DAO domain-containing protein

Overview
NameDAO domain-containing protein
Smed IDSMED30033861
Length (bp)1406
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DAO domain-containing protein (SMED30033861) t-SNE clustered cells

Violin plots show distribution of expression levels for DAO domain-containing protein (SMED30033861) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DAO domain-containing protein (SMED30033861) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DAO domain-containing protein (SMED30033861) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033861

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30033861h1SMcG0007342 Contig11492uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033861h1SMcG0007342 Contig11492newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033861h1SMcG0007341 Contig11492uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033861h1SMcG0007341 Contig11492newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30033861h1SMcG0007342 PL06004A2A12smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DAO domain-containing protein vs. Ensembl Celegans
Match: pdpr-1 (Pyruvate Dehydrogenase Phosphatase Regulatory subunit [Source:UniProtKB/TrEMBL;Acc:Q9U300])

HSP 1 Score: 50.0618 bits (118), Expect = 2.936e-6
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 1
Query:   61 IFNMKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIAC-GASGKAGGFLAK-TWCKSNGCNELALLSYDLHMELA 282
            + N  +V+CGGGI G S AY LAK+     ++E++ I C GA+G + G ++   + +      +A  S DL+  LA
Sbjct:   19 VANADVVVCGGGISGTSIAYHLAKRGKKVALVEKDSIGCSGATGLSAGLVSSPIFWQDTSLQAIAQASLDLYSHLA 94          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q10058|YAM3_SCHPO (Putative oxidoreductase C1F5.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.03c PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.055e-50
Identity = 131/387 (33.85%), Postives = 195/387 (50.39%), Query Frame = 1
Query:   73 KIVICGGGIIGLSCAYFLA------KKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNFTEVD---YRNVDTYSAFIDK-IRSPITRKSSEYLKWIDGPAT--NRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNT----------TQMITDTVVGIGY--DDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLS-SDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLI-----TTGKCDLLDLE 1143
             IVI GGGI G+SC YFLA      +   +  + E   IA  ASGKA GFL+  W      + LA LSY+LH EL+  +  V+   YR +DT+S   D+  + P   K  E ++WI  P+   N + L     + QVHP K C    EE  ++ N T             +   ++G  Y  D+   +  +  L +  ++EA  +++A GPW+   +         +ISG R HS+ + +P  L   A    + +K D  I++PE Y R D  +YVCG  DD  LPE + D  +++ KC+ +++ A      +  S +   QAC+LP+S + G P+IGKI +    Y+A  H CWGI    GTG  +++LI     T+   DLLD E
Sbjct:    6 NIVIVGGGITGVSCLYFLAHHPSFNRDRDTITLFESAGIASAASGKASGFLSLEW-HGPSTSSLAALSYNLHKELSDQYDGVNKWGYRALDTWSIKADENCQQP--DKLPEGIEWI-APSIVENVTRLGNKKNSGQVHPYKFCHAIYEEASKVANVTLVKGHVLSVDENEVEYRLIGDDYAPDEEEEITSAEELHTIHSMEATHIIVAAGPWTPQLIPNL------RISGARIHSITIDLPIKLNGNAVFSEITYK-DGTIAAPEFYARED-ELYVCGEFDDEPLPELSSDTKVDQDKCALIKQCANHFHQIIRDSPVKVRQACYLPISNATGAPVIGKIGS--SIYVAAAHGCWGITLGPGTGKVLSELILDGAVTSANIDLLDPE 378          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|P38758|TDA3_YEAST (Putative oxidoreductase TDA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA3 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 4.152e-29
