRISPECQQLIKWCLSLRPSDRPTLEQIFDHQW 290          
BLAST of pim-3 vs. UniProt/SwissProt
Match: sp|Q62070|PIM2_MOUSE (Serine/threonine-protein kinase pim-2 OS=Mus musculus OX=10090 GN=Pim2 PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 4.634e-74
Identity = 118/261 (45.21%), Postives = 167/261 (63.98%), Query Frame = 2
Query:  257 FQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDG---VIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            F+ EY+   ++G+GGFG V    R +D++QVAIK IS +++  W   S  +   PLE+AL+ +  + +G   VI++  +F   E  G+ +V++R     DLFD+IT  G + E  + +F  Q++  + +CH  GV HRDIKDENI+IDL    I LIDFG+G +LHD  Y++FDGTRVYSPPEWI   +YHA+P  +WSLG+LLYDMVCG++P++ D  I+   L F   +S  C  LI+ CL   P +RPSL  IL   W
Sbjct:   87 FEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWSTVSD-SVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPE--GFMLVLERPMPAQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPW 344          
BLAST of pim-3 vs. UniProt/SwissProt
Match: sp|P06803|PIM1_MOUSE (Serine/threonine-protein kinase pim-1 OS=Mus musculus OX=10090 GN=Pim1 PE=1 SV=3)

HSP 1 Score: 237.654 bits (605), Expect = 2.029e-73
Identity = 117/261 (44.83%), Postives = 164/261 (62.84%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E  + +YQ   ++G GGFG V   IR +D   VAIK +   +I+ W        +VP+E+ L+ +      GVI++  +F  +    + ++++R E   DLFD IT  G + E  A  F  Q++  + +CHN GV HRDIKDENI+IDLS  +I LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLGILLYDMVCG++P+++D+ I+   + FR+ +S  CQ LIK CL   P +RPS   I  H W
Sbjct:   32 EPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSDFSGVIRLLDWF--ERPDSFVLILERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGEIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPW 289          
BLAST of pim-3 vs. UniProt/SwissProt
Match: sp|Q9YHZ5|PIM2_DANRE (Serine/threonine-protein kinase pim-2 OS=Danio rerio OX=7955 GN=pim2 PE=2 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 9.225e-73
Identity = 119/267 (44.57%), Postives = 166/267 (62.17%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDG-------VIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+ +Y    ++G GGFG V    R SD ++VAIK IS  +I  W         VP EIAL+       G       +I++  +F I   + + IV ++ ++  DLFD IT  G + E  A  F+ Q+I  +  CH+ G+ HRDIKDENI++D  T  I +IDFG+G  L D +Y++F+GTRVYSPPEWI Y +YHA+PL +WSLG+LLYDMVCG++P++ D  IV    +F + IS+ C+ LI +CL  NP +RPSL  IL+H W
Sbjct:   24 EHFEKQYTMGNLLGSGGFGSVYSGHRISDGQKVAIKQISRDRIQQWSKMPGEVNPVPNEIALLQSLGGGSGSVPGHRGIIRMLDWFEIPGQE-YLIVFEKPQHCQDLFDFITERGALDESLARRFLKQVIEAVQFCHSKGIVHRDIKDENILVDTRTGDIKVIDFGSGATLKDSMYTDFEGTRVYSPPEWILYHKYHALPLTVWSLGVLLYDMVCGDIPFEQDTDIVKAKPSFNKRISNDCRSLICSCLSYNPGDRPSLEQILQHPW 289          
BLAST of pim-3 vs. UniProt/SwissProt
Match: sp|P26794|PIM1_RAT (Serine/threonine-protein kinase pim-1 OS=Rattus norvegicus OX=10116 GN=Pim1 PE=1 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.162e-72
Identity = 115/261 (44.06%), Postives = 166/261 (63.60%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E  + +YQ   ++G GGFG V   IR +D   VAIK +   +I+ W        +VP+E+ L+ +      GVI++  +F  +    + ++++R E   DLFD IT  G + E+ A +F  Q++  + +CHN GV HRDIKDENI+IDL+  ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLGILLYDMVCG++P+++D+ IV   + FR+ +S  CQ LI+ CL   P +RPS   I  H W
Sbjct:   32 EPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWF--ERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIVKGQVYFRQRVSSECQHLIRWCLSLRPSDRPSFEEIQNHPW 289          
BLAST of pim-3 vs. TrEMBL
Match: I1ZIJ1 (Pim-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 362/367 (98.64%), Postives = 363/367 (98.91%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRWXXXXXXXXXXXXXXXTIQLNSFLHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVNDESISKQQFSFENSDDFISCHNSKSKHLF 1333
            QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHA+PLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISH CQDLIKNCLERNPENRPSLSNILKHRWFSSFSKSSYSDNSKSTIQLNS LHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVNDESISKQ F FENSDDFISCHNSKSKHLF
Sbjct:   12 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAVPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHFCQDLIKNCLERNPENRPSLSNILKHRWFSSFSKSSYSDNSKSTIQLNSSLHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVNDESISKQPFFFENSDDFISCHNSKSKHLF 378          
BLAST of pim-3 vs. TrEMBL
Match: T1D128 (Pim-3 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 3.338e-123
Identity = 198/355 (55.77%), Postives = 255/355 (71.83%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRWXXXXXXXXXXXXXXXT----IQLNSFLHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVND---ESISKQQFSFENSDDFISCHN 1312
            Y+ L++IGEGGFGKVR AI+ SD++ VAIKF+S+ KITSW++     K +P+EI+LMCRCR+V GVIKI KYF IKEHKGWYI+M+RFE  +DLFD+ITN   + EK A +FM QL+TI+ +CH LGVCHRDIKDENI+I+L T KIYLIDFGAGG  H G+Y +FDGTRVYSPPEWIQ+K Y    LE+WSLGILLYDMVCGNLP+DND+ IVN    +RRP++  CQDLI+ CL+ +P  R +++ I+ H WF+ +S  +  +  K       QL+S LH+         L+ A + + E + RRIS E SPF TPQSSG ED D++ND   +SIS     +  S+   + HN
Sbjct:   27 YKCLQVIGEGGFGKVRSAIQLSDQRDVAIKFVSDKKITSWYYCQNQQKYIPMEISLMCRCREVAGVIKIIKYFQIKEHKGWYIIMERFERFVDLFDYITNQNHLKEKLAVDFMAQLMTIVKDCHRLGVCHRDIKDENIVINLDTMKIYLIDFGAGGFFHGGIYKDFDGTRVYSPPEWIQFKEYKVSSLEVWSLGILLYDMVCGNLPFDNDESIVNGIFHYRRPVTPSCQDLIQKCLQYDPCKRINMTEIIHHPWFTQYSHMNTIERVKRNPHLPCQLSSNLHN---------LSPASTTTSEDNSRRISLETSPFTTPQSSGLEDSDFINDNIQDSISSAPHQYLPSNKHNNPHN 372          
BLAST of pim-3 vs. TrEMBL
Match: T1DBL3 (Pim-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.403e-88
Identity = 130/258 (50.39%), Postives = 183/258 (70.93%), Query Frame = 2
Query:  257 FQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            F+ +YQ  E +G+GGFG V KA+RR D+K+V +KFISN K T  +++   + +VPLE+ L+ +C+ V GVI +  ++   +  GWY+VM+R E  +DLFD+I+    +SE+ A+ F+ QL+TILI CH  GV HRDIKDENI++DL T+ IYLIDFG+G    D  Y+++DGTRVYSPPEWI+  RY+   LE WSLGILL+DMVCG++P+ ND  I++  L FR  +S  C+DLI +CL  +P +R +L  I +H W
Sbjct:   32 FRNDYQCYEEVGQGGFGSVYKAVRREDQKKVVVKFISNKKNTEKYYWKSHDLEVPLEVVLLAQCKHVKGVITLLAFYQTTQADGWYLVMNRVERFMDLFDYISCKKYLSEEIAAFFLQQLVTILIGCHQSGVLHRDIKDENILVDLDTHDIYLIDFGSGAFFKDDDYTQYDGTRVYSPPEWIRDHRYNGSKLESWSLGILLFDMVCGDIPFSNDQQILSGHLRFRHVVSGQCKDLIHSCLTHDPCDRVTLFEIARHPW 289          
BLAST of pim-3 vs. TrEMBL
Match: A0A1I8GEI7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020156g1 PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.122e-81
Identity = 126/267 (47.19%), Postives = 178/267 (66.67%), Query Frame = 2
Query:  242 EKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINK-QVPLEIALMCRCRKVDGVIKIFKYFYIKEHKG---WYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E L+    EYQ    +G GGFG+V  AIRRSD  +VAIKFI  +K++   +Y   N  ++PLE  L+ +CR + G+++   +     H+G   W IVM + E  +DLFD I+    + E +A NF+ QLI  L+ CH  GV HRDIKDEN+++DL+ N++ LIDFG+G IL +  Y++FDGTRVYSPPEWI+++RYH  P E+W+LGILL+DMVCG++P++ DD I +    F+R +S  C+ LI  CL+  P  RPSL  +L+H W
Sbjct:   47 EPLDALHREYQIDRQLGSGGFGRVFLAIRRSDGTRVAIKFILKAKMSVHSWYELPNGHRIPLEFLLLHKCRHISGIVRPISF-----HEGPTEWAIVMPKIEKGMDLFDFISRRRFLPEFEARNFIKQLIETLLACHEAGVLHRDIKDENLLVDLADNRLQLIDFGSGAILKEEQYTDFDGTRVYSPPEWIRWRRYHGKPAEVWALGILLFDMVCGDIPFERDDQICHSGPRFKRRLSRQCRQLILACLQTEPSKRPSLREMLRHPW 308          
BLAST of pim-3 vs. TrEMBL
Match: A0A267GNW3 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020156g2 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.284e-80
Identity = 125/267 (46.82%), Postives = 177/267 (66.29%), Query Frame = 2
Query:  242 EKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINK-QVPLEIALMCRCRKVDGVIKIFKYFYIKEHKG---WYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E L+     YQ    +G GGFG+V  AIRRSD  +VAIKFI  +K++   +Y   N  ++PLE  L+ +CR + G+++   +     H+G   W IVM + E  +DLFD I+    + E +A NF+ QLI  L+ CH  GV HRDIKDEN+++DL+ N++ LIDFG+G IL +  Y++FDGTRVYSPPEWI+++RYH  P E+W+LGILL+DMVCG++P++ DD I +    F+R +S  C+ LI  CL+  P  RPSL  +L+H W
Sbjct:   47 EPLDALHRAYQIDRQLGSGGFGRVFLAIRRSDGTRVAIKFILKAKMSVHSWYELPNGHRIPLEFLLLHKCRHISGIVRPISF-----HEGPTEWAIVMPKIEKGMDLFDFISRRRFLPEFEARNFIKQLIETLLACHEAGVLHRDIKDENLLVDLADNRLQLIDFGSGAILKEEQYTDFDGTRVYSPPEWIRWRRYHGKPAEVWALGILLFDMVCGDIPFERDDQICHSGPRFKRRLSRQCRQLILACLQTEPSKRPSLREMLRHPW 308          
BLAST of pim-3 vs. Ensembl Cavefish
Match: pim1 (serine/threonine-protein kinase pim-1-like [Source:NCBI gene;Acc:103031835])

