FERM domain-containing protein

Overview
NameFERM domain-containing protein
Smed IDSMED30033841
Length (bp)3189
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FERM domain-containing protein (SMED30033841) t-SNE clustered cells

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30033841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FERM domain-containing protein (SMED30033841) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30033841) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033841SMESG000016903.1 PL04015A2B09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30033841SMESG000016903.1 dd_Smed_v4_2996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033841SMESG000016903.1 dd_Smed_v4_2996_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: RIN2 (Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:HGNC:18750])

HSP 1 Score: 90.8929 bits (224), Expect = 7.437e-18
Identity = 88/364 (24.18%), Postives = 174/364 (47.80%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     ++ +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +   +D  V+ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  545 ECHVSSTDM-----LQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKGHVEAMLKDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDFVD--VEKIKVKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSETRDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 875          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: RIN2 (Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:HGNC:18750])

HSP 1 Score: 90.8929 bits (224), Expect = 7.730e-18
Identity = 88/364 (24.18%), Postives = 174/364 (47.80%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     ++ +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +   +D  V+ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  594 ECHVSSTDM-----LQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKGHVEAMLKDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDFVD--VEKIKVKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSETRDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 924          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: RIN2 (Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:HGNC:18750])

HSP 1 Score: 85.8853 bits (211), Expect = 1.050e-16
Identity = 76/304 (25.00%), Postives = 146/304 (48.03%), Query Frame = 1
Query: 2137 IIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +   +D  V+ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  157 VLEKAMHKCILKPLKGHVEAMLKDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDFVD--VEKIKVKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSETRDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 442          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: AL159141.1 (Ras and Rab interactor 3 [Source:NCBI gene;Acc:79890])

HSP 1 Score: 71.633 bits (174), Expect = 6.031e-12
Identity = 46/140 (32.86%), Postives = 76/140 (54.29%), Query Frame = 1
Query:  316 INNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY------KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            I+  ++L KT  +W+Q    + +V +IL+    G+F++R +S SK +VL        ++   V    IK + +   Y++GS+ +F+ +  +IA Y V    S DLL   L+LP+A+ EAS  T  +   NL   FW +SL
Sbjct:   50 ISILEKLIKTCPVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE-KSILYLEGSALVFEDIFRLIAFYCV----SRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSL 184          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: AL159141.1 (Ras and Rab interactor 3 [Source:NCBI gene;Acc:79890])

HSP 1 Score: 71.633 bits (174), Expect = 6.033e-12
Identity = 46/140 (32.86%), Postives = 76/140 (54.29%), Query Frame = 1
Query:  316 INNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY------KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            I+  ++L KT  +W+Q    + +V +IL+    G+F++R +S SK +VL        ++   V    IK + +   Y++GS+ +F+ +  +IA Y V    S DLL   L+LP+A+ EAS  T  +   NL   FW +SL
Sbjct:   50 ISILEKLIKTCPVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE-KSILYLEGSALVFEDIFRLIAFYCV----SRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSL 184          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: rin-1 (RIN (Ras/Rab INteractor) homolog [Source:UniProtKB/TrEMBL;Acc:G5ECM3])

HSP 1 Score: 108.612 bits (270), Expect = 5.961e-24
Identity = 101/421 (23.99%), Postives = 189/421 (44.89%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRK--GHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFL--QMAKQYSP--EXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKS----DYLLPILVYIFSQCKVDAISTQCEVE--YIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLG--RPSINPTDAVDLRNNEPIKINNSAFFSKIN---------PSTLSAAAVGS-VNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G++++ Y+ +L   K   ++    ++R F+ CT +  +  P   +R +RQ+++G+KN + +   E  L  II+EE  +   N  +N ++++E+VL K +++ +   +Y +++ EH K   L+LIS       K   T+LG      L+  S   + Q K L  +M   YSP  + +       + +  ++      + P+D M   ++     D L+   VYI S+      +  CEVE  Y+  L+    +   +  +YL ++ S++  +K     R        V + ++    + +S   S            P  +SAA   + V + + DE +  +   TFP    +T   L   +AH+ GI NP+E+ LY      E  L   E P+ + +  ++     + F +KR  A    P
Sbjct:  243 GRAVQNYVEELAQVKEGDNACFGLTLRQFVACTKDTKETDPAVVIRNVRQFINGMKNYLVKH-GEGDLHHIIDEESSRLNSNQILNIDAVLEAVLHKLLLREVKPLLYHVMIKEHSKAGALQLISQNQGVVRKMNLTELGFSNPESLVTPSSSIMEQVKLLMRKMQNHYSPMKKLENLMKAVGLVLGCQVNNGNENENPTDPMSCGYRGLPPGDDLVRWFVYILSRTS----TVGCEVEAWYMWELLPQPIVTQSDASYYLTSLWSAVHVLKSTESIRRLCENDQRVIVSHDSSRHLCSSPLLSTATLTRGTSAGIPQVISAATCDAFVKIAVPDEAVGCVRYATFPGVPMLTTSKLSRLVAHQQGITNPEEHGLYLIAEGFESCLSPSECPVLVHEQLKKDKKPHM-FAYKRHEAKIAWP 657          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: rin-1 (RIN (Ras/Rab INteractor) homolog [Source:UniProtKB/TrEMBL;Acc:G5ECM3])

HSP 1 Score: 108.227 bits (269), Expect = 6.197e-24
Identity = 101/421 (23.99%), Postives = 189/421 (44.89%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRK--GHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFL--QMAKQYSP--EXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKS----DYLLPILVYIFSQCKVDAISTQCEVE--YIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLG--RPSINPTDAVDLRNNEPIKINNSAFFSKIN---------PSTLSAAAVGS-VNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G++++ Y+ +L   K   ++    ++R F+ CT +  +  P   +R +RQ+++G+KN + +   E  L  II+EE  +   N  +N ++++E+VL K +++ +   +Y +++ EH K   L+LIS       K   T+LG      L+  S   + Q K L  +M   YSP  + +       + +  ++      + P+D M   ++     D L+   VYI S+      +  CEVE  Y+  L+    +   +  +YL ++ S++  +K     R        V + ++    + +S   S            P  +SAA   + V + + DE +  +   TFP    +T   L   +AH+ GI NP+E+ LY      E  L   E P+ + +  ++     + F +KR  A    P
Sbjct:  165 GRAVQNYVEELAQVKEGDNACFGLTLRQFVACTKDTKETDPAVVIRNVRQFINGMKNYLVKH-GEGDLHHIIDEESSRLNSNQILNIDAVLEAVLHKLLLREVKPLLYHVMIKEHSKAGALQLISQNQGVVRKMNLTELGFSNPESLVTPSSSIMEQVKLLMRKMQNHYSPMKKLENLMKAVGLVLGCQVNNGNENENPTDPMSCGYRGLPPGDDLVRWFVYILSRTS----TVGCEVEAWYMWELLPQPIVTQSDASYYLTSLWSAVHVLKSTESIRRLCENDQRVIVSHDSSRHLCSSPLLSTATLTRGTSAGIPQVISAATCDAFVKIAVPDEAVGCVRYATFPGVPMLTTSKLSRLVAHQQGITNPEEHGLYLIAEGFESCLSPSECPVLVHEQLKKDKKPHM-FAYKRHEAKIAWP 579          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: rin-1 (RIN (Ras/Rab INteractor) homolog [Source:UniProtKB/TrEMBL;Acc:G5ECM3])

HSP 1 Score: 108.227 bits (269), Expect = 2.189e-23
Identity = 101/421 (23.99%), Postives = 189/421 (44.89%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRK--GHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFL--QMAKQYSP--EXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKS----DYLLPILVYIFSQCKVDAISTQCEVE--YIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLG--RPSINPTDAVDLRNNEPIKINNSAFFSKIN---------PSTLSAAAVGS-VNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G++++ Y+ +L   K   ++    ++R F+ CT +  +  P   +R +RQ+++G+KN + +   E  L  II+EE  +   N  +N ++++E+VL K +++ +   +Y +++ EH K   L+LIS       K   T+LG      L+  S   + Q K L  +M   YSP  + +       + +  ++      + P+D M   ++     D L+   VYI S+      +  CEVE  Y+  L+    +   +  +YL ++ S++  +K     R        V + ++    + +S   S            P  +SAA   + V + + DE +  +   TFP    +T   L   +AH+ GI NP+E+ LY      E  L   E P+ + +  ++     + F +KR  A    P
Sbjct: 1221 GRAVQNYVEELAQVKEGDNACFGLTLRQFVACTKDTKETDPAVVIRNVRQFINGMKNYLVKH-GEGDLHHIIDEESSRLNSNQILNIDAVLEAVLHKLLLREVKPLLYHVMIKEHSKAGALQLISQNQGVVRKMNLTELGFSNPESLVTPSSSIMEQVKLLMRKMQNHYSPMKKLENLMKAVGLVLGCQVNNGNENENPTDPMSCGYRGLPPGDDLVRWFVYILSRTS----TVGCEVEAWYMWELLPQPIVTQSDASYYLTSLWSAVHVLKSTESIRRLCENDQRVIVSHDSSRHLCSSPLLSTATLTRGTSAGIPQVISAATCDAFVKIAVPDEAVGCVRYATFPGVPMLTTSKLSRLVAHQQGITNPEEHGLYLIAEGFESCLSPSECPVLVHEQLKKDKKPHM-FAYKRHEAKIAWP 1635          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: rin-1 (RIN (Ras/Rab INteractor) homolog [Source:UniProtKB/TrEMBL;Acc:G5ECM3])