Identity = 97/296 (32.77%), Postives = 141/296 (47.64%), Query Frame = 1
Query:  379 LKWIDGPATNR-SLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTV-----IKSVI---LKSGGNIEA----------------------DKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFK-NDRGISSPEIYPRPDGTVYVCGFGDD-PELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPL----SSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNP 1155
            L WI     N  S L   DTT+Q+HP K     L  +K M      ++   VVG+  D+   V     + SV+     S G+ E                        ++V++MGPW+   LK  PI      SG RAHSV +K P   T+    +  + K NDR   SPE+Y R D  VYVCG GD    +PE + DV +   KC +L          L    ++ +QACFLP+    +S G P+IG+ + ++  YIA+GHSCWGI N+  TG  +A+++  G+    ++   +P
Sbjct:  230 LDWIRRELVNDWSSLGGTDTTAQLHPYKFTHFIL--SKAMETGAVDLLLGKVVGLKCDEMDCVHSLKYLPSVVKNRRNSRGHAENPDIKLGTIFNDENAKPIEINDIQQIVLSMGPWTSKILKDCPI------SGLRAHSVTIK-PSEKTVSPYAILAELKVNDREFFSPEMYARKD-EVYVCGEGDTLVNIPESSDDVEVVSEKCDELYHYVSKLSPTLSKGHLLRKQACFLPVLNVPTSSG-PLIGETN-VKDLYIASGHSCWGINNAPATGKLMAEILLDGEATSAEISSLDP 513          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|O14252|YE66_SCHPO (Putative oxidoreductase C6G10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.06 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.563e-10
Identity = 76/348 (21.84%), Postives = 142/348 (40.80%), Query Frame = 1
Query:  130 KKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNF---TEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNR-SLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSS-DGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPN 1158
            K  +   I E +EIA G+SG     L K  C++     L+ L+  L+  L K F      +YR  +++   + K  +    K  + L+W+      + S + + +  + ++PK  CQ   +E ++      + I  +V  +       V K     +    +  K +++ GPW+   L   P   +  +     H  V   P   +I   C      N     + EI+ +    +   G      LP+ +       ++  +L+E+     S    S  +     FLP S   G+PII    +  G ++A GH+ WGI  +  TG  +A+++   +   ++ +PF+ N
Sbjct:   37 KGELDIFIFESKEIAGGSSGIDSAILTKL-CQNEIIQPLSTLALKLYEGLDKKFDGKKNWEYRTANSWFCKM-KWDNTNVAKVPDTLQWLQRERMQKCSSIGSGNDFAMINPKLFCQFMAKEIEK---RGVKFIFGSVKEVSKHHITYVPKQEAEDTIIKAQVHKTLVSAGPWTGYLL---PFTGIAGLCIPIIHLSVGNFPVGDSIVV-CCLNTMGNLNICKTTEIFSKNREQLIFMGTPKFHLLPKDSNRCFFNPFEIIELKEMTDLVLSENTKSNYLDASFKFLPTSRITGIPIISTTKS--GVFVAAGHANWGITQAPATGLCMAEMLLGKEKTSINTDPFHLN 373          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|S5FMM4|GLYOX_BACLI (Glycine oxidase OS=Bacillus licheniformis OX=1402 GN=thiO PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 7.604e-6
Identity = 93/381 (24.41%), Postives = 138/381 (36.22%), Query Frame = 1
Query:  106 LSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFL-AKTWCKSNGC-NELALLSYDLHMELA---KNFTEVDYRNVD---TYSAFIDKIRSPITRKSS-EYLKWIDG-------PATNRSLLETVDTTSQVH--PKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPE--------IYPRPDGTVYVCGF---GDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNR 1161