HSP 1 Score: 255.373 bits (651), Expect = 4.605e-81
Identity = 122/261 (46.74%), Postives = 169/261 (64.75%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V   +R +D   VAIK ++  ++T W        +VP+EI L+ +      GVIK+  ++  +    + IVM+R EN  DLFD IT  G + E+ A +F  Q++  + +CHN GV HRDIKDENI+IDL + ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLGILLYDMVCG++P++ D+ IV   + FRR IS  CQ LIK CL   P +RPS  +++ H W
Sbjct:   30 EPFEKVYQVGSVLGSGGFGTVYAGLRIADGAPVAIKHVAKDRVTEWGELPITGARVPMEIVLLKKVSTGFRGVIKMLDWY--ERPDSFIIVMERPENAKDLFDFITEKGALPEELARSFFRQVLEAVRHCHNSGVVHRDIKDENILIDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIKYHRYHGRSATVWSLGILLYDMVCGDIPFEQDEEIVRGQVLFRRRISTECQQLIKWCLALRPADRPSFEDLVNHPW 288          
BLAST of pim-3 vs. Ensembl Cavefish
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043334])

HSP 1 Score: 247.284 bits (630), Expect = 3.943e-78
Identity = 121/261 (46.36%), Postives = 165/261 (63.22%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRC-RKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R SD   VA+K ++  ++T W   + +   VPLEI L+ +      GVIK+  ++  +   GW IVM+R E   DLFD IT  G + E  A  F  Q++  + +C++ GV HRDIKDEN+++DL T  + LIDFG+G  L D +Y++FDGTRVYSPPEWI++ RYH     IWSLG+LLYDMVCG++P++ D+ I+   L FRR IS  CQ LIK CL   P +RP+L  I +H W
Sbjct:   15 EPFEKVYQVGSVLGSGGFGTVYAGSRISDGLPVAVKHVAKDRVTEWGSINGV--MVPLEIVLLKKVGSSFRGVIKLLDWY--ERPDGWLIVMERPELVKDLFDFITEKGALDEATARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAFLKDTVYTDFDGTRVYSPPEWIRFHRYHGRSATIWSLGVLLYDMVCGDIPFEQDEEIIRGRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFEHPW 271          
BLAST of pim-3 vs. Ensembl Cavefish
Match: pim3 (serine/threonine-protein kinase pim-3-like [Source:NCBI gene;Acc:103024220])

HSP 1 Score: 247.284 bits (630), Expect = 7.081e-78
Identity = 121/261 (46.36%), Postives = 168/261 (64.37%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRC-RKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R +D   VAIK ++  ++T W   S     VPLE+ L+ +      GVIK+  ++  +   GW IVM+R E   DLFD+IT  G + E  A  F  Q++  + +C++ GV HRDIKDEN+++DL T  + LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RYH     +WSLG+LLYDMVCG++P+++D+ I+   L FRR IS  CQ LIK CL   P +RP+L  I +H+W
Sbjct:   35 EPFEKIYQVGSVLGSGGFGTVYAGSRLADGLPVAIKHVAKERVTEWG--SVNGSLVPLEVLLLKKVGNSFRGVIKLIDWY--ERPDGWLIVMERPEMVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEHDEEIMKGSLFFRRRISPDCQQLIKWCLCLRPSDRPTLEQIFEHQW 291          
BLAST of pim-3 vs. Ensembl Cavefish
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043334])