HSP 1 Score: 107.457 bits (267), Expect = 3.181e-23
Identity = 101/421 (23.99%), Postives = 189/421 (44.89%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRK--GHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFL--QMAKQYSP--EXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKS----DYLLPILVYIFSQCKVDAISTQCEVE--YIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLG--RPSINPTDAVDLRNNEPIKINNSAFFSKIN---------PSTLSAAAVGS-VNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G++++ Y+ +L   K   ++    ++R F+ CT +  +  P   +R +RQ+++G+KN + +   E  L  II+EE  +   N  +N ++++E+VL K +++ +   +Y +++ EH K   L+LIS       K   T+LG      L+  S   + Q K L  +M   YSP  + +       + +  ++      + P+D M   ++     D L+   VYI S+      +  CEVE  Y+  L+    +   +  +YL ++ S++  +K     R        V + ++    + +S   S            P  +SAA   + V + + DE +  +   TFP    +T   L   +AH+ GI NP+E+ LY      E  L   E P+ + +  ++     + F +KR  A    P
Sbjct: 1471 GRAVQNYVEELAQVKEGDNACFGLTLRQFVACTKDTKETDPAVVIRNVRQFINGMKNYLVKH-GEGDLHHIIDEESSRLNSNQILNIDAVLEAVLHKLLLREVKPLLYHVMIKEHSKAGALQLISQNQGVVRKMNLTELGFSNPESLVTPSSSIMEQVKLLMRKMQNHYSPMKKLENLMKAVGLVLGCQVNNGNENENPTDPMSCGYRGLPPGDDLVRWFVYILSRTS----TVGCEVEAWYMWELLPQPIVTQSDASYYLTSLWSAVHVLKSTESIRRLCENDQRVIVSHDSSRHLCSSPLLSTATLTRGTSAGIPQVISAATCDAFVKIAVPDEAVGCVRYATFPGVPMLTTSKLSRLVAHQQGITNPEEHGLYLIAEGFESCLSPSECPVLVHEQLKKDKKPHM-FAYKRHEAKIAWP 1885          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: rin-1 (RIN (Ras/Rab INteractor) homolog [Source:UniProtKB/TrEMBL;Acc:G5ECM3])

HSP 1 Score: 107.457 bits (267), Expect = 3.427e-23
Identity = 101/421 (23.99%), Postives = 189/421 (44.89%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRK--GHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFL--QMAKQYSP--EXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKS----DYLLPILVYIFSQCKVDAISTQCEVE--YIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLG--RPSINPTDAVDLRNNEPIKINNSAFFSKIN---------PSTLSAAAVGS-VNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G++++ Y+ +L   K   ++    ++R F+ CT +  +  P   +R +RQ+++G+KN + +   E  L  II+EE  +   N  +N ++++E+VL K +++ +   +Y +++ EH K   L+LIS       K   T+LG      L+  S   + Q K L  +M   YSP  + +       + +  ++      + P+D M   ++     D L+   VYI S+      +  CEVE  Y+  L+    +   +  +YL ++ S++  +K     R        V + ++    + +S   S            P  +SAA   + V + + DE +  +   TFP    +T   L   +AH+ GI NP+E+ LY      E  L   E P+ + +  ++     + F +KR  A    P
Sbjct: 1326 GRAVQNYVEELAQVKEGDNACFGLTLRQFVACTKDTKETDPAVVIRNVRQFINGMKNYLVKH-GEGDLHHIIDEESSRLNSNQILNIDAVLEAVLHKLLLREVKPLLYHVMIKEHSKAGALQLISQNQGVVRKMNLTELGFSNPESLVTPSSSIMEQVKLLMRKMQNHYSPMKKLENLMKAVGLVLGCQVNNGNENENPTDPMSCGYRGLPPGDDLVRWFVYILSRTS----TVGCEVEAWYMWELLPQPIVTQSDASYYLTSLWSAVHVLKSTESIRRLCENDQRVIVSHDSSRHLCSSPLLSTATLTRGTSAGIPQVISAATCDAFVKIAVPDEAVGCVRYATFPGVPMLTTSKLSRLVAHQQGITNPEEHGLYLIAEGFESCLSPSECPVLVHEQLKKDKKPHM-FAYKRHEAKIAWP 1740          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: spri (gene:FBgn0085443 transcript:FBtr0336902)

HSP 1 Score: 150.214 bits (378), Expect = 2.393e-38
Identity = 104/400 (26.00%), Postives = 199/400 (49.75%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKV-LGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPS 3069
            G S+R Y +QL ++   S  + ++  FI CT E  + +P   MR MRQ+MSG+KN ++K  + +F   + +E  R +   + F+N ++++E+V+ + VV PL  ++Y + V  + ++ +++L++  V  A + E    G+  +      + ++LI     ++ +   P       +  +E+   ++ +++  T     +    +D  LP+LVY+ ++C    +  + E E++ GL+   TL++GEPG+YL  + S+++ +K  +     + + ++D R                  S+   A    + VII DE    L T+T PVR   T   +C  IAH+  I NP++Y L+K    +E LL + E P   +   +   G+     +KR +A    P+
Sbjct:   73 GDSLRAYTLQL-AQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFH--AELETARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDHYQRSEDIQLLAQNVRYACEREAADFGIRPTVTPPSQAALRLIANLLWRLQEAELP-------LDKLELFLCVISTVFDATGCPRGQQ-LGADDFLPVLVYVVAKCGF--VGAEIEAEFMWGLL-QPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWR------------------SSCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLVDGEETLLTDAECPQDARLAAK---GKHCMLAYKRIDAKIAWPT 437          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: spri (gene:FBgn0085443 transcript:FBtr0336903)

HSP 1 Score: 151.369 bits (381), Expect = 1.391e-37
Identity = 104/400 (26.00%), Postives = 199/400 (49.75%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKV-LGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPS 3069
            G S+R Y +QL ++   S  + ++  FI CT E  + +P   MR MRQ+MSG+KN ++K  + +F   + +E  R +   + F+N ++++E+V+ + VV PL  ++Y + V  + ++ +++L++  V  A + E    G+  +      + ++LI     ++ +   P       +  +E+   ++ +++  T     +    +D  LP+LVY+ ++C    +  + E E++ GL+   TL++GEPG+YL  + S+++ +K  +     + + ++D R                  S+   A    + VII DE    L T+T PVR   T   +C  IAH+  I NP++Y L+K    +E LL + E P   +   +   G+     +KR +A    P+
Sbjct:  267 GDSLRAYTLQL-AQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFH--AELETARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDHYQRSEDIQLLAQNVRYACEREAADFGIRPTVTPPSQAALRLIANLLWRLQEAELP-------LDKLELFLCVISTVFDATGCPRGQQ-LGADDFLPVLVYVVAKCGF--VGAEIEAEFMWGLL-QPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWR------------------SSCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLVDGEETLLTDAECPQDARLAAK---GKHCMLAYKRIDAKIAWPT 631          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: spri (gene:FBgn0085443 transcript:FBtr0112690)

HSP 1 Score: 151.754 bits (382), Expect = 1.962e-37
Identity = 104/400 (26.00%), Postives = 199/400 (49.75%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKV-LGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPS 3069
            G S+R Y +QL ++   S  + ++  FI CT E  + +P   MR MRQ+MSG+KN ++K  + +F   + +E  R +   + F+N ++++E+V+ + VV PL  ++Y + V  + ++ +++L++  V  A + E    G+  +      + ++LI     ++ +   P       +  +E+   ++ +++  T     +    +D  LP+LVY+ ++C    +  + E E++ GL+   TL++GEPG+YL  + S+++ +K  +     + + ++D R                  S+   A    + VII DE    L T+T PVR   T   +C  IAH+  I NP++Y L+K    +E LL + E P   +   +   G+     +KR +A    P+
Sbjct:  351 GDSLRAYTLQL-AQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFH--AELETARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDHYQRSEDIQLLAQNVRYACEREAADFGIRPTVTPPSQAALRLIANLLWRLQEAELP-------LDKLELFLCVISTVFDATGCPRGQQ-LGADDFLPVLVYVVAKCGF--VGAEIEAEFMWGLL-QPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWR------------------SSCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLVDGEETLLTDAECPQDARLAAK---GKHCMLAYKRIDAKIAWPT 715          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: spri (gene:FBgn0085443 transcript:FBtr0310293)

HSP 1 Score: 150.214 bits (378), Expect = 2.571e-36
Identity = 104/400 (26.00%), Postives = 199/400 (49.75%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKV-LGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPS 3069
            G S+R Y +QL ++   S  + ++  FI CT E  + +P   MR MRQ+MSG+KN ++K  + +F   + +E  R +   + F+N ++++E+V+ + VV PL  ++Y + V  + ++ +++L++  V  A + E    G+  +      + ++LI     ++ +   P       +  +E+   ++ +++  T     +    +D  LP+LVY+ ++C    +  + E E++ GL+   TL++GEPG+YL  + S+++ +K  +     + + ++D R                  S+   A    + VII DE    L T+T PVR   T   +C  IAH+  I NP++Y L+K    +E LL + E P   +   +   G+     +KR +A    P+
Sbjct: 1079 GDSLRAYTLQL-AQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFH--AELETARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDHYQRSEDIQLLAQNVRYACEREAADFGIRPTVTPPSQAALRLIANLLWRLQEAELP-------LDKLELFLCVISTVFDATGCPRGQQ-LGADDFLPVLVYVVAKCGF--VGAEIEAEFMWGLL-QPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWR------------------SSCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLVDGEETLLTDAECPQDARLAAK---GKHCMLAYKRIDAKIAWPT 1443          