             S AY LAK      + E  E+   A+  A G L A   C   G   E A  S   +  L    K+ + +D R  D      AF +  R  + +  + + ++W++        P   + +L        VH  P  +C+ F    + +  +  +     V+ I   ++G V    +  + G  EA+  VIA G WS    K   ++                  +   +  EC  L   ND GIS           I PR  G + V      GD  E PE             +L   A S    +ES +I    A   P + DG P IG+    +    A GH   GIL +  TG  +AD+I         +E F   R
Sbjct:   17 TSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLGAHAECDKPGTFFEFARASQKAYKRLTGELKDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYT--PVLSI-ESEAGAV---RVTSASGTAEAEHAVIASGVWSGALFKQIGLDK-----------------RFYPVKGEC--LSVWND-GISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELG--------GIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGILLAPATGEMMADMILGNPVKTEWIEAFKAER 363          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A1S3KFR3 (putative oxidoreductase TDA3 OS=Lingula unguis OX=7574 GN=LOC106181594 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.503e-99
Identity = 168/371 (45.28%), Postives = 228/371 (61.46%), Query Frame = 1
Query:   67 NMKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNF--TEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIG--YDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGIS-SPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNRL 1164
            ++++VICGGGIIG+S AY+LA+K V+  IIE+  +AC ASG+AGGFLAK WC  N    LA  S+++H ELA+ F  +++DYR +DT+   +D +    +   S    WIDG  T+ + L    TT+QVHP KL    LEE ++      ++I   V GI   +D    V    I      I  D VVIAMGPWS  A +WF    LPK+ GHRAHS+++K P     PA   F++ +   GI+ SPEIY RPDG VY+CG GDDPELP+  +DV  +     +L  +     + L  ++I  + ACF P+S DG P+IGKI   EGAYIATGHSCWGILN+  TG A+A+LI  G+  ++DL+ F+P R 
Sbjct:   11 DLRVVICGGGIIGVSIAYYLAEKGVAATIIERRSVACAASGRAGGFLAKNWCDHNELGHLARKSFEMHKELAEKFGASKIDYRLLDTFQ--VDSLEGFHSDSDSGKPDWIDGCVTSVATLGNTSTTAQVHPYKLTHAMLEEAQK---KGVKLIKGAVEGIKSTHDKRPKVQGVKIADQEEPIPCDIVVIAMGPWSHMASQWF--ARLPKVKGHRAHSIMVKPPTPF--PAHACFIEHRLKNGITRSPEIYCRPDGEVYICGLGDDPELPDNPEDVKPDPETGEKLLGIVGEISTKLGQADIQRKSACFYPVSPDGTPLIGKITTAEGAYIATGHSCWGILNAPVTGAAMAELIVDGQASIVDLKEFSPKRF 372          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A1S3KG89 (putative oxidoreductase TDA3 OS=Lingula unguis OX=7574 GN=LOC106181592 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 4.116e-99
Identity = 168/371 (45.28%), Postives = 228/371 (61.46%), Query Frame = 1
Query:   67 NMKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNF--TEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIG--YDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGIS-SPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNRL 1164
            ++++VICGGGIIG+S AY+LA+K V+  IIE+  +AC ASG+AGGFLAK WC  N    LA  S+++H ELA+ F  +++DYR +DT+   +D +    +   S    WIDG  T+ + L    TT+QVHP KL    LEE ++      ++I   V GI   +D    V    I      I  D VVIAMGPWS  A +WF    LPK+ GHRAHS+++K P     PA   F++ +   GI+ SPEIY RPDG VY+CG GDDPELP+  +DV  +     +L  +     + L  ++I  + ACF P+S DG P+IGKI   EGAYIATGHSCWGILN+  TG A+A+LI  G+  ++DL+ F+P R 