HSP 1 Score: 246.899 bits (629), Expect = 9.372e-78
Identity = 121/261 (46.36%), Postives = 165/261 (63.22%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRC-RKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R SD   VA+K ++  ++T W   + +   VPLEI L+ +      GVIK+  ++  +   GW IVM+R E   DLFD IT  G + E  A  F  Q++  + +C++ GV HRDIKDEN+++DL T  + LIDFG+G  L D +Y++FDGTRVYSPPEWI++ RYH     IWSLG+LLYDMVCG++P++ D+ I+   L FRR IS  CQ LIK CL   P +RP+L  I +H W
Sbjct:   35 EPFEKVYQVGSVLGSGGFGTVYAGSRISDGLPVAVKHVAKDRVTEWGSINGV--MVPLEIVLLKKVGSSFRGVIKLLDWY--ERPDGWLIVMERPELVKDLFDFITEKGALDEATARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAFLKDTVYTDFDGTRVYSPPEWIRFHRYHGRSATIWSLGVLLYDMVCGDIPFEQDEEIIRGRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFEHPW 291          
BLAST of pim-3 vs. Ensembl Cavefish
Match: pim2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:58054])

HSP 1 Score: 226.098 bits (575), Expect = 7.230e-70
Identity = 117/274 (42.70%), Postives = 171/274 (62.41%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKIT-SWHFYSKINKQ------VPLEIALMCRCRKVD-------GVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+ +Y+   ++G GGFG V    R SD  QV      NSK + S HF S    Q      VP+EIAL+ +  +         G+I++  +F +   +G+ IV +R +   DLFD IT  G + E  A  F+ Q++  +  CH+ GV HRDIKDENI++D  T  + +IDFG+G +L D +Y++F+GTRVYSPPEWI +++Y A+PL +WSLG+LLYDMVCG++P++ D  IV+   +F + IS  CQ LI+ CL  + ++RP+L  IL+H W
Sbjct:   24 EPFEKQYKCGALLGSGGFGSVFAGQRISDGLQV------NSKTSFSHHFLSLCPSQPDKPSLVPMEIALLLQLGRESPAGPSHRGIIRMLDWFEVP-GQGYLIVFERPQPCKDLFDFITERGVVEEPLAQRFLKQVVEAIQFCHSKGVVHRDIKDENILVDTRTGDLKIIDFGSGALLKDSIYTDFEGTRVYSPPEWIVHQQYEAVPLTVWSLGVLLYDMVCGDIPFEMDRDIVSANPSFTKRISKECQSLIRWCLSFHSKDRPTLEQILQHPW 290          
BLAST of pim-3 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 120.939 bits (302), Expect = 3.297e-30
Identity = 84/262 (32.06%), Postives = 139/262 (53.05%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKE-HKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDG-LYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYD--NDDGIVNCCL--AFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+ L+ IG+G F KV+ A      ++VA+K I  +++ +     K+ ++V        R  KV     I K F + E  K  Y+VM+ + +  ++FD++   G++ EK+A     Q+++ +  CH   + HRD+K EN+++D   N I + DFG       G     F G+  Y+ PE  Q K+Y    +++WSLG++LY +V G+LP+D  N   +    L   +R P  +S  C++L+K  L  +P  R SL  I+K RW
Sbjct:   68 YRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSL-QKLFREV--------RIMKVLNHPNIVKLFEVIEMEKTLYLVME-YSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMN-IKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRW 318          
BLAST of pim-3 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 122.865 bits (307), Expect = 5.458e-30
Identity = 84/262 (32.06%), Postives = 138/262 (52.67%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYF-YIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDG-LYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYD--NDDGIVNCCL--AFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+ L+ IG+G F KV+ A      ++VA+K I  +++       K+ ++V        R  K+     I K F  I+  K  Y+VM+ + +  ++FD++   G++ EK+A     Q+++ +  CH   + HRD+K EN+++D   N I + DFG       G     F G+  Y+ PE  Q K+Y    +++WSLG++LY +V G+LP+D  N   +    L   +R P  +S  C++L+K  L  NP  R SL  I+K RW
Sbjct:   54 YRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSL-QKLFREV--------RIMKILNHPNIVKLFEVIETEKTLYLVME-YASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMN-IKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMKDRW 304          
BLAST of pim-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.123e-29
Identity = 82/262 (31.30%), Postives = 145/262 (55.34%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGG--ILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYD--NDDGIVNCCL--AFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y+ L+ IG+G F KV+ A      ++VAIK I  +++          +++  E+ +M +C     ++K+  Y  I+  K  Y+VM+ + +  ++FD++   G++ EK+A     Q+++ +  CH   + HRD+K EN+++D+  + I + DFG      L + L + F G+  Y+ PE  Q K+Y    +++WSLG++LY +V G+LP+D  N   +    L   +R P  +S  C++L+K  L  NP  R SL  I++ RW
Sbjct:   39 YRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSL-----QKLFREVRIM-KCLNHPNIVKL--YEVIETEKTLYLVME-YASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMH-IKIADFGFSNEFTLVNKLDT-FCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELREKVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGSLEQIMRDRW 289          
BLAST of pim-3 vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 113.235 bits (282), Expect = 6.042e-27
Identity = 78/261 (29.89%), Postives = 126/261 (48.28%), Query Frame = 2
Query:  281 EIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKV---DGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHIT-NMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGL-YSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYD--NDDG----IVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            + +G G F  V+ A      ++VA+K I  SK+          ++V        RC K+     V+++  Y  I      Y++++   +  DL+D+I  + G + E+ A  +  Q++  +  CH L V HRD+K EN++       + L DFG   +   G   +   G+  YS PE +    Y A  ++IWSLG++LY +VCG+ P+   ND      I++C       IS  C+DLI   L+R+P  R SL  +  H W
Sbjct:   20 KTLGRGHFAVVKLARHVFTGEKVAVKVIDKSKLDPMATSHLFQQEV--------RCMKLVQHPNVVRL--YEVIDTQTKLYLILE-LADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGTKLATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMIMDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEGHPW 269          
BLAST of pim-3 vs. Ensembl Sea Lamprey
Match: tssk6 (testis-specific serine kinase 6 [Source:ZFIN;Acc:ZDB-GENE-060216-3])