HSP 2 Score: 56.225 bits (134), Expect = 2.138e-7
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  328 QRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYK----TEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFW 696
            +RL  T  +W  P   R     +L   E G FI+R +S   TM +S +    T   ++H  I+        ++ S   F S+  +IAHY     + P + L LPR LREA++         L  +FW
Sbjct:  124 ERLLVTHPMWFLPGIQRSGAVHLLQGKEEGTFIVRGSSQPNTMAVSVRLPQDTGPYIEHYLIQSH-DNVLSLESSRFTFGSIPSLIAHYAQCCDELP-VQLMLPRVLREANNRKKLSSLALLGQEFW 248          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: spri (gene:FBgn0085443 transcript:FBtr0310438)

HSP 1 Score: 150.214 bits (378), Expect = 3.282e-36
Identity = 104/400 (26.00%), Postives = 199/400 (49.75%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKV-LGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPS 3069
            G S+R Y +QL ++   S  + ++  FI CT E  + +P   MR MRQ+MSG+KN ++K  + +F   + +E  R +   + F+N ++++E+V+ + VV PL  ++Y + V  + ++ +++L++  V  A + E    G+  +      + ++LI     ++ +   P       +  +E+   ++ +++  T     +    +D  LP+LVY+ ++C    +  + E E++ GL+   TL++GEPG+YL  + S+++ +K  +     + + ++D R                  S+   A    + VII DE    L T+T PVR   T   +C  IAH+  I NP++Y L+K    +E LL + E P   +   +   G+     +KR +A    P+
Sbjct: 1171 GDSLRAYTLQL-AQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFH--AELETARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDHYQRSEDIQLLAQNVRYACEREAADFGIRPTVTPPSQAALRLIANLLWRLQEAELP-------LDKLELFLCVISTVFDATGCPRGQQ-LGADDFLPVLVYVVAKCGF--VGAEIEAEFMWGLL-QPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWR------------------SSCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLVDGEETLLTDAECPQDARLAAK---GKHCMLAYKRIDAKIAWPT 1535          

HSP 2 Score: 56.225 bits (134), Expect = 2.054e-7
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  328 QRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYK----TEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFW 696
            +RL  T  +W  P   R     +L   E G FI+R +S   TM +S +    T   ++H  I+        ++ S   F S+  +IAHY     + P + L LPR LREA++         L  +FW
Sbjct:  216 ERLLVTHPMWFLPGIQRSGAVHLLQGKEEGTFIVRGSSQPNTMAVSVRLPQDTGPYIEHYLIQSH-DNVLSLESSRFTFGSIPSLIAHYAQCCDELP-VQLMLPRVLREANNRKKLSSLALLGQEFW 340          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: rin3 (Ras and Rab interactor 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8871])

HSP 1 Score: 79.337 bits (194), Expect = 1.989e-14
Identity = 95/378 (25.13%), Postives = 177/378 (46.83%), Query Frame = 1
Query: 1885 IRKYLIQLCSRKGHSDISNSVRTFIQCTME--RTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKV-QLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGS-VNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQ 3006
            ++K ++++ SR G++   N V+ +   T++  R   S    ++ +RQ ++ LK+ + Q     A L  ++E    + +      E IIE+ + K+V+KPL   VY  L   H +  NLK + +  +    +  T LG+  S   + ++ + + IQ +   + ++YSP+KKI  ++   +I       IY             +D  LP+L+Y+ ++C + A+    +VEY+  L+    L  GE  +YL     +LE IK   + ++    +++++++    I+       +N +  S  +V   +NV  L+   N   TKT  VR   T  +LC+  A +  + +P+ Y L          L   E+PL IK T   
Sbjct:  664 LQKRIVEM-SRDGNTYFGNLVKDYRAFTLDTMRKHTSSTEMLQEIRQMITQLKSYLIQS----AELQNVQETAAYSEEK----LEIIIEAAICKSVLKPLREAVYNGLKDIHSRAGNLKKLKENQQVVQGTTTTDLGVITS---VPETPIMEKIQTRLGNLHQEYSPQKKIDLLLKTCKI-------IYESMSVGCPGRAHGADDFLPVLMYVLARCNITAL--LLDVEYMMELM-DPALQLGEGSYYLTTTYGALEHIKNFDKQAVTRQLSLEIQDS----IHRWERRRTLNKARASRTSVQDFINVSFLEACSN---TKTLGVRPNTTAKDLCSQCAEKFEVLDPESYCLSVLVEGHYNHLAPEEFPLAIKSTLHH 1012          

HSP 2 Score: 64.6994 bits (156), Expect = 6.659e-10
Identity = 42/141 (29.79%), Postives = 79/141 (56.03%), Query Frame = 1
Query:  307 PEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQ--HVK-IKVDLRRG-FYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            P  I+  ++L KT  +W+Q          IL++   GIF++R ++  KTMVL+ +  D++   HVK + V   +   Y++GS  +F+++ ++IA Y V    S D+L   LKLP+ +++ +     +   ++ S+FW ++L
Sbjct:  144 PPGISILEKLIKTCPVWLQLGMNLDKAMHILSKEFPGIFLVRRDATQKTMVLAVRLPDQLGEPHVKELPVKEEKSLLYLEGSVLVFENIFKLIAFYCV----SRDILPFPLKLPQVIQKVAKYEDMEVISSIGSEFWNSTL 280          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: rin2 (Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-194])

HSP 1 Score: 60.077 bits (144), Expect = 1.474e-8
Identity = 72/331 (21.75%), Postives = 152/331 (45.92%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK 2991
            ++ +RQ+M+ +K+ +++  + +  + S+I E++           + ++E  + K V+KPL   +   L      +  ++ + + +  A   +P ++G++ +        ++ I+ KF  M K YSPEKK++ ++S+ ++       IY    ++S R  + +D  LP+L Y+ +QC +  + T  E++Y+  L+   +L+ GE G+YL +   ++  IK           + + RN     ++          +T S     +   + L +  +    KT  V+   T  ++C   A +  I +P+ Y L+  T      L    +P  IK
Sbjct:  598 LQTLRQFMTQMKSYLLQSSELDPPIESLIPEDQ----------IDQVMEKAMHKCVLKPLKPVIEAALRDFQLSSGTMQQLKENLLLAKAKQPQEMGVDGARP-PDPVAIEKIRHKFNNMCKMYSPEKKVSLLLSVCKL-------IYTIMENNSGRM-YGADDFLPMLTYVMAQCDMPELDT--EIQYMMELL-DPSLLHGEGGYYLTSAYGAMSLIKNFQEDQAARELSSETRNT----LHQWHRRRTTQRTTPSVDDFQNYLRVALQDASSGCTAKTLQVQPYATTEDVCQICADKFKISDPENYALFLLTEETTQQLTLDTHPQKIK 902          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: rin2 (Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE-090312-194])

HSP 1 Score: 60.077 bits (144), Expect = 1.474e-8
Identity = 72/331 (21.75%), Postives = 152/331 (45.92%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK 2991
            ++ +RQ+M+ +K+ +++  + +  + S+I E++           + ++E  + K V+KPL   +   L      +  ++ + + +  A   +P ++G++ +        ++ I+ KF  M K YSPEKK++ ++S+ ++       IY    ++S R  + +D  LP+L Y+ +QC +  + T  E++Y+  L+   +L+ GE G+YL +   ++  IK           + + RN     ++          +T S     +   + L +  +    KT  V+   T  ++C   A +  I +P+ Y L+  T      L    +P  IK
Sbjct:  598 LQTLRQFMTQMKSYLLQSSELDPPIESLIPEDQ----------IDQVMEKAMHKCVLKPLKPVIEAALRDFQLSSGTMQQLKENLLLAKAKQPQEMGVDGARP-PDPVAIEKIRHKFNNMCKMYSPEKKVSLLLSVCKL-------IYTIMENNSGRM-YGADDFLPMLTYVMAQCDMPELDT--EIQYMMELL-DPSLLHGEGGYYLTSAYGAMSLIKNFQEDQAARELSSETRNT----LHQWHRRRTTQRTTPSVDDFQNYLRVALQDASSGCTAKTLQVQPYATTEDVCQICADKFKISDPENYALFLLTEETTQQLTLDTHPQKIK 902          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: RIN2 (si:ch211-85n16.4 [Source:ZFIN;Acc:ZDB-GENE-030131-7043])

HSP 1 Score: 56.225 bits (134), Expect = 1.330e-7
Identity = 78/358 (21.79%), Postives = 152/358 (42.46%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKNMIKQQKSEF--ALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINP----STL-----SAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFK 3039
            ++ +RQ+M+ +K  +KQ  SE    + S + E++           + ++E  + K V+KPL   ++  L          + + + +  A    P +LG+  +      + +Q I++K   M   YSPE+KI  ++ + ++       IY       +R  F +D  LP+L Y+  QC +  + T  E+ Y+  LI    L+ GE G+YL +   ++  IK             + +  +  +I +SA    ++      TL     S     +   + L +  +    KT  VR   T   +C   A +  + +P+ Y L+  T      L    +P  IK + + +   +  +F+++
Sbjct:  119 LQTIRQFMTQMKAYLKQ-SSEMNPPIESYMPEDQ----------IDPVLEKAMHKCVLKPLYGCLHSALHEFQAAAGVWQTLQENLAIAKTKRPNELGVNGAQAPDTHA-IQRIRRKLRAMCSMYSPERKIMVLLKVCKL-------IYSIMQEHEVRM-FGADDFLPMLTYVLVQCDMPQLDT--EILYMMELI-DPPLLHGEGGYYLTSAYGAMSLIK-------------NFQEEQAARILSSATSDTLHQWHQRRTLQRNLPSVDDFQNYMRVALQKADSGCTAKTLQVRPYATTEEVCRLCALKFRVSDPENYGLFLLTDESSQQLAADTHPQWIKAELHSRPNRQPFHFVYR 440          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: RIN2 (si:ch211-85n16.4 [Source:ZFIN;Acc:ZDB-GENE-030131-7043])