Sbjct:   11 DVRVVICGGGIIGVSIAYYLAEKGVAATIIERRSVACAASGRAGGFLAKNWCDHNELGHLARKSFEMHKELAEKFGASKIDYRLLDTFQ--VDSLEGFHSDSDSGKPDWIDGCVTSVATLGNTSTTAQVHPYKLTHAMLEEAQK---KGVKLIKGAVEGIKSTHDKRPKVQGVKIADQEEPIPCDIVVIAMGPWSHMASQWF--ARLPKVKGHRAHSIMVKPPTPF--PAHACFIEHRLKNGITRSPEIYCRPDGEVYICGLGDDPELPDNPEDVKPDPETGEKLLGIVGEISTKLGQADIQRKSACFYPVSPDGTPLIGKITTAEGAYIATGHSCWGILNAPVTGAAMAELIVDGQASIVDLKEFSPKRF 372          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A183MLN8 (DAO domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS16963 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.111e-88
Identity = 164/406 (40.39%), Postives = 226/406 (55.67%), Query Frame = 1
Query:   70 MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNF-TEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSV-----ILKSGGN---IEADKVVIAMGPWSKNALKWFPINSLP--KISGHRAHSVVMKVPK--NLTIPAECVFLQFKNDRGISSPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLI-----------------------TTGKCDLLD---LEPFNPNRLSK 1170
            M ++I GGGI+G+S AY+L+K+ V  +IIE+E+I   ASG+AGGFLAK WC  N  + LA   +DLHMELA  F +  DYR V+TYS  +   +   +  SS    W+     N SL+    TT+QVHPKKL  +     + +TN  T++    V+G+ +  S T    V     I  S  N   I A  V++  GPWSK A+ W P   L   K  G RAHS+++K PK     I A+C+F+ ++N     SPE+YPRPD TVYVCG GD   +P     V IE W+C++L+E+  S   +L+ +E++ E AC+LPL SDG P+IG+I  +   YIATG+SCWGIL    +G  +  +I                        T + DLL    +E FNP RL K
Sbjct:    1 MSVIIVGGGIMGVSTAYYLSKRKVDTLIIEKEQIGSAASGRAGGFLAKDWCSHNEMDVLAQNGFDLHMELADEFGSACDYRRVNTYSISLSPGK---SSGSSNSPSWVSAKVKNCSLIGDSTTTAQVHPKKLTDELFRRAQYLTNQGTKLKIARVIGLEFSTSNTSAPKVNGVRVIESSTSNSEVIPASLVILTTGPWSKEAVTWLPSGFLNSNKFHGRRAHSIILK-PKIEKSPIDAKCLFMDYQNSEFSCSPEVYPRPDNTVYVCGLGDGAPVPSSKDQVEIESWRCNRLKEIVTSVVPSLKDAEMITESACYLPLVSDGYPVIGQIPGLSNVYIATGNSCWGILTGPISGRLLTAIILKNNTNLKRSTNSNVTDQMELDEKTAQDDLLQKPGIELFNPARLIK 402          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A3R7TP80 (FAD-binding oxidoreductase OS=Hyphomicrobiaceae bacterium TMED74 OX=1986774 GN=CBC34_000930 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 5.208e-88
Identity = 150/368 (40.76%), Postives = 218/368 (59.24%), Query Frame = 1
Query:   70 MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNF-TEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGIS-SPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNRLS 1167
            M IVICG G+IG + AY L+ +     +IE+ ++   ASGK+GGFLA+ WC       LA  S++LH + A+       YR VDTYS      RS  +R  ++   W+     +R  L T  TT+Q+ P+   +  ++   +   N  Q+    V G+   D+GT ++ V L+ G  IE D VV+A+GPWS  A +W P   LP I G + HSV+ K PK + +P E +F +F++  G   +PEI PR +GT+YVCG   D  LP     V+ E   C +LR V+ S    L  ++++AEQACF P+++DG+PI+G ID  + AY+ATGHS WG+LN+ GT  A+ADLI TG+   +DL PF+P+RL+