HSP 1 Score: 101.293 bits (251), Expect = 1.910e-24
Identity = 75/272 (27.57%), Postives = 131/272 (48.16%), Query Frame = 2
Query:  260 QYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGW-YIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFD----GTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDD----------GIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +Y Y+    +GEG + KV+ A     +++VAIK I   K+    F  K    +P E+ L+ R      ++++ +   I+  +G+ +IVM+  ++  DL   +   G + ++ A     +L + +   H + V HRD+K EN+++ +    + L DFG    LH G   E      G+  Y+ PE +    Y    L++WSLG++L+ MV G +P+D+ +          G++    A    +   C+DLI   L   P  RP L+ +  H W
Sbjct:    9 RYGYRLGYTLGEGTYSKVKFATSEQHERRVAIKVIDRRKLPP-DFEEKF---LPREVDLL-RSLHHQNIVEVLQL--IEGCRGYIFIVMELAQS--DLLRLMQERGSLDQRTARGIFTELCSAVHYLHQMHVSHRDVKCENVLL-VDGLHVRLTDFGFARQLHPGCLEELSKTYCGSAAYTSPEVLLGTPYDPRLLDLWSLGVVLFIMVTGYMPFDDSNLMRLVRQQKRGVIFSGAA---SVDTRCEDLILKLLSFKPLARPQLAQVFLHPW 267          
BLAST of pim-3 vs. Ensembl Yeast
Match: PSK2 (PAS-domain containing serine/threonine protein kinase; regulates sugar flux and translation in response to an unknown metabolite by phosphorylating Ugp1p and Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p (translation); PSK2 has a paralog, PSK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005405])

HSP 1 Score: 131.339 bits (329), Expect = 5.534e-33
Identity = 85/264 (32.20%), Postives = 133/264 (50.38%), Query Frame = 2
Query:  266 EYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKIT--SWHFYSKINKQVPLEIALMCRCRK--VDGVIKIFKYFYIKEHKGWYIVMDRFENH---IDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            ++  L+++GEG +GKV   I   +   V IK I   +I   +W    K+   +P EI +M    K   + ++K+  +F   E   +Y +          IDLFD I     + E +A     Q++  + + H+ G+ HRDIKDEN+I+D S   + LIDFG+   +  G +  F GT  Y+ PE +    Y   P +IW+LG+LLY ++    PY N D I+   L F +   +S  C  LIK  L R  + RP++  I + +W
Sbjct:  840 DFTILQVMGEGAYGKVNLCIHNREHYIVVIKMIFKERILVDTWVRDRKLG-TIPSEIQIMATLNKNSQENILKLLDFF---EDDDYYYIETPVHGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHDQGIVHRDIKDENVIVD-SHGFVKLIDFGSAAYIKSGPFDVFVGTMDYAAPEVLGGSSYKGKPQDIWALGVLLYTIIYKENPYYNIDEILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEIYEDKW 1098          
BLAST of pim-3 vs. Ensembl Yeast
Match: PSK1 (PAS domain-containing serine/threonine protein kinase; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status; PSK1 has a paralog, PSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000015])

HSP 1 Score: 127.872 bits (320), Expect = 1.054e-31
Identity = 84/264 (31.82%), Postives = 136/264 (51.52%), Query Frame = 2
Query:  266 EYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKI--TSWHFYSKINKQVPLEIALMCRCRKV--DGVIKIFKYFYIKEHKGWYIVMDRFENH---IDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            ++ SL+ +GEG +GKV   I + ++  V IK I   +I   +W    K+   +P EI +M    K   + ++++  +F   E   +Y +          IDLFD I     ++E +A     Q++  + + H+ G+ HRDIKDEN+I+D S   + +IDFG+   +  G +  F GT  Y+ PE +    Y   P +IW++GILLY +V    P+ N D I+   L F     +S  C +LIK+ L R    RP++ +I   +W
Sbjct: 1095 DFVSLQKMGEGAYGKVNLCIHKKNRYIVVIKMIFKERILVDTWVRDRKLG-TIPSEIQIMATLNKKPHENILRLLDFF---EDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVD-SKGFVKIIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGNPYEGQPQDIWAIGILLYTVVFKENPFYNIDEILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDINNDKW 1353          
BLAST of pim-3 vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 124.79 bits (312), Expect = 4.658e-31
Identity = 80/261 (30.65%), Postives = 135/261 (51.72%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFD-GTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDD------GIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            YQ ++ +GEG FGKV+ A   +  ++VA+K I+   +       +I +++        R  +   +IK+  Y  IK      +V++   N  +LFD+I    ++SE++A  F  Q+I+ +  CH   + HRD+K EN+++D   N + + DFG   I+ DG + +   G+  Y+ PE I  K Y    +++WS G++LY M+C  LP+D++        I N      + +S     LIK  L  NP NR S+  I++  W
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISY-----LRLLRHPHIIKL--YDVIKSKDEIIMVIEYAGN--ELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLN-VKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDW 305          
BLAST of pim-3 vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 110.923 bits (276), Expect = 2.904e-26
Identity = 78/266 (29.32%), Postives = 127/266 (47.74%), Query Frame = 2
Query:  281 EIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFY------SKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKE-HKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFD-GTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCL------AFRRP----ISHLCQDLIKNCLERNPENRPSLSNILKH 1024
            E +G G  GKV+ A   S  ++ A+K IS +   + +        S     +P  I       K+     + + + + E +   Y+V++  E   +LF+ +   G + E +A  F  Q+I  +  CH LG+ HRD+K EN+++D   N I + DFG   +  +G   E   G+  Y+ PE +    Y     ++WS G++L+ ++ G LP+D +DG +   L       F  P    IS   QDLI+  L  +PE R    +ILKH
Sbjct:   23 ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG-ELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286          
BLAST of pim-3 vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 110.923 bits (276), Expect = 4.127e-26
Identity = 59/192 (30.73%), Postives = 107/192 (55.73%), Query Frame = 2
Query:  473 IFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGI-LHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCL-----AFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKH 1024
            +   F + E+K    ++  + +  +LFD++ + G++ E++A ++  Q++  +  CH+  +CHRD+K EN+++D    +I + DFG   + L + L     G+  Y+ PE +  + YH  P ++WS GI+L+ ++ G+LP+ NDD I    L      ++ P  +S   +DLI   L  +PE R +   ILKH
Sbjct:  176 VMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF-NDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKH 366          
BLAST of pim-3 vs. Ensembl Nematostella
Match: EDO46861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH5])

HSP 1 Score: 188.348 bits (477), Expect = 2.947e-56
Identity = 93/241 (38.59%), Postives = 149/241 (61.83%), Query Frame = 2
Query:  311 VRKAIRRSDKKQVAIKFISNSKITSWHFYSKINK-QVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            V    R  D K VAIK I  + +   +F+ ++    VP+E+ L  R      V++++ YF  + ++ + +V++R  ++ DLFD+IT    +SE++A +   Q++  +  C   GV HRDIKDEN+++D  T ++ L DFG+G +L + LY++++GTR Y PPEW ++ RYHA P  +WSLGILL++M+ G++P+ N   IV   L F   +S   Q L++  L ++P  RP+L NILKH W
Sbjct:    2 VYAGTRVRDGKPVAIKVIPKNNV---YFFEEVGGISVPMEVYLH-RVLDHPNVVRLYDYF--EYNQAYVLVLERPTHYRDLFDYITEKKLLSEREAKDIFKQVVHAVAYCEGKGVFHRDIKDENLLLDTKTGQVKLFDFGSGTVLENTLYTDYEGTRAYCPPEWFRFHRYHARPCTVWSLGILLFNMLSGDVPFANQIEIVRGELNFAENVSKEAQSLVRWLLAKHPSYRPTLENILKHPW 236          
BLAST of pim-3 vs. Ensembl Nematostella
Match: EDO37143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS0])