HSP 1 Score: 56.225 bits (134), Expect = 2.289e-7
Identity = 78/358 (21.79%), Postives = 152/358 (42.46%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKNMIKQQKSEF--ALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINP----STL-----SAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFK 3039
            ++ +RQ+M+ +K  +KQ  SE    + S + E++           + ++E  + K V+KPL   ++  L          + + + +  A    P +LG+  +      + +Q I++K   M   YSPE+KI  ++ + ++       IY       +R  F +D  LP+L Y+  QC +  + T  E+ Y+  LI    L+ GE G+YL +   ++  IK             + +  +  +I +SA    ++      TL     S     +   + L +  +    KT  VR   T   +C   A +  + +P+ Y L+  T      L    +P  IK + + +   +  +F+++
Sbjct:  491 LQTIRQFMTQMKAYLKQ-SSEMNPPIESYMPEDQ----------IDPVLEKAMHKCVLKPLYGCLHSALHEFQAAAGVWQTLQENLAIAKTKRPNELGVNGAQAPDTHA-IQRIRRKLRAMCSMYSPERKIMVLLKVCKL-------IYSIMQEHEVRM-FGADDFLPMLTYVLVQCDMPQLDT--EILYMMELI-DPPLLHGEGGYYLTSAYGAMSLIK-------------NFQEEQAARILSSATSDTLHQWHQRRTLQRNLPSVDDFQNYMRVALQKADSGCTAKTLQVRPYATTEEVCRLCALKFRVSDPENYGLFLLTDESSQQLAADTHPQWIKAELHSRPNRQPFHFVYR 812          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: rin2 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:100144744])

HSP 1 Score: 92.4337 bits (228), Expect = 2.384e-18
Identity = 89/366 (24.32%), Postives = 174/366 (47.54%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVN---VIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     +  +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL S++  +L      + + + + + ++   +  P +LG+   +   +D  ++ ++ KFL M K YSPE+K+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC +  I T  E+EY+  L+    L+ GE G+YL +   +L  IK     +     A  L N+E    +    + K   +  S  ++        + L E  +    KT  V+   T  ++C+  A R GI +P+ Y L+ Y  +    L E  YP  IK + + +   +  +F++KR
Sbjct:  529 ECHVSSTDM-----LHTIRQFMTQVKNYLAQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKSHIESMLKEFRVADGSWRQLKENLQLVRQRSPQELGVLTPTPESMD--IEKMRIKFLNMQKMYSPERKVMLLLRVCKL-------IYTCMENNSGRM-YGADDFLPVLTYVIAQCDMLEIDT--EIEYMMELL-DPALLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLNSE--TRDTLKQWHKRRTTNRSIPSIDDFQNYLRVALQEADSGCTGKTLIVKPYTTTEDVCHMCAKRFGIQDPENYGLFLYIDDTWQQLSEDTYPQKIKAELHSRPQLQVFHFVYKR 859          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: rin2 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:100144744])

HSP 1 Score: 92.0485 bits (227), Expect = 2.738e-18
Identity = 89/366 (24.32%), Postives = 174/366 (47.54%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVN---VIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     +  +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL S++  +L      + + + + + ++   +  P +LG+   +   +D  ++ ++ KFL M K YSPE+K+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC +  I T  E+EY+  L+    L+ GE G+YL +   +L  IK     +     A  L N+E    +    + K   +  S  ++        + L E  +    KT  V+   T  ++C+  A R GI +P+ Y L+ Y  +    L E  YP  IK + + +   +  +F++KR
Sbjct:  531 ECHVSSTDM-----LHTIRQFMTQVKNYLAQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKSHIESMLKEFRVADGSWRQLKENLQLVRQRSPQELGVLTPTPESMD--IEKMRIKFLNMQKMYSPERKVMLLLRVCKL-------IYTCMENNSGRM-YGADDFLPVLTYVIAQCDMLEIDT--EIEYMMELL-DPALLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLNSE--TRDTLKQWHKRRTTNRSIPSIDDFQNYLRVALQEADSGCTGKTLIVKPYTTTEDVCHMCAKRFGIQDPENYGLFLYIDDTWQQLSEDTYPQKIKAELHSRPQLQVFHFVYKR 861          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 67.3958 bits (163), Expect = 1.149e-10
Identity = 76/303 (25.08%), Postives = 142/303 (46.86%), Query Frame = 1
Query: 2128 FESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLF 3036
             E+I+E+ L K V+KPL S +   L   H K+ +L+L+ +          T LG+  S   I  S ++ I +KF  M K YSPEKK+++++   ++       IY    + S      +D  LP+L+Y+ ++C +  +    +VEY+  L+    L  GE  +YL     +LE IK   + ++    +V+++++    I+       +N + +S +++     I  +E  ++  ++T  ++    V  L    A +  +  P+ Y LY       + L +   P  IK     K+ + L+F F
Sbjct:  733 IEAIVEAALCKCVLKPLKSPIEGYLREIHTKDGSLRLLKENQIVIQDITTTDLGVTTSVPEI--SVMEKITQKFSVMHKTYSPEKKVSYLLKACKM-------IYDSMATGSPGKLHGADDFLPVLMYVLARCDLTELLQ--DVEYMMELM-DPALQLGEGSYYLTTTYGALEHIKNYDKITVTRQLSVEVQDS----IHRWERRRTLNKARVSRSSIQDFITISFEELDSK--SRTLVIKPDTNVELLLQDCAEKFQVLEPQNYGLYVQVNERSLRLADDALPHHIKSNL-LKSEQKLDFHF 1016          

HSP 2 Score: 58.5362 bits (140), Expect = 7.233e-8
Identity = 44/149 (29.53%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  286 TAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVL-----SYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            T    H P  I+   RL KT  +W+Q          IL +   G+F+I  + + K MVL     S K +  V    IK + +   Y++ S  +F+ + +++A Y V    S D+L   LKLP+A+  A      + F NL + FW ++ 
Sbjct:   30 TENNCHVPSGISVLDRLIKTCPVWLQLCMNPEQAVDILKKEGPGVFLITRDVERKCMVLWVHVTSNKEQADVLRYNIKEE-KTMMYLESSVLVFEDIFKLVAFYCV----SRDVLPFPLKLPQAIAAAQTYKELETFSNLGTGFWDSAF 173          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 65.4698 bits (158), Expect = 4.362e-10
Identity = 76/303 (25.08%), Postives = 142/303 (46.86%), Query Frame = 1
Query: 2128 FESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLF 3036
             E+I+E+ L K V+KPL S +   L   H K+ +L+L+ +          T LG+  S   I  S ++ I +KF  M K YSPEKK+++++   ++       IY    + S      +D  LP+L+Y+ ++C +  +    +VEY+  L+    L  GE  +YL     +LE IK   + ++    +V+++++    I+       +N + +S +++     I  +E  ++  ++T  ++    V  L    A +  +  P+ Y LY       + L +   P  IK     K+ + L+F F
Sbjct:  686 IEAIVEAALCKCVLKPLKSPIEGYLREIHTKDGSLRLLKENQIVIQDITTTDLGVTTSVPEI--SVMEKITQKFSVMHKTYSPEKKVSYLLKACKM-------IYDSMATGSPGKLHGADDFLPVLMYVLARCDLTELLQ--DVEYMMELM-DPALQLGEGSYYLTTTYGALEHIKNYDKITVTRQLSVEVQDS----IHRWERRRTLNKARVSRSSIQDFITISFEELDSK--SRTLVIKPDTNVELLLQDCAEKFQVLEPQNYGLYVQVNERSLRLADDALPHHIKSNL-LKSEQKLDFHF 969          

HSP 2 Score: 61.6178 bits (148), Expect = 8.320e-9
Identity = 43/151 (28.48%), Postives = 74/151 (49.01%), Query Frame = 1
Query:  286 TAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVL-SYKTEDRVQHVKIKVDLRRGF------YMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            T    H P  I+   RL KT  +W+Q          IL +   G+F+I  + + K MVL  + T ++ Q  +I +++ + F      Y++ S  +F+ + +++A Y V    S D+L   LKLP+A+  A      + F NL + FW ++ 
Sbjct:   18 TENNCHVPSGISVLDRLIKTCPVWLQLCMNPEQAVDILKKEGPGVFLITRDVERKCMVLWVHVTSNKEQLTRIWLNIVKLFLFPLVMYLESSVLVFEDIFKLVAFYCV----SRDVLPFPLKLPQAIAAAQTYKELETFSNLGTGFWDSAF 164          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 65.4698 bits (158), Expect = 4.729e-10
Identity = 76/303 (25.08%), Postives = 142/303 (46.86%), Query Frame = 1
Query: 2128 FESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLF 3036
             E+I+E+ L K V+KPL S +   L   H K+ +L+L+ +          T LG+  S   I  S ++ I +KF  M K YSPEKK+++++   ++       IY    + S      +D  LP+L+Y+ ++C +  +    +VEY+  L+    L  GE  +YL     +LE IK   + ++    +V+++++    I+       +N + +S +++     I  +E  ++  ++T  ++    V  L    A +  +  P+ Y LY       + L +   P  IK     K+ + L+F F
Sbjct:  675 IEAIVEAALCKCVLKPLKSPIEGYLREIHTKDGSLRLLKENQIVIQDITTTDLGVTTSVPEI--SVMEKITQKFSVMHKTYSPEKKVSYLLKACKM-------IYDSMATGSPGKLHGADDFLPVLMYVLARCDLTELLQ--DVEYMMELM-DPALQLGEGSYYLTTTYGALEHIKNYDKITVTRQLSVEVQDS----IHRWERRRTLNKARVSRSSIQDFITISFEELDSK--SRTLVIKPDTNVELLLQDCAEKFQVLEPQNYGLYVQVNERSLRLADDALPHHIKSNL-LKSEQKLDFHF 958          