Sbjct:    1 MNIVICGAGVIGGALAYELSSRGTDVTVIERWKVGGCASGKSGGFLARDWCDGTPVAPLAQRSFNLHEQWAEALGNPYGYRKVDTYSGAKSVRRSLGSRGQNDLAAWLADDVVHRQQLGTPSTTAQLDPEAFTKALVDGAVK---NGAQLKFGAVSGLLQTDAGTDVQGVTLEDGTRIEGDAVVLALGPWSLLAAQWLP---LPPIYGLKGHSVIFK-PK-VALPPETIFAEFEDTDGEHLAPEIVPRANGTLYVCGLSGDDALPVDPARVLPEDGGCERLRRVSMSLVPQLADADVIAEQACFRPVTADGMPIVGAIDGYDHAYVATGHSVWGMLNAPGTAEALADLILTGETKQVDLSPFSPSRLA 360          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A2D7F6A2 (D-amino-acid oxidase OS=Filomicrobium sp. OX=2024831 GN=CMB79_00955 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 5.208e-88
Identity = 150/368 (40.76%), Postives = 218/368 (59.24%), Query Frame = 1
Query:   70 MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNF-TEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGIS-SPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNRLS 1167
            M IVICG G+IG + AY L+ +     +IE+ ++   ASGK+GGFLA+ WC       LA  S++LH + A+       YR VDTYS      RS  +R  ++   W+     +R  L T  TT+Q+ P+   +  ++   +   N  Q+    V G+   D+GT ++ V L+ G  IE D VV+A+GPWS  A +W P   LP I G + HSV+ K PK + +P E +F +F++  G   +PEI PR +GT+YVCG   D  LP     V+ E   C +LR V+ S    L  ++++AEQACF P+++DG+PI+G ID  + AY+ATGHS WG+LN+ GT  A+ADLI TG+   +DL PF+P+RL+
Sbjct:    1 MNIVICGAGVIGGALAYELSSRGTDVTVIERWKVGGCASGKSGGFLARDWCDGTPVAPLAQRSFNLHEQWAEALGNPYGYRKVDTYSGAKSVRRSLGSRGQNDLAAWLADDVVHRQQLGTPSTTAQLDPEAFTKALVDGAVK---NGAQLKFGAVSGLLQTDAGTDVQGVTLEDGTRIEGDAVVLALGPWSLLAAQWLP---LPPIYGLKGHSVIFK-PK-VALPPETIFAEFEDTDGEHLAPEIVPRANGTLYVCGLSGDDALPVDPARVLPEDGGCERLRRVSMSLVPQLADADVIAEQACFRPVTADGMPIVGAIDGYDHAYVATGHSVWGMLNAPGTAEALADLILTGETKQVDLSPFSPSRLA 360          
BLAST of DAO domain-containing protein vs. Ensembl Yeast
Match: TDA3 (Putative oxidoreductase involved in late endosome to Golgi transport; physical and genetical interactions with Btn2p; null mutant is viable, has extended S phase, and sensitive to expression of top1-T722A allele; similar to human FOXRED1 [Source:SGD;Acc:S000001051])

HSP 1 Score: 123.25 bits (308), Expect = 5.979e-31
Identity = 97/296 (32.77%), Postives = 141/296 (47.64%), Query Frame = 1
Query:  379 LKWIDGPATNR-SLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTV-----IKSVI---LKSGGNIEA----------------------DKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFK-NDRGISSPEIYPRPDGTVYVCGFGDD-PELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPL----SSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNP 1155
            L WI     N  S L   DTT+Q+HP K     L  +K M      ++   VVG+  D+   V     + SV+     S G+ E                        ++V++MGPW+   LK  PI      SG RAHSV +K P   T+    +  + K NDR   SPE+Y R D  VYVCG GD    +PE + DV +   KC +L          L    ++ +QACFLP+    +S G P+IG+ + ++  YIA+GHSCWGI N+  TG  +A+++  G+    ++   +P
Sbjct:  230 LDWIRRELVNDWSSLGGTDTTAQLHPYKFTHFIL--SKAMETGAVDLLLGKVVGLKCDEMDCVHSLKYLPSVVKNRRNSRGHAENPDIKLGTIFNDENAKPIEINDIQQIVLSMGPWTSKILKDCPI------SGLRAHSVTIK-PSEKTVSPYAILAELKVNDREFFSPEMYARKD-EVYVCGEGDTLVNIPESSDDVEVVSEKCDELYHYVSKLSPTLSKGHLLRKQACFLPVLNVPTSSG-PLIGETN-VKDLYIASGHSCWGINNAPATGKLMAEILLDGEATSAEISSLDP 513          
BLAST of DAO domain-containing protein vs. Planmine SMEST
Match: SMESG000014053.1 (SMESG000014053.1)

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 366/368 (99.46%), Postives = 368/368 (100.00%), Query Frame = 1