HSP 1 Score: 128.642 bits (322), Expect = 8.476e-34
Identity = 86/270 (31.85%), Postives = 136/270 (50.37%), Query Frame = 2
Query:  248 LEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGI-LHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGI-----VNCCLAFRRP---ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            L D  Y++     +GEG + KV+ A        VA+K I   +  S      INK +P E+ ++ R R    +I++   F ++E    Y++M+      DL ++I   G + E+ A    +QL+  +  CH  GV HRD+K EN+++D+  N + L DFG   +     L   F G+  Y+  E +Q   Y     +IWSLGI+LY MV G +P+D+ +       +   + FR+P   +S  C+DLI+  L  N E R ++  I  HRW
Sbjct:   11 LRDRGYQFVDNGRLGEGTYAKVKCAYSTQLANHVAVKIIDKKRAPS----DFINKFLPREMVVIKRLRH-KHIIQVLDLFEVREK--VYVIME-LATRGDLLEYIRYRGCVRERKAKKVFSQLLQAVKYCHQQGVIHRDLKCENVLLDIGDN-VKLTDFGFSKLNPRKELCKTFCGSAAYAAIEILQGTEYDGEKADIWSLGIILYTMVTGRMPFDDANMTTLLRQIKRGVEFRKPKQMVSEECRDLIRCMLTHNYEYRITIPEIEAHRW 271          
BLAST of pim-3 vs. Ensembl Nematostella
Match: EDO33625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN4])

HSP 1 Score: 123.635 bits (309), Expect = 2.409e-31
Identity = 84/270 (31.11%), Postives = 138/270 (51.11%), Query Frame = 2
Query:  263 YEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILH-------DGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIV-------NCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y Y   + +G+G +  V+ A  R  KKQVA+K ++  K    +    + K +P EI +M        V+ + +   I+     YI++D  +N  DL ++I + G I E +A  F +QL+  +   HN GV HRD+K ENI+++   N+I + DFG     H         L   F G+  Y+PPE ++   Y     +IWSLG++LY MV  +LP+D+ +  V       +   + R+ IS   +DL++  L  + + R  L++I +H W
Sbjct:   59 YGYALGDTLGKGSYAVVKAAYSRKLKKQVAVKIVTKKKAPDDY----LTKFLPREIQVMKHLNH-SNVVSLHEA--IETSSRIYIILDLADNG-DLLEYIRSNGAIPENEARLFYHQLVDAVEYLHNKGVVHRDLKCENILLN-RDNRILISDFGFARTQHVMADTGKRRLSQTFCGSYAYAPPEILRGIAYDGTLADIWSLGVVLYTMVSASLPFDDTNLKVLLEQVSRDVVFSRRKKISDEVKDLVRRMLVADVKTRIDLASIRRHPW 319          
BLAST of pim-3 vs. Ensembl Nematostella
Match: EDO46035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR22])

HSP 1 Score: 120.553 bits (301), Expect = 1.816e-30
Identity = 79/267 (29.59%), Postives = 135/267 (50.56%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILH-DGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDND----------DGIVNCCLAFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y   + IG+G F  V+ A     K +VA+K I  S++   +  +K+ ++V +   L            I K   + E +    ++  + +  ++FD++   G++ EK+A N  NQ+++ +  CH + + HRD+K EN+++D   N I + DFG   I   D     + G+  Y+ PE  + K Y    ++IWSLG++LY +VCG LP+D            DG       FR P  +S  C+ LI++ L R+P  R ++  I +H+W
Sbjct:   20 YNIEKTIGKGNFAVVKLATHCITKSKVAVKIIDKSQLDDDNL-TKVKREVKVMKKL--------AHPHIIKLHEVMETERMLYLVTEYASKGEIFDYLVAHGRMQEKEAKNTFNQIVSAIEYCHKMNIVHRDLKAENLLLDEDMN-IKIADFGFSNIFQADKKLKTWCGSPPYAAPELFEGKEYLGPEVDIWSLGVVLYVLVCGALPFDGSTLQSLRSRVLDG------RFRIPFFMSTECEHLIRHMLVRDPVKRFTIPQIRQHKW 270          
BLAST of pim-3 vs. Ensembl Nematostella
Match: EDO44439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVS7])

HSP 1 Score: 114.775 bits (286), Expect = 2.226e-28
Identity = 75/263 (28.52%), Postives = 135/263 (51.33%), Query Frame = 2
Query:  269 YQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFD---GTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCL----AFRRP--ISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Y   E IG GGF KV+ A+ R+  ++VAIK ++   +   H   ++ +++    A+   C +   + ++  Y  I+  +  Y+V++ +    +LFD+I    ++ E +A  F  Q+I+ +   H  G  HRD+K EN+++D   N I LIDFG       G+  + +   G+  Y+ PE I    Y    +++WS+G+LLY +VCG LP+D+D+      L     +  P  +S     ++   L+ +P  R  + +++ H W
Sbjct:   14 YDVRETIGSGGFAKVKLAVHRTSGEKVAIKMMNKEALG--HDLPRVQRELE---AMKDLCHQ--HICQL--YHVIETDENIYMVLE-YAQGGELFDYIVAKDRLKEDEARGFFRQIISAVAYIHEKGYAHRDLKPENLLLDEEQN-IKLIDFGLVAKPEGGMTEQLETCCGSPAYAAPELISGLPYFGNEVDLWSMGVLLYALVCGFLPFDDDNTYKLYRLIQKGEYEIPSWLSQGTVAILGQLLQVSPRKRAKIQDLVNHDW 265          
BLAST of pim-3 vs. Ensembl Medaka
Match: pim1 (serine/threonine-protein kinase pim-1 [Source:NCBI gene;Acc:101157054])

HSP 1 Score: 247.669 bits (631), Expect = 4.821e-78
Identity = 123/267 (46.07%), Postives = 171/267 (64.04%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRC-RKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Q+ EK E F+  YQ   ++G GGFG V    R SD   VA+K ++  +++ W        +VP+EI L+ +      GVIK+  +F  +    + IVM+R EN  DLFD IT  G + E+ A +F  Q++  + +CH+ GV HRDIKDENI+IDL T ++ LIDFG+G +L D +Y++FDGTRVYSPPEWI+Y RY      +WSLGILLYDMVCG++P+++D+ I    + FRR IS  CQ LIK CL   P +RPS  +++ H W
Sbjct:   23 QVKEK-EPFEKLYQVGAVLGSGGFGTVYAGTRISDGVPVAVKHVARDRVSEWGELPS-GARVPMEIVLLKKVGTGFRGVIKMLDWF--ERPDSFIIVMERPENVKDLFDFITERGALPEELARSFFRQVLEAVRHCHSCGVVHRDIKDENILIDLRTGEMKLIDFGSGALLKDTIYTDFDGTRVYSPPEWIKYHRYQGRSATVWSLGILLYDMVCGDIPFEHDEEITRGQVLFRRRISTECQHLIKWCLSLRPTDRPSFEDVINHSW 285          
BLAST of pim-3 vs. Ensembl Medaka
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101171374])