HSP 2 Score: 59.3066 bits (142), Expect = 3.889e-8
Identity = 44/149 (29.53%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  286 TAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVL-----SYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            T    H P  I+   RL KT  +W+Q          IL +   G+F+I  + + K MVL     S K +  V    IK + +   Y++ S  +F+ + +++A Y V    S D+L   LKLP+A+  A      + F NL + FW ++ 
Sbjct:   28 TENNCHVPSGISVLDRLIKTCPVWLQLCMNPEQAVDILKKEGPGVFLITRDVERKCMVLWVHVTSNKEQADVLRYNIKEE-KTMMYLESSVLVFEDIFKLVAFYCV----SRDVLPFPLKLPQAIAAAQTYKELETFSNLGTGFWDSAF 171          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Rin2 (Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MGI:1921280])

HSP 1 Score: 87.0409 bits (214), Expect = 8.224e-17
Identity = 86/364 (23.63%), Postives = 175/364 (48.08%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     ++ +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +  +++  ++ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  509 ECHVSSTDM-----LQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKGHVEAMLKDFHTADGSWKQLKENLQLVRQRNPQELGVFAPTPDLME--LEKIKLKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSEARDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQLCAEKFKVEDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 839          

HSP 2 Score: 51.6026 bits (122), Expect = 5.490e-6
Identity = 37/138 (26.81%), Postives = 63/138 (45.65%), Query Frame = 1
Query:  331 RLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRG---FYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSLPNKSID 726
            RL  T  IW+Q   +  +  ++L     GIF++R +S  +  VLS +          +  ++     F ++GS   F  +  +IA Y +    S D+L   LKLP A+  A   +  +    L  +FW +S  NK ++
Sbjct:   44 RLLHTHPIWLQLSLSEEEAAEVLQAQPPGIFLVRKSSKMQKKVLSLRLPCEFGAPLKEFTIKESTYTFSLEGSGISFADLFRLIAFYCI----SRDVLPFTLKLPYAISTAKTESQLEELAQLGLNFWSSSADNKPLN 177          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Rin2 (Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MGI:1921280])

HSP 1 Score: 87.0409 bits (214), Expect = 8.316e-17
Identity = 86/364 (23.63%), Postives = 175/364 (48.08%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     ++ +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +  +++  ++ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  554 ECHVSSTDM-----LQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKGHVEAMLKDFHTADGSWKQLKENLQLVRQRNPQELGVFAPTPDLME--LEKIKLKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSEARDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQLCAEKFKVEDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 884          

HSP 2 Score: 51.6026 bits (122), Expect = 7.070e-6
Identity = 37/138 (26.81%), Postives = 63/138 (45.65%), Query Frame = 1
Query:  331 RLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRG---FYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSLPNKSID 726
            RL  T  IW+Q   +  +  ++L     GIF++R +S  +  VLS +          +  ++     F ++GS   F  +  +IA Y +    S D+L   LKLP A+  A   +  +    L  +FW +S  NK ++
Sbjct:   89 RLLHTHPIWLQLSLSEEEAAEVLQAQPPGIFLVRKSSKMQKKVLSLRLPCEFGAPLKEFTIKESTYTFSLEGSGISFADLFRLIAFYCI----SRDVLPFTLKLPYAISTAKTESQLEELAQLGLNFWSSSADNKPLN 222          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Rin3 (Ras and Rab interactor 3 [Source:MGI Symbol;Acc:MGI:2385708])

HSP 1 Score: 62.7734 bits (151), Expect = 2.407e-9
Identity = 43/147 (29.25%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  316 INNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY------KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDE 729
            I+  ++L KT  +W+Q    + +  KIL +   G+F++  +++ K +VL         +   V    IK + +   Y++GS  +F+ +  +IA Y V    S DLL   L+LP+A+ EAS     +   NL   FW +SL ++   E
Sbjct:   50 ISVLEKLVKTCPVWLQLGLGQAEAAKILQQEMAGMFLVCRDNNLKQLVLCVHFPSLKGSSAEVLEYPIKEE-KAILYLEGSVLVFEDIFRLIAFYCV----SRDLLPFTLRLPQAILEASSFLELETISNLGLGFWDSSLNSRGSAE 191          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Rin3 (Ras and Rab interactor 3 [Source:MGI Symbol;Acc:MGI:2385708])

HSP 1 Score: 54.6842 bits (130), Expect = 9.306e-8
Identity = 38/131 (29.01%), Postives = 66/131 (50.38%), Query Frame = 1
Query:  316 INNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY------KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENL 681
            I+  ++L KT  +W+Q    + +  KIL +   G+F++  +++ K +VL         +   V    IK + +   Y++GS  +F+ +  +IA Y V    S DLL   L+LP+A+ EAS     +   NL
Sbjct:   50 ISVLEKLVKTCPVWLQLGLGQAEAAKILQQEMAGMFLVCRDNNLKQLVLCVHFPSLKGSSAEVLEYPIKEE-KAILYLEGSVLVFEDIFRLIAFYCV----SRDLLPFTLRLPQAILEASSFLELETISNL 175          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8MQW8|SPRI_DROME (Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3)

HSP 1 Score: 148.288 bits (373), Expect = 1.433e-34
Identity = 104/400 (26.00%), Postives = 199/400 (49.75%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKV-LGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPS 3069
            G S+R Y +QL ++   S  + ++  FI CT E  + +P   MR MRQ+MSG+KN ++K  + +F   + +E  R +   + F+N ++++E+V+ + VV PL  ++Y + V  + ++ +++L++  V  A + E    G+  +      + ++LI     ++ +   P       +  +E+   ++ +++  T     +    +D  LP+LVY+ ++C    +  + E E++ GL+   TL++GEPG+YL  + S+++ +K  +     + + ++D R                  S+   A    + VII DE    L T+T PVR   T   +C  IAH+  I NP++Y L+K    +E LL + E P   +   +   G+     +KR +A    P+
Sbjct: 1419 GDSLRAYTLQL-AQDPSSTFARNIENFICCTKESREAAPQVVMRNMRQFMSGMKNYLVKHGEGKFH--AELETARARLKSDEFLNLDAMLETVMHQLVVLPLREHLYGIFVDHYQRSEDIQLLAQNVRYACEREAADFGIRPTVTPPSQAALRLIANLLWRLQEAELP-------LDKLELFLCVISTVFDATGCPRGQQ-LGADDFLPVLVYVVAKCGF--VGAEIEAEFMWGLL-QPTLLNGEPGYYLTALCSAVQVLKTFMASEGESGSGSLDWR------------------SSCLPACSSVLRVIIPDECNGSLQTRTLPVRPHTTTREVCRIIAHKARITNPQDYALFKLVDGEETLLTDAECPQDARLAAK---GKHCMLAYKRIDAKIAWPT 1783          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WYP3|RIN2_HUMAN (Ras and Rab interactor 2 OS=Homo sapiens OX=9606 GN=RIN2 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.572e-17
Identity = 88/364 (24.18%), Postives = 174/364 (47.80%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     ++ +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +   +D  V+ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  545 ECHVSSTDM-----LQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKGHVEAMLKDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDFVD--VEKIKVKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSETRDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 875          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D684|RIN2_MOUSE (Ras and Rab interactor 2 OS=Mus musculus OX=10090 GN=Rin2 PE=1 SV=3)

HSP 1 Score: 87.0409 bits (214), Expect = 5.817e-16
Identity = 86/364 (23.63%), Postives = 175/364 (48.08%), Query Frame = 1
Query: 1960 QCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVT-KTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            +C +  TD+     ++ +RQ+M+ +KN + Q    +  + S+I E++           + ++E  + K ++KPL  +V  +L   H  + + K + + ++   +  P +LG+   +  +++  ++ I+ KF+ M K YSPEKK+  ++ + ++       IY    ++S R  + +D  LP+L Y+ +QC  D +    E+EY+  L+   +L+ GE G+YL +   +L  IK     +     A  L ++E           +    T+ +       + +  +++N   T KT  VR  +T  ++C   A +  + +P+EY+L+ +       L E  YP  IK + + +      +F++KR
Sbjct:  554 ECHVSSTDM-----LQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQ----------IDVVLEKAMHKCILKPLKGHVEAMLKDFHTADGSWKQLKENLQLVRQRNPQELGVFAPTPDLME--LEKIKLKFMTMQKMYSPEKKVMLLLRVCKL-------IYTVMENNSGRM-YGADDFLPVLTYVIAQC--DMLELDTEIEYMMELL-DPSLLHGEGGYYLTSAYGALSLIK-----NFQEEQAARLLSSEARDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQLCAEKFKVEDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKR 884          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TB24|RIN3_HUMAN (Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4)