Query:   70 MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNFTEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNRLSKN 1173
            MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNFTEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGTVY+CGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLD+EPFNPNRLSKN
Sbjct:    1 MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNFTEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGTVYLCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDMEPFNPNRLSKN 368          
BLAST of DAO domain-containing protein vs. Planmine SMEST
Match: SMESG000014040.1 (SMESG000014040.1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 243/367 (66.21%), Postives = 298/367 (81.20%), Query Frame = 1
Query:   70 MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTWCKSNGCNELALLSYDLHMELAKNFTEVDYRNVDTYSAFIDKIRSPITRKSSEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMITDTVVGIGYDDSGT--VIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPINSLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGTVYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQACFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTGKCDLLDLEPFNPNRL 1164
            MK+VICGGGIIGLSCAY+LAK+NVSCII+EQE++AC ASG+AGGFL+KTWC+SN CN+LA LS+ LHM+L+  FT+VDYRNV TYSA ++K+         E L W+DGP T  SLLET   T+QVHPKKL  KFLEE K++T+N+TQ+I  TV+G+G+D+SG   V+K+V L+SG  I+ D V+IAMGPWS  A  WFP  S+P+IS HRAHSV++K+PK L +  +C+FLQ+KN RG + PEIYPRPDGTVYV GFGD+ ELP++A +V IERW+CS LREVAYS CSNLE+SE++ EQACFLPLS DGVP+IGKI ++ GAYIAT HSCWGILNSTGTG AIA+LITTGKC  LDL PF PNR 
Sbjct:    1 MKVVICGGGIIGLSCAYYLAKQNVSCIIVEQEDVACAASGRAGGFLSKTWCESNVCNDLAQLSFSLHMQLSTVFTDVDYRNVTTYSAHVNKVNPVYFSNVPEELHWVDGPVTKCSLLETKANTAQVHPKKLSYKFLEEAKKLTSNSTQIIRGTVIGVGFDESGEIPVVKTVKLRSGRFIDTDAVLIAMGPWSHKASGWFPAGSIPQISSHRAHSVILKIPKTLQLTPDCLFLQYKNFRGTTCPEIYPRPDGTVYVSGFGDNAELPDRATEVQIERWRCSSLREVAYSTCSNLEASEVLVEQACFLPLSPDGVPLIGKIHSVHGAYIATAHSCWGILNSTGTGLAIAELITTGKCHSLDLTPFQPNRF 367          
The following BLAST results are available for this feature:
BLAST of DAO domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdpr-12.936e-635.53Pyruvate Dehydrogenase Phosphatase Regulatory subu... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q10058|YAM3_SCHPO2.055e-5033.85Putative oxidoreductase C1F5.03c OS=Schizosaccharo... [more]
sp|P38758|TDA3_YEAST4.152e-2932.77Putative oxidoreductase TDA3 OS=Saccharomyces cere... [more]
sp|O14252|YE66_SCHPO1.563e-1021.84Putative oxidoreductase C6G10.06 OS=Schizosaccharo... [more]
sp|S5FMM4|GLYOX_BACLI7.604e-624.41Glycine oxidase OS=Bacillus licheniformis OX=1402 ... [more]
back to top
BLAST of DAO domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KFR32.503e-9945.28putative oxidoreductase TDA3 OS=Lingula unguis OX=... [more]
A0A1S3KG894.116e-9945.28putative oxidoreductase TDA3 OS=Lingula unguis OX=... [more]
A0A183MLN82.111e-8840.39DAO domain-containing protein OS=Schistosoma margr... [more]
A0A3R7TP805.208e-8840.76FAD-binding oxidoreductase OS=Hyphomicrobiaceae ba... [more]