HSP 1 Score: 244.202 bits (622), Expect = 1.099e-76
Identity = 118/261 (45.21%), Postives = 166/261 (63.60%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRK-VDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ   ++G GGFG V    R SD   VA+K ++  ++T W   + +   VPLEI L+ +      GVIK+  Y+  +   GW IVM+R +   DLFD IT  G + E  A  F  Q++  + +C++ GV HRDIKDEN+++DL T ++ LIDFG+G IL D +Y++FDGTRVYSPPEWI++ RYH     +WSLG+LLYDMVCG++P++ D+ I+   + FRR +S  CQ +IK CL   P +RP+L  I  H W
Sbjct:   34 EPFERVYQVGSVLGSGGFGTVYAGNRISDGAPVAVKHVAKERVTEWGSINGV--MVPLEILLLKKVSSSFRGVIKLLDYY--ERPDGWLIVMERPDLVKDLFDFITEKGALDEGTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGELKLIDFGSGAILKDTVYTDFDGTRVYSPPEWIRFHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGKVYFRRRVSPECQQIIKWCLALRPSDRPTLDQICDHPW 290          
BLAST of pim-3 vs. Ensembl Medaka
Match: ENSORLT00000010626.2 (pep primary_assembly:ASM223467v1:12:12000679:12006348:1 gene:ENSORLG00000008461.2 transcript:ENSORLT00000010626.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 7.357e-62
Identity = 108/259 (41.70%), Postives = 160/259 (61.78%), Query Frame = 2
Query:  263 YEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFIS--NSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILH-DGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            ++Y  L  +G+GGFGKV    RRSD+  VA+KF+    ++       SK  + V LE  ++ +     G+I++  ++  K    W IV +  EN  DLF +IT   ++ E  A +F+ Q+I  L++CH+ GV H D+KDEN+++D ST+K+ LIDFG+   L  D +Y  F GT VY+PPE +    Y A+P E+WSLGILLYDMV G++P+ ND+ I+   L F++ +S  C  L++ CL R PE RP+L +IL H W
Sbjct:   46 FKYVRLHCLGKGGFGKVFLGKRRSDRISVALKFVPLLRTRCCEVDGTSKPLEVVALE--MVTKDPPFPGIIRMLDFY--KTRGAWVIVTETPENTQDLFHYITTCKRLCEDTARDFLGQVIQALLHCHSRGVVHMDVKDENLLLDPSTHKLLLIDFGSAVFLEPDKVYDTFHGTAVYAPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFQNDEEILLGELRFKKDLSEDCVALMQWCLSRAPEERPTLKDILAHPW 300          
BLAST of pim-3 vs. Ensembl Medaka
Match: ENSORLT00000032540.1 (serine/threonine-protein kinase pim-2-like [Source:NCBI gene;Acc:101156739])

HSP 1 Score: 201.445 bits (511), Expect = 4.457e-60
Identity = 106/251 (42.23%), Postives = 156/251 (62.15%), Query Frame = 2
Query:  287 IGEGGFGKVRKAIRRSDKKQVAIKFIS--NSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILH-DGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +G+GGFGKV    RRSD+  VA+KF+    ++       SK  + V LE  ++ +     G+I++  ++  K    W IV +  EN  DLF +IT   ++ E  A +F+ Q+I  L++CH+ GV H D+KDEN+++D ST+K+ LIDFG+   L  D +Y  F GT VY+PPE +    Y A+P E+WSLGILLYDMV G++P+ ND+ I+   L F++ +S  C  L++ CL R PE RP+L +IL H W
Sbjct:   28 LGKGGFGKVFLGKRRSDRISVALKFVPLLRTRCCEVDGTSKPLEVVALE--MVTKDPPFPGIIRMLDFY--KTRGAWVIVTETPENTQDLFHYITTCKRLCEDTARDFLGQVIQALLHCHSRGVVHMDVKDENLLLDPSTHKLLLIDFGSAVFLEPDKVYDTFHGTAVYAPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFQNDEEILLGELRFKKDLSEDCVALMQWCLSRAPEERPTLKDILAHPW 274          
BLAST of pim-3 vs. Ensembl Medaka
Match: ENSORLT00000041570.1 (pep primary_assembly:ASM223467v1:10:18938984:18940525:-1 gene:ENSORLG00000023590.1 transcript:ENSORLT00000041570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 6.508e-56
Identity = 105/251 (41.83%), Postives = 151/251 (60.16%), Query Frame = 2
Query:  287 IGEGGFGKVRKAIRRSDKKQVAIKFI--SNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILH-DGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            +G+GGFGKV    RRSD   VA+K I  S ++       SK  + V LE  ++ +     G+I++  ++  K    W IV ++ EN  DL+++IT   ++ E  A  F+ Q+I  L++CH+ GV H D+KDEN+++DL+T ++ LIDFG+   L  D +Y  F GT  Y PPE +    Y A+P E+WSLGILLYDMV G++P+ ND  ++   L F + +S  C  LIK CL R PE RP L +IL H W
Sbjct:   47 LGKGGFGKVFLGKRRSDGISVALKIIPLSRTRCCEVDGTSKPFEAVALE--MVSKDPPFPGIIRMLDFY--KTPYNWVIVTEKPENTQDLYEYITISKRLREDTAREFLGQVIQALLHCHSRGVVHMDVKDENLLVDLTTLELKLIDFGSAEFLEPDKVYDMFHGTAAYGPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFGNDRELLLGELRFEKDLSEDCVALIKWCLSRTPEERPMLKDILAHPW 293          
BLAST of pim-3 vs. Planmine SMEST
Match: SMESG000014593.1 (SMESG000014593.1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 362/367 (98.64%), Postives = 363/367 (98.91%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRWXXXXXXXXXXXXXXXTIQLNSFLHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVNDESISKQQFSFENSDDFISCHNSKSKHLF 1333
            QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHA+PLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISH CQDLIKNCLERNPENRPSLSNILKHRWFSSFSKSSYSDNSKSTIQLNS LHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVNDESISKQ F FENSDDFISCHNSKSKHLF
Sbjct:   12 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAVPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHFCQDLIKNCLERNPENRPSLSNILKHRWFSSFSKSSYSDNSKSTIQLNSSLHSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVNDESISKQPFFFENSDDFISCHNSKSKHLF 378          
BLAST of pim-3 vs. Planmine SMEST
Match: SMESG000017137.1 (SMESG000017137.1)

HSP 1 Score: 268.085 bits (684), Expect = 5.062e-85
Identity = 127/260 (48.85%), Postives = 174/260 (66.92%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ  E IG+GGFG V K  R SD+ +V IKFISN KIT  + +   N  +PLE+AL+ +CR V GVI +  ++     KGWY++M+R    +DLFD+I+    +SE+ A+ F  Q+I IL  CH   V HRDIKDENI++D +T+ +YLIDFG+G  L    Y  FDGTRVYSPPEWI+   Y+   LE+WSLG+LL+DMVCG++P++ DD I+N  L +R  +S  C+DLI+ CL+ +P  R +L+ I  H W
Sbjct:   22 EFFRSHYQCHEEIGQGGFGTVFKGTRLSDRLEVIIKFISNKKITDTYKWKAKNLAIPLEVALLAKCRPVKGVIDMLAFYKSDGKKGWYLIMNRIAKFVDLFDYISRAKYLSEEKAAFFFRQIIEILKQCHQQKVLHRDIKDENILVDENTDFVYLIDFGSGAFLKTDDYRNFDGTRVYSPPEWIKNHCYNGFKLEVWSLGVLLFDMVCGDIPFNTDDQILNGKLKYRHCVSADCRDLIEKCLKHDPSYRINLNEISNHPW 281          
BLAST of pim-3 vs. Planmine SMEST
Match: SMESG000017137.1 (SMESG000017137.1)