HSP 1 Score: 71.633 bits (174), Expect = 2.897e-11
Identity = 46/140 (32.86%), Postives = 76/140 (54.29%), Query Frame = 1
Query:  316 INNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY------KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            I+  ++L KT  +W+Q    + +V +IL+    G+F++R +S SK +VL        ++   V    IK + +   Y++GS+ +F+ +  +IA Y V    S DLL   L+LP+A+ EAS  T  +   NL   FW +SL
Sbjct:   50 ISILEKLIKTCPVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE-KSILYLEGSALVFEDIFRLIAFYCV----SRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSL 184          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|P59729|RIN3_MOUSE (Ras and Rab interactor 3 OS=Mus musculus OX=10090 GN=Rin3 PE=1 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 1.684e-8
Identity = 43/147 (29.25%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  316 INNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY------KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDE 729
            I+  ++L KT  +W+Q    + +  KIL +   G+F++  +++ K +VL         +   V    IK + +   Y++GS  +F+ +  +IA Y V    S DLL   L+LP+A+ EAS     +   NL   FW +SL ++   E
Sbjct:   50 ISVLEKLVKTCPVWLQLGLGQAEAAKILQQEMAGMFLVCRDNNLKQLVLCVHFPSLKGSSAEVLEYPIKEE-KAILYLEGSVLVFEDIFRLIAFYCV----SRDLLPFTLRLPQAILEASSFLELETISNLGLGFWDSSLNSRGSAE 191          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A1Z5L0X4 (Uncharacterized protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 7.771e-45
Identity = 118/408 (28.92%), Postives = 213/408 (52.21%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRND-----FKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKI----NNSAFFSKINPSTLSAAAV-GSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G +IRKY+ +L   + ++  + ++  FIQCT+E ++ SP   MR +RQ+M+G+KN ++K  + +F  L  ++EE+ K   + F+N +++IE  L + V++PL  Y+Y+L V  + +  +LKL+SD ++ A    P  LG+ K         +++++    ++ + YSP       +  +E +   + +IY     D    D       +D  LPI +Y+  QC +  +S + E EY+ GL+  S L+ GE G+YL  + S++  +K L  P++  +         P K+    ++   +  +     S A + G + ++I +E    +V KT PVR  +T   +C  IAH+  + NP++Y+L+K    +E  L + E P TIK      +G    F +KR +  F+ P
Sbjct:   35 GVNIRKYIFKLVEER-NTTFAMTIENFIQCTLESSEASPVIVMRNIRQFMNGMKNYLLKHGEGQFEQL--VQEEQAKLKPHEFMNIDAVIEEALHRLVIRPLKQYLYQLFVNHYTETGSLKLLSDNIKYARTRTPEDLGIRKDYQPPQGISLEVVKYFLSRLQQSYSP-------LKKLENLLAAISTIYNSVQKDVGSRDSDNLSLGADDFLPIFIYVLVQCGL--VSAEVEAEYMWGLLHQS-LLTGEGGYYLTTLSSAVHILKNLRSPTVATSPPSSPMAVTPSKLLVRSSDCKLYKNVEIRYPSIADLQGFMQIVIPNEVSGSVVAKTLPVRPNMTTKEVCKMIAHKFQVTNPQDYSLFKLVNGEETPLGDNECPQTIKGDL-MTSGTDCRFAYKRCDMKFVWP 428          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A293M1F9 (RAB GDP/GTP exchange factor (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.347e-43
Identity = 122/415 (29.40%), Postives = 217/415 (52.29%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRND-----FKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSIN---PTDAVDLRNNE-PIKINNSAFFSKINPSTLSAAA--VGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPSLIQER 3084
            G +IRKY+ +L   + ++  + ++  FIQCT E ++ SP   MR +RQ+M+G+KN ++K  + +F  L  ++EE+ K   + F+N +++IE  L + V++PL  Y+Y+L V  + K  +LKL+SD ++ A    P  LG+ K         +++++    ++ + YSP       +  +E +   + +IY     D    D       +D  LPI +Y+  QC V  IS + E EY+ GL+  S L+ GE G+YL  + S++  +K L   ++    P+  V L + +  +   +   +    P    + A   G + ++I DE    +V KT PVR  +T   +C  IAH+  + NP++Y+L+K    +E+ L + E P TIK      +G    F +KR +  F+ P + +++
Sbjct:  826 GVNIRKYIFKLVEER-NTTFAKTIENFIQCTQESSETSPAVVMRNVRQFMTGMKNYLLKHGEGQFEQL--VQEEQTKLKPHEFMNIDAVIEEALHRLVIRPLKQYLYQLFVNHYTKTGSLKLLSDNIKYARTKTPEDLGIRKDYQPPQGISLEVVKYFLSKLQQSYSP-------LKKMENLLAAISTIYNSVQKDMQSRDTDSLSLGADDFLPIFIYVLVQCGV--ISAEVEAEYMWGLLHPS-LLTGEGGYYLTTLSSAVHVLKNLRSTTLTADPPSSPVALTSPKLLVGSGDCKLYKDGTPIRYPSIADLQGFMQIVIPDEVSGSIVAKTLPVRPNMTTKEVCKMIAHKFQVTNPQDYSLFKLVNGEEMQLGDNECPQTIKADL-ITSGADCRFAYKRCDMKFVWPCIDKQQ 1226          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A2R5L7T3 (Putative ras effector rin1 (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 9.286e-43
Identity = 124/404 (30.69%), Postives = 218/404 (53.96%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSIN---PTDAVDLRNNEPIKINNSA-FFSKINPSTLSAAA--VGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G +IRKY+ +L   + ++  + ++  FIQCT E ++ SP   MR +RQ+MSG+KN ++K  + +F  L  ++EE+ +   + F+N +++IE  L + V++PL  Y+Y+L V    K  +LKL+SD ++ A    P  LG+ K         +++++    ++ + YSP KK+ ++++ I  I+  V+       SDS+     +D  LPI +Y+  QC +  IS + E EY+ GL+  S L+ GE G+YL  + S++  +K L  P+I    P+    L +++ +       ++   +P      A   G + ++I +E    +V KT PVR  +T   +C  IAH+  + NP++Y+L+K    +E  L + E P TIK      +G    F +KR +  F+ P
Sbjct:  597 GVNIRKYIFKLVEER-NTTFAMTIENFIQCTQESSETSPAVVMRNIRQFMSGMKNYLLKHGEGQFEQL--VQEEQTRLKPHEFMNIDAVIEEALHRLVIRPLKQYLYQLFVNHFTKTGSLKLLSDNIKYARTKTPEDLGIGKDYQPPQGISLEVVKYFLSRLQQSYSPLKKLENLLAAISTIYNSVQKDTQSRESDSL--SLGADDFLPIFIYVLVQCGL--ISAEIEAEYMWGLLHPS-LLTGEGGYYLTTLSSAVHILKNLHSPTIASPPPSAPKALASSKLLACGGDCKWYKSADPIRYPTIADLQGFMQIVIPNEVSGSVVAKTLPVRPNMTTKEVCKMIAHKFQVTNPQDYSLFKLVNGEETQLGDNECPQTIKADL-ITSGTDCRFAYKRCDMKFVWP 991          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A1Z5L5V2 (Actin (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.928e-42
Identity = 118/408 (28.92%), Postives = 213/408 (52.21%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRND-----FKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKI----NNSAFFSKINPSTLSAAAV-GSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G +IRKY+ +L   + ++  + ++  FIQCT+E ++ SP   MR +RQ+M+G+KN ++K  + +F  L  ++EE+ K   + F+N +++IE  L + V++PL  Y+Y+L V  + +  +LKL+SD ++ A    P  LG+ K         +++++    ++ + YSP       +  +E +   + +IY     D    D       +D  LPI +Y+  QC +  +S + E EY+ GL+  S L+ GE G+YL  + S++  +K L  P++  +         P K+    ++   +  +     S A + G + ++I +E    +V KT PVR  +T   +C  IAH+  + NP++Y+L+K    +E  L + E P TIK      +G    F +KR +  F+ P
Sbjct:  528 GVNIRKYIFKLVEER-NTTFAMTIENFIQCTLESSEASPVIVMRNIRQFMNGMKNYLLKHGEGQFEQL--VQEEQAKLKPHEFMNIDAVIEEALHRLVIRPLKQYLYQLFVNHYTETGSLKLLSDNIKYARTRTPEDLGIRKDYQPPQGISLEVVKYFLSRLQQSYSP-------LKKLENLLAAISTIYNSVQKDVGSRDSDNLSLGADDFLPIFIYVLVQCGL--VSAEVEAEYMWGLLHQS-LLTGEGGYYLTTLSSAVHILKNLRSPTVATSPPSSPMAVTPSKLLVRSSDCKLYKNVEIRYPSIADLQGFMQIVIPNEVSGSVVAKTLPVRPNMTTKEVCKMIAHKFQVTNPQDYSLFKLVNGEETPLGDNECPQTIKGDL-MTSGTDCRFAYKRCDMKFVWP 921          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: B7QI18 (RAB GDP/GTP exchange factor, putative OS=Ixodes scapularis OX=6945 GN=8041568 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 9.538e-41
Identity = 121/404 (29.95%), Postives = 211/404 (52.23%), Query Frame = 1
Query: 1876 GQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSD--SMRNDF---KSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDA-VDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILP 3066
            G ++R Y+ +L   + ++  + ++  FIQCT E  + SP   MR +RQ+MSG+KN ++K  + +F  L  ++EE+ K   + F+N ++IIE  L + V+KPL  Y+Y+L V  + K+ +LKL+SD ++ A    P  LG+           ++L+Q    ++ K YSP       +  +E +   + +IY     D  +  N++    +D  LPI +++  QC +  +S + E +Y+ GL+  S L+ GE G+YL  + S++  +K LG  + +P  A V+LR            + ++      A   G + ++I DE    +++KT PV   +T   +C  IAH+  + NP++Y L+K    +E  L + E P TIK      +G    F +KR +  F+ P
Sbjct:  612 GVNVRSYIFKLVQER-NTTFAMTIENFIQCTRESNETSPTVVMRNIRQFMSGMKNYLLKHGEGQFEQL--VQEEQSKLKSDEFMNIDAIIEVSLHRLVIKPLRRYLYQLFVNHYTKSGSLKLLSDNIKYARTKSPQDLGIRAEFEPPRGVSLELVQYFLQKLQKSYSP-------LRKLENLLAAISTIYNSVQKDKKTQENEYFSLGADDFLPIFLHVLVQCGM--VSAEVEADYMWGLLHPS-LLTGEGGYYLTTLSSAVHVLKNLGGGASSPEQAPVELR------------YPRV------ADLQGFMQIVIPDELSGSILSKTLPVMPNMTTKEVCKMIAHKFKVTNPEDYGLFKLVKGEETQLGDNECPQTIKADL-LTSGIECRFAYKRCDIKFVWP 983          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-85n16.4 (ras and Rab interactor 2 [Source:NCBI gene;Acc:103032545])