A0A2D7F6A25.208e-8840.76D-amino-acid oxidase OS=Filomicrobium sp. OX=20248... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TDA35.979e-3132.77Putative oxidoreductase involved in late endosome ... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000014053.10.000e+099.46SMESG000014053.1[more]
SMESG000014040.10.000e+066.21SMESG000014040.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033861 ID=SMED30033861|Name=DAO domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1406bp
TGTTTTACTACGCAAAATCGCTCAAAGCTTAAATTTTAGAAATTTACTTA
AATTAATGAAATTTTTAACATGAAAATAGTAATTTGTGGAGGGGGTATAA
TAGGTCTGTCGTGTGCATATTTTCTTGCCAAGAAAAATGTTTCATGTATC
ATAATTGAGCAAGAAGAGATTGCTTGTGGTGCTTCTGGTAAAGCTGGTGG
ATTTTTAGCAAAAACTTGGTGTAAATCAAATGGTTGCAATGAATTAGCAC
TTTTAAGTTATGATTTACACATGGAGTTGGCTAAAAATTTTACTGAAGTA
GATTACCGGAATGTAGATACCTATTCTGCTTTTATAGATAAAATTCGTTC
ACCTATTACTAGAAAAAGTTCTGAATATTTGAAATGGATTGACGGGCCAG
CTACAAATCGATCACTACTGGAAACTGTCGACACAACATCACAGGTTCAT
CCAAAAAAGTTGTGCCAAAAGTTTCTCGAAGAAACGAAAAGAATGACAAA
TAATACTACGCAAATGATTACTGACACTGTAGTTGGAATAGGATATGATG
ATTCCGGCACTGTAATTAAATCAGTTATATTGAAGTCTGGAGGTAATATT
GAAGCTGATAAAGTTGTAATTGCAATGGGTCCATGGTCCAAAAATGCATT
GAAATGGTTTCCTATAAACTCATTGCCAAAAATAAGTGGCCATAGAGCAC
ACAGTGTTGTTATGAAAGTTCCAAAAAATTTAACTATTCCTGCCGAGTGT
GTATTTCTACAATTTAAAAACGATCGTGGAATTTCTTCACCCGAGATTTA
TCCTCGACCAGATGGTACAGTATATGTTTGTGGATTTGGAGATGATCCAG
AACTTCCAGAAAAAGCTAAAGATGTGATAATTGAACGCTGGAAATGCAGC
CAATTGCGTGAAGTGGCTTATTCGGCTTGTTCAAATCTTGAATCATCAGA
AATTGTTGCTGAACAGGCTTGTTTCTTGCCATTATCATCGGACGGCGTTC
CTATTATTGGTAAAATTGATGCGATTGAGGGTGCGTATATCGCCACTGGT
CACAGTTGTTGGGGTATCCTCAATTCAACCGGAACTGGATATGCGATCGC
TGATTTGATAACGACTGGAAAATGCGATCTACTTGACCTGGAACCTTTTA
ACCCCAATAGACTTTCGAAAAATTGAATTTGTAATTCATGAAACTGGAAA
ATTGGAATTTTTAATTCATAAAAATATTTTTTATTTCTAAAGTGAATTAT
TTGATTGAAAAGAGCTTGGTGGTTTTTCGAATTGGAAAGATACCACACCT
CAGTCGATAGATGTGAGATTCTAACTCATTTCCAGTTATCAAGTCGATAA
CGAAAGCTGAGTTATGAAATTTGTCTAAAATGTTTTTGCAGACGAATAAA
GTTTCG
back to top

protein sequence of SMED30033861-orf-1

>SMED30033861-orf-1 ID=SMED30033861-orf-1|Name=SMED30033861-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MKIVICGGGIIGLSCAYFLAKKNVSCIIIEQEEIACGASGKAGGFLAKTW
CKSNGCNELALLSYDLHMELAKNFTEVDYRNVDTYSAFIDKIRSPITRKS
SEYLKWIDGPATNRSLLETVDTTSQVHPKKLCQKFLEETKRMTNNTTQMI
TDTVVGIGYDDSGTVIKSVILKSGGNIEADKVVIAMGPWSKNALKWFPIN
SLPKISGHRAHSVVMKVPKNLTIPAECVFLQFKNDRGISSPEIYPRPDGT
VYVCGFGDDPELPEKAKDVIIERWKCSQLREVAYSACSNLESSEIVAEQA
CFLPLSSDGVPIIGKIDAIEGAYIATGHSCWGILNSTGTGYAIADLITTG
KCDLLDLEPFNPNRLSKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR006076FAD-dep_OxRdtase
IPR023753FAD/NAD-binding_dom
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.9.10coord: 81..306
e-value: 4.7E-42
score: 146.4
NoneNo IPR availablePANTHERPTHR13847:SF150OXIDOREDUCTASE TDA3-RELATEDcoord: 2..366
NoneNo IPR availablePANTHERPTHR13847FAD NAD BINDING OXIDOREDUCTASEScoord: 2..366
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..15
score: 5.0
IPR006076FAD dependent oxidoreductasePFAMPF01266DAOcoord: 2..346
e-value: 7.8E-53
score: 180.3
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 3..347
e-value: 4.7E-42
score: 146.4
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 1..365