HSP 1 Score: 268.085 bits (684), Expect = 5.689e-85
Identity = 127/260 (48.85%), Postives = 174/260 (66.92%), Query Frame = 2
Query:  251 EDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            E F+  YQ  E IG+GGFG V K  R SD+ +V IKFISN KIT  + +   N  +PLE+AL+ +CR V GVI +  ++     KGWY++M+R    +DLFD+I+    +SE+ A+ F  Q+I IL  CH   V HRDIKDENI++D +T+ +YLIDFG+G  L    Y  FDGTRVYSPPEWI+   Y+   LE+WSLG+LL+DMVCG++P++ DD I+N  L +R  +S  C+DLI+ CL+ +P  R +L+ I  H W
Sbjct:   26 EFFRSHYQCHEEIGQGGFGTVFKGTRLSDRLEVIIKFISNKKITDTYKWKAKNLAIPLEVALLAKCRPVKGVIDMLAFYKSDGKKGWYLIMNRIAKFVDLFDYISRAKYLSEEKAAFFFRQIIEILKQCHQQKVLHRDIKDENILVDENTDFVYLIDFGSGAFLKTDDYRNFDGTRVYSPPEWIKNHCYNGFKLEVWSLGVLLFDMVCGDIPFNTDDQILNGKLKYRHCVSADCRDLIEKCLKHDPSYRINLNEISNHPW 285          
BLAST of pim-3 vs. Planmine SMEST
Match: SMESG000027798.1 (SMESG000027798.1)

HSP 1 Score: 233.417 bits (594), Expect = 3.544e-73
Identity = 118/256 (46.09%), Postives = 167/256 (65.23%), Query Frame = 2
Query:  260 QYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHR 1027
            Q +Y     IGEGGFGKV K+ + S+ K VA+KF++  KI+ +  + +  +++P+E  L+  C+ + GVIK+ +   ++E + W IVM+R  N IDLFD+I    QISE+ A   + QLI  LI CH  GV HRDIKDENI+ID+ T +I LIDFG+G   HDG Y +F+GT +YSPPEWI+ K Y    LE WS+G LLY+M+ G+ P+ N++ I+   ++     S  C+DLI +CL R+ ENR  L  IL H+
Sbjct:   20 QNKYAIYGKIGEGGFGKVFKSTKISNGKSVALKFVAKDKISEYCLHEETQQKIPMEAVLLAECQGIPGVIKLLEIVELEEFQVWCIVMERNPNFIDLFDYINRCSQISEETAVFILTQLIHTLIGCHKAGVAHRDIKDENILIDVDTKEIKLIDFGSGHYYHDGEYFDFNGTSIYSPPEWIKDKHYFVKELESWSIGALLYNMITGDGPFKNENEILLAPISIDSA-SAECRDLILSCLCRDRENRMDLDKILCHK 274          
BLAST of pim-3 vs. Planmine SMEST
Match: SMESG000072329.1 (SMESG000072329.1)