HSP 1 Score: 73.9442 bits (180), Expect = 6.336e-13
Identity = 92/394 (23.35%), Postives = 171/394 (43.40%), Query Frame = 1
Query: 1891 KYLIQLCSRKGHSDISNSVR---TFIQ----CTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEF--ALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTG-ETLNFLFKR 3042
            +++I++ SR   S   N V+   +F+Q    C     DL     ++ +RQ+M+ +K  + Q  SE    + S+I EE+           ++++E  + K ++KPL   +   L      N   + + + +  A   +P +LG+  +        ++ I++K   M K YSPE+K+  ++ I ++       +Y    + S R  F +D  LP+L Y+  QC +  + T  EV+Y+  L+   +L+ GE G+YL     ++  IK           A  LR+     ++          +  S     +   + L E  +    KT  VR + T   +C   AH+  + +P+ Y L+  T +    L     P  IK  +  +T      F+++R
Sbjct:  396 RHIIEM-SRDKSSYFGNLVQDYMSFVQENHSCHRSSLDL-----LQTIRQFMTQMKAYLTQ-SSEMNPPVQSLIPEEQ----------IDAVLERAMHKCLLKPLHGSLDAALHEFQVSNGEWQRLQENLTLARAKKPRELGVNGAQP-PDHHAIKKIRRKLHSMCKMYSPERKVMALLHICKL-------VYTIMLNHSGRT-FGADEFLPMLTYVLVQCDMPQLDT--EVQYMMELL-DPSLLHGEGGYYLTTAYGAMSLIKNYKEEQA----ACFLRSTTRNTLHQWHQRRTTQKNLPSVEDFQNYLRVALQEADSGCTAKTLQVRPSTTTEEVCRLCAHKFHVIDPENYGLFLLTDDSSQQLAPDTSPQWIKAEFHSQTHTRPFYFVYRR 756          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-85n16.4 (ras and Rab interactor 2 [Source:NCBI gene;Acc:103032545])

HSP 1 Score: 73.1738 bits (178), Expect = 1.100e-12
Identity = 92/394 (23.35%), Postives = 171/394 (43.40%), Query Frame = 1
Query: 1891 KYLIQLCSRKGHSDISNSVR---TFIQ----CTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEF--ALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTG-ETLNFLFKR 3042
            +++I++ SR   S   N V+   +F+Q    C     DL     ++ +RQ+M+ +K  + Q  SE    + S+I EE+           ++++E  + K ++KPL   +   L      N   + + + +  A   +P +LG+  +        ++ I++K   M K YSPE+K+  ++ I ++       +Y    + S R  F +D  LP+L Y+  QC +  + T  EV+Y+  L+   +L+ GE G+YL     ++  IK           A  LR+     ++          +  S     +   + L E  +    KT  VR + T   +C   AH+  + +P+ Y L+  T +    L     P  IK  +  +T      F+++R
Sbjct:  540 RHIIEM-SRDKSSYFGNLVQDYMSFVQENHSCHRSSLDL-----LQTIRQFMTQMKAYLTQ-SSEMNPPVQSLIPEEQ----------IDAVLERAMHKCLLKPLHGSLDAALHEFQVSNGEWQRLQENLTLARAKKPRELGVNGAQP-PDHHAIKKIRRKLHSMCKMYSPERKVMALLHICKL-------VYTIMLNHSGRT-FGADEFLPMLTYVLVQCDMPQLDT--EVQYMMELL-DPSLLHGEGGYYLTTAYGAMSLIKNYKEEQA----ACFLRSTTRNTLHQWHQRRTTQKNLPSVEDFQNYLRVALQEADSGCTAKTLQVRPSTTTEEVCRLCAHKFHVIDPENYGLFLLTDDSSQQLAPDTSPQWIKAEFHSQTHTRPFYFVYRR 900          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: rin2 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:103022367])

HSP 1 Score: 63.929 bits (154), Expect = 8.005e-10
Identity = 75/346 (21.68%), Postives = 153/346 (44.22%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLF 3036
            ++ +RQ+M+ +K+ +++  + +  + S+I E++           + ++E  + K ++KPL   V   L      +   + + + +  A   +P ++G++  ++      ++ I+ KF  M+K YSPEKK++ ++ + ++       IY     +S R  + +D  LP+L Y+ +QC +  + T  E++Y+  L+  S L  GE G+YL +   ++  IK           + + RN     ++          +T +     +   + L E  +    KT  VR   T   +C   A +  + +P  Y L+  T      L    +P  IK     +  + L F F
Sbjct:  611 LQTLRQFMTQMKSYLLQSSELDPPIESLIPEDQ----------IDQVLEKAMHKCILKPLKPVVEAALHDFEMSSGAWQQLKENLALAKTKQPAEMGVD-GAMPPDPMAIEKIRHKFQNMSKLYSPEKKVSLLLRVCKL-------IYTIMEDNSGRM-YGADDFLPMLTYVLAQCDMPQLDT--EIQYMMELLDPSQL-HGEGGYYLTSAYGAMSLIKNFQEEQAARVLSSETRNT----LHQWHRRRTAQRTTPTVDDFQNYLRVALQEPGSGCTAKTLQVRPYATTEEVCRKCAEKFKVSDPDSYALFLLTEETTQQLAPDTHPQKIKAELHSRP-QVLPFYF 929          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: rin2 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:103022367])

HSP 1 Score: 63.929 bits (154), Expect = 8.723e-10
Identity = 75/346 (21.68%), Postives = 153/346 (44.22%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKN-MIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLF 3036
            ++ +RQ+M+ +K+ +++  + +  + S+I E++           + ++E  + K ++KPL   V   L      +   + + + +  A   +P ++G++  ++      ++ I+ KF  M+K YSPEKK++ ++ + ++       IY     +S R  + +D  LP+L Y+ +QC +  + T  E++Y+  L+  S L  GE G+YL +   ++  IK           + + RN     ++          +T +     +   + L E  +    KT  VR   T   +C   A +  + +P  Y L+  T      L    +P  IK     +  + L F F
Sbjct:  636 LQTLRQFMTQMKSYLLQSSELDPPIESLIPEDQ----------IDQVLEKAMHKCILKPLKPVVEAALHDFEMSSGAWQQLKENLALAKTKQPAEMGVD-GAMPPDPMAIEKIRHKFQNMSKLYSPEKKVSLLLRVCKL-------IYTIMEDNSGRM-YGADDFLPMLTYVLAQCDMPQLDT--EIQYMMELLDPSQL-HGEGGYYLTSAYGAMSLIKNFQEEQAARVLSSETRNT----LHQWHRRRTAQRTTPTVDDFQNYLRVALQEPGSGCTAKTLQVRPYATTEEVCRKCAEKFKVSDPDSYALFLLTEETTQQLAPDTHPQKIKAELHSRP-QVLPFYF 954          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-168d1.3 (Ras and Rab interactor 1 [Source:NCBI gene;Acc:103039050])