HSP 1 Score: 237.269 bits (604), Expect = 7.758e-73
Identity = 116/266 (43.61%), Postives = 171/266 (64.29%), Query Frame = 2
Query:  233 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHLCQDLIKNCLERNPENRPSLSNILKHRW 1030
            Q   KLE  +Y Y   + +G+G +G V    R+ D   VAIK +  + I +W+F   +   +P+EI L+     +DGVI + +Y+   E   WYIVM+RF   IDLF++I + G ++E  AS    +L  I+I CH  G+ HRDIK+ENI+ID  T KI+LIDFG+GG+++D  +  ++GT  Y+PPEWI+Y  Y    LE WSLGI+LY MVCG +P+++++ I++  + F R IS+ C++LI  C+ER+P+NR   S ILKH W
Sbjct:   16 QGKTKLE-LKYNYD--KELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPW 278          
The following BLAST results are available for this feature:
BLAST of pim-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIM14.851e-7343.68Pim-1 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM25.964e-7344.87Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM34.924e-7244.74Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM24.458e-4851.75Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
NUAK28.782e-3233.58NUAK family kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of pim-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prk-22.496e-6141.33Serine/threonine-protein kinase prk-2 [Source:Uni... [more]
prk-22.496e-6141.33Serine/threonine-protein kinase prk-2 [Source:Uni... [more]
prk-11.017e-5136.50Pim (Mammalian oncogene) Related Kinase [Source:U... [more]
prk-16.483e-5136.50Pim (Mammalian oncogene) Related Kinase [Source:U... [more]
prk-11.000e-5036.50Pim (Mammalian oncogene) Related Kinase [Source:U... [more]
back to top
BLAST of pim-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sik23.714e-3132.42gene:FBgn0025625 transcript:FBtr0070340[more]
KP78a3.717e-3130.04gene:FBgn0026064 transcript:FBtr0301426[more]
Sik31.477e-3031.80gene:FBgn0262103 transcript:FBtr0304024[more]
Sik35.553e-3031.80gene:FBgn0262103 transcript:FBtr0344259[more]
Sik35.558e-3031.80gene:FBgn0262103 transcript:FBtr0344258[more]
back to top
BLAST of pim-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim18.294e-7947.19Pim-1 proto-oncogene, serine/threonine kinase [Sou... [more]
pim35.687e-7546.18Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pim21.721e-7344.57Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
pimr266.499e-5235.16Pim proto-oncogene, serine/threonine kinase, relat... [more]
pimr277.729e-5235.16Pim proto-oncogene, serine/threonine kinase, relat... [more]
back to top
BLAST of pim-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIM36.037e-7645.45Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
ncbp11.593e-7545.72nuclear cap binding protein subunit 1 [Source:Xenb... [more]
ncbp13.603e-7541.61nuclear cap binding protein subunit 1 [Source:Xenb... [more]
PASK2.471e-3335.23PAS domain containing serine/threonine kinase [Sou... [more]
PASK6.961e-3335.23PAS domain containing serine/threonine kinase [Sou... [more]
back to top
BLAST of pim-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pim26.624e-7545.21proviral integration site 2 [Source:MGI Symbol;Acc... [more]
Pim27.715e-7545.21proviral integration site 2 [Source:MGI Symbol;Acc... [more]
Pim12.901e-7444.83proviral integration site 1 [Source:MGI Symbol;Acc... [more]
Pim31.652e-7244.74proviral integration site 3 [Source:MGI Symbol;Acc... [more]
Pim17.253e-3940.11proviral integration site 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of pim-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PU85|PIM3_COTJA5.180e-7545.59Serine/threonine-protein kinase pim-3 OS=Coturnix ... [more]
sp|Q62070|PIM2_MOUSE4.634e-7445.21Serine/threonine-protein kinase pim-2 OS=Mus muscu... [more]
sp|P06803|PIM1_MOUSE2.029e-7344.83Serine/threonine-protein kinase pim-1 OS=Mus muscu... [more]
sp|Q9YHZ5|PIM2_DANRE9.225e-7344.57Serine/threonine-protein kinase pim-2 OS=Danio rer... [more]
sp|P26794|PIM1_RAT1.162e-7244.06Serine/threonine-protein kinase pim-1 OS=Rattus no... [more]
back to top
BLAST of pim-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIJ10.000e+098.64Pim-3 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
T1D1283.338e-12355.77Pim-3 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBL32.403e-8850.39Pim-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A1I8GEI72.122e-8147.19Protein kinase domain-containing protein OS=Macros... [more]
A0A267GNW31.284e-8046.82Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of pim-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim14.605e-8146.74serine/threonine-protein kinase pim-1-like [Source... [more]
PIM33.943e-7846.36Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pim37.081e-7846.36serine/threonine-protein kinase pim-3-like [Source... [more]
PIM39.372e-7846.36Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pim27.230e-7042.70Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of pim-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARK33.297e-3032.06microtubule affinity regulating kinase 3 [Source:H... [more]
MARK35.458e-3032.06microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000006410.11.123e-2931.30pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
snrka6.042e-2729.89SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
tssk61.910e-2427.57testis-specific serine kinase 6 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of pim-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PSK25.534e-3332.20PAS-domain containing serine/threonine protein kin... [more]
PSK11.054e-3131.82PAS domain-containing serine/threonine protein kin... [more]
SNF14.658e-3130.65AMP-activated S/T protein kinase; forms a complex ... [more]
GIN42.904e-2629.32Protein kinase involved in bud growth and assembly... [more]
HSL14.127e-2630.73Nim1p-related protein kinase; septin-binding kinas... [more]
back to top
BLAST of pim-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468612.947e-5638.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371438.476e-3431.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336252.409e-3131.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460351.816e-3029.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444392.226e-2828.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of pim-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim14.821e-7846.07serine/threonine-protein kinase pim-1 [Source:NCBI... [more]
pim31.099e-7645.21Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
ENSORLT00000010626.27.357e-6241.70pep primary_assembly:ASM223467v1:12:12000679:12006... [more]
ENSORLT00000032540.14.457e-6042.23serine/threonine-protein kinase pim-2-like [Source... [more]
ENSORLT00000041570.16.508e-5641.83pep primary_assembly:ASM223467v1:10:18938984:18940... [more]
back to top
BLAST of pim-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014593.10.000e+098.64SMESG000014593.1[more]
SMESG000017137.15.062e-8548.85SMESG000017137.1[more]
SMESG000017137.15.689e-8548.85SMESG000017137.1[more]
SMESG000027798.13.544e-7346.09SMESG000027798.1[more]
SMESG000072329.17.758e-7343.61SMESG000072329.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033864
GenBankAFJ24845.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033864 ID=SMED30033864|Name=pim-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1467bp
AATGAAAACTGCTTACTAAAAATAGTCGCATTTAGGAACAATATGGTTGG
TTTGCAAAGAAAATTGGCATGAATTATCAATACATATAGTTGATTTGTGT
TGATTAAATCAGAAAATTTGTCTGATTTCTATTACAATTTTAATTGTCTA
AATTTTCTTTTTATTTCAAATTAATTTGCTTATACTAACTCAAGAAATTA
TGGATGTTTTAGATGTTGATCTAGACGATGTACAAATGAGTGAAAAATTG
GAAGATTTCCAATATGAATATCAATCTTTGGAAATTATTGGCGAAGGAGG
ATTTGGAAAAGTTAGAAAAGCTATTCGTCGATCCGACAAAAAGCAAGTGG
CAATAAAATTTATTTCCAATTCCAAAATTACATCGTGGCATTTTTATTCG
AAAATCAATAAACAAGTTCCATTGGAAATAGCATTAATGTGTCGTTGTCG
AAAAGTAGACGGTGTGATAAAAATCTTCAAATATTTCTATATTAAAGAAC
ACAAAGGCTGGTATATAGTGATGGATAGATTCGAAAATCACATAGATTTA
TTCGATCACATTACCAATATGGGACAAATCAGTGAGAAAGACGCATCAAA
TTTTATGAATCAATTGATTACAATTCTTATTAATTGTCACAATCTTGGAG
TTTGTCATCGTGATATCAAAGATGAAAATATCATTATTGATTTATCTACA
AACAAAATATATCTTATCGATTTTGGTGCCGGTGGTATTTTACATGATGG
TCTATATTCGGAATTCGATGGTACCAGAGTATATAGTCCACCAGAATGGA
TACAATACAAACGATACCATGCAATACCCCTCGAAATTTGGTCTTTGGGA
ATTCTTCTCTACGATATGGTCTGTGGAAATCTACCATATGACAATGATGA
TGGCATTGTTAATTGTTGCCTTGCATTTCGTCGGCCGATCAGTCACCTTT
GTCAAGATCTTATTAAAAATTGTTTGGAAAGAAATCCAGAAAACCGGCCG
AGTTTATCGAATATATTGAAGCATCGTTGGTTTAGTAGCTTTTCGAAATC
TAGCTATTCCGACAATTCCAAATCCACAATTCAGTTGAACAGTTTTCTAC
ATTCCAAAACCAATATCAATCAAACTAAAACCTTAACCCAAGCATTTTCT
TATTCACCAGAATCCTCTCCCAGAAGAATAAGCGGCGAACTGTCTCCTTT
TGTCACTCCACAATCTTCGGGATTTGAAGACGTGGATTACGTAAACGATG
AAAGCATTTCCAAACAACAATTTTCCTTTGAAAATTCAGATGATTTTATT
TCTTGTCACAATTCAAAGTCTAAACACCTCTTCCAAAAAGACAAACATAA
CAATCAGAAAAACAATGATTCCCTTATTAACAATCCTTATTATTTAAACA
ACTATTTGTGATATTTATATATTTTTGAAAATATTTTGTACATAATATAT
TATTTCAGATATCAAAA
back to top

protein sequence of SMED30033864-orf-1

>SMED30033864-orf-1 ID=SMED30033864-orf-1|Name=SMED30033864-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=404bp
MDVLDVDLDDVQMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQV
AIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKE
HKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLG
VCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEW
IQYKRYHAIPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHL
CQDLIKNCLERNPENRPSLSNILKHRWFSSFSKSSYSDNSKSTIQLNSFL
HSKTNINQTKTLTQAFSYSPESSPRRISGELSPFVTPQSSGFEDVDYVND
ESISKQQFSFENSDDFISCHNSKSKHLFQKDKHNNQKNNDSLINNPYYLN
NYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007634optokinetic behavior
GO:0048593camera-type eye morphogenesis
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0043066negative regulation of apoptotic process
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR017348PIM1/2/3
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 24..278
e-value: 3.9E-56
score: 202.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 24..278
e-value: 3.2E-56
score: 190.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 24..278
score: 39.071
IPR017348Serine/threonine-protein kinase pim-1/2/3PIRSFPIRSF037993STPK_Pim-1coord: 4..303
e-value: 8.7E-78
score: 259.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 114..299
e-value: 1.2E-47
score: 163.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 8..112
e-value: 1.8E-21
score: 78.3
NoneNo IPR availablePANTHERPTHR22984:SF22SERINE/THREONINE-PROTEIN KINASE PRK-2coord: 12..310
NoneNo IPR availablePANTHERPTHR22984SERINE/THREONINE PROTEIN KINASEcoord: 12..310
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 151..163
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 30..53
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 23..282