HSP 1 Score: 52.7582 bits (125), Expect = 1.894e-6
Identity = 62/273 (22.71%), Postives = 123/273 (45.05%), Query Frame = 1
Query: 2140 IESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSK-VQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIK--INNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGND 2949
            +E  L   V+KPL   + + L+  H ++ +L+  ++ ++   +    +LG+      ++D++ ++  +KK   M + +SP       I  + ++ ++ KS+Y K        D+ S+  LP+L Y+  QC +  +    E EY+  L+  S L  GE G+YL ++ +S+  I+   +P    T  +     E ++         +KI   +          V IL +   R   +T   ++  +V  L    A   G+ +P+ Y L+  TG +
Sbjct:  424 LEKALFGCVLKPLKLQLGQTLLSLHTQDGSLQRFANSLQACQQGTLERLGVRSG---VLDAQGIERAKKKLTLMQRSHSP-------IDKVLLLLQVCKSVY-KAMGSQPGQDYSSEDFLPVLSYVVVQCNIPQL--MLETEYMMELLEPSWLT-GEGGYYLTSVYASVCLIQ--SQPGTPSTSGLTNEARESLREWSRRRGQEAKIQRESQQNQRF----VRILFQNTERSAAQTLHWKAGESVEVLTQTCAGVFGVNDPQHYCLFWRTGGE 676          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002461.1 (pep scaffold:Pmarinus_7.0:GL476414:561132:574898:1 gene:ENSPMAG00000002247.1 transcript:ENSPMAT00000002461.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 2.740e-6
Identity = 67/280 (23.93%), Postives = 117/280 (41.79%), Query Frame = 1
Query: 2131 ESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQ-LIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVL----GRPSINPTDAVDLRNNEPIKINNSAFFSKIN---PSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIF--NPKEYNLYKYT 2940
            + ++E  L K V+KPL   + + L+  H K   +K +           PT+LG+   S+   DS  Q  I+ K   +A  YSP  K+  ++ + ++++  + S      S  +R    +D   P+L Y    C    ++ Q  V+YI  L+ +  L+ GE G+YL ++ ++L  +  L        +       LR     ++ ++A  S  +   P  +S    GS             +TK F  R TVT   +C   A    +     + + LY  T
Sbjct:   73 DDVVEKALYKCVLKPLKPTLEQALMSTHNKQGLVKRLQSNCFWGRSQLPTELGVSP-SVNTPDSATQERIRAKLSDLAASYSPMVKVDSLLKVCKMVYNAMGS------SGEVRG---ADDFFPVLTYSLLHCDCPQLAIQ--VDYIMELL-NPNLMSGESGYYLTSVYAALLMLGSLQEEQATAELTANTQQSLREFRRSRMTSTAQHSTRSQHLPLMVSFRKCGS-------------MTKPFSTRETVTAKEVCQNCATHFEVTADEAESFGLYAVT 326          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-85n16.4 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:101171225])

HSP 1 Score: 65.855 bits (159), Expect = 2.074e-10
Identity = 84/382 (21.99%), Postives = 168/382 (43.98%), Query Frame = 1
Query: 1912 SRKGHSDISNSVRTFIQCTMERTDLSPYTT--MRLMRQYMSGLKNMIKQQKSEF--ALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            SR   S   + V+ +I    E     P     ++ +RQ+M+ +K  ++Q  SE    + S+I E++           + ++E  + K V+KPL   +   L      +   + + + +  A   +P  LG++  ++      ++ I++KFL M K YSPEKK+  ++ + ++       IY     +S R  + +D  LP+L Y+ +QC +  + T  +++Y+  L+   +L+ GE G+YL +   ++  IK           + + RN     ++          S  +     +   + L E  +    KT  V    T   +C+  A++  I +P+ Y L+  T +    L    +P  IK + + +      +F+++R
Sbjct:  626 SRDKSSYFGSLVQDYINFVQENRSCHPSGMDLLQTLRQFMTQMKAYLRQ-TSELDPPIESLIPEDQ----------IDPVLEKAMHKCVLKPLHHVIEVALHDFQVSSGAWRQLWENLALAKTKKPQDLGVD-GAVPPDSVAIEKIRQKFLNMRKMYSPEKKVRLLLRVCKL-------IYTIMQDNSGRM-YGADDFLPMLTYVVAQCNMPRLDT--DIQYMMELL-DPSLLQGEGGYYLTSAYGAMALIKNFQEEQAARVLSSEARNT----LHQWHSRRTAQRSMPTVDDFQNFLRVALQELDSGCTGKTLLVHPYTTTEEVCSLCAYKFKIPDPENYALFLVTQDTSQQLALDTHPQRIKAELHSRPLAHAFHFVYRR 980          

HSP 2 Score: 51.6026 bits (122), Expect = 5.428e-6
Identity = 35/134 (26.12%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  331 RLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY-----KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            RLT+T  +W+    +  + ++IL +   G+F++R ++  +  VLS      + E  + H+ I+ + +  F ++GSS  F  +  ++A Y +    S D+L   LKLP A+  A      +    L + FW ++ 
Sbjct:  128 RLTQTHPVWLLLSVSEEEADRILLKQPPGVFLVRKSAALQRKVLSVHLDEDQAETPINHIPIR-ESQYTFSLEGSSISFADLFRLVAFYCI----SRDVLPFTLKLPEAIVSAKTQKELEEVAQLGAGFWDSAF 256          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-85n16.4 (Ras and Rab interactor 2 [Source:NCBI gene;Acc:101171225])

HSP 1 Score: 65.0846 bits (157), Expect = 3.844e-10
Identity = 82/381 (21.52%), Postives = 167/381 (43.83%), Query Frame = 1
Query: 1912 SRKGHSDISNSVRTFIQCTMERTDLSPYTT--MRLMRQYMSGLKNMIKQQKS-EFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIK-QTYQQKTGETLNFLFKR 3042
            SR   S   + V+ +I    E     P     ++ +RQ+M+ +K  ++Q    +  + S+I E++           + ++E  + K V+KPL   +   L      +   + + + +  A   +P  LG++  ++      ++ I++KFL M K YSPEKK+  ++ + ++       IY     +S R  + +D  LP+L Y+ +QC +  + T  +++Y+  L+   +L+ GE G+YL +   ++  IK           + + RN     ++          S  +     +   + L E  +    KT  V    T   +C+  A++  I +P+ Y L+  T +    L    +P  IK + + +      +F+++R
Sbjct:  617 SRDKSSYFGSLVQDYINFVQENRSCHPSGMDLLQTLRQFMTQMKAYLRQTSELDPPIESLIPEDQ----------IDPVLEKAMHKCVLKPLHHVIEVALHDFQVSSGAWRQLWENLALAKTKKPQDLGVD-GAVPPDSVAIEKIRQKFLNMRKMYSPEKKVRLLLRVCKL-------IYTIMQDNSGRM-YGADDFLPMLTYVVAQCNMPRLDT--DIQYMMELL-DPSLLQGEGGYYLTSAYGAMALIKNFQEEQAARVLSSEARNT----LHQWHSRRTAQRSMPTVDDFQNFLRVALQELDSGCTGKTLLVHPYTTTEEVCSLCAYKFKIPDPENYALFLVTQDTSQQLALDTHPQRIKAELHSRPLAHAFHFVYRR 971          

HSP 2 Score: 51.9878 bits (123), Expect = 4.234e-6
Identity = 35/134 (26.12%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  331 RLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSY-----KTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLL---LKLPRALREASDATHFKFFENLKSDFWKTSL 708
            RLT+T  +W+    +  + ++IL +   G+F++R ++  +  VLS      + E  + H+ I+ + +  F ++GSS  F  +  ++A Y +    S D+L   LKLP A+  A      +    L + FW ++ 
Sbjct:  119 RLTQTHPVWLLLSVSEEEADRILLKQPPGVFLVRKSAALQRKVLSVHLDEDQAETPINHIPIR-ESQYTFSLEGSSISFADLFRLVAFYCI----SRDVLPFTLKLPEAIVSAKTQKELEEVAQLGAGFWDSAF 247          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033324.1 (SH2 domain-containing protein 7-like [Source:NCBI gene;Acc:105358849])

HSP 1 Score: 59.6918 bits (143), Expect = 9.430e-9
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  292 QKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQ 600
            Q++  P+M+++          W Q    R   E +L +   G F+IR++  +   ++SYK  DR +H  I  +    F + G   +F S+NE+I HY V  IQ
Sbjct:   73 QETQAPQMLSDG-----NFPAWFQGLAPRQHAEDLLRDKGVGSFLIRLSDKAIGYIVSYKGHDRCRHFVITQNQHGQFVVAGDCELFGSLNELIDHYRVSPIQ 170          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022356.2 (ras and Rab interactor 3 [Source:NCBI gene;Acc:101162800])

HSP 1 Score: 51.6026 bits (122), Expect = 4.423e-6
Identity = 60/220 (27.27%), Postives = 103/220 (46.82%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVL 2661
            +RLM   M+ LKN + Q     A+L   +  + K         ESI+E+ L K+V+KPL   +Y+ L   H      K ++        S  T LG+  S  +     ++ I  K   + ++YSP++KI  ++   +II+  +   +P            +D  LP+++Y+ ++  + A+  Q +VEY+  L+   TL  GE  +YL     +LE IK  
Sbjct:  605 IRLM---MTQLKNYLLQSSELQAMLEPQQCTQDK--------LESIVEAALCKSVLKPLREPIYKTLEKLHTDAGCTKQLASNQSAILGSTTTALGITTS--VPEAPALEKISIKLNDLHQEYSPQRKIQLLLKTCKIIYDSMSVSHPG-------RAHGADDFLPVMMYVLARSNLSAL--QLDVEYMMELM-DPTLTLGEGSYYLTTTYGALEHIKTF 801          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042520.1 (ras and Rab interactor 3 [Source:NCBI gene;Acc:101162800])

HSP 1 Score: 51.6026 bits (122), Expect = 4.787e-6
Identity = 60/220 (27.27%), Postives = 103/220 (46.82%), Query Frame = 1
Query: 2002 MRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVL 2661
            +RLM   M+ LKN + Q     A+L   +  + K         ESI+E+ L K+V+KPL   +Y+ L   H      K ++        S  T LG+  S  +     ++ I  K   + ++YSP++KI  ++   +II+  +   +P            +D  LP+++Y+ ++  + A+  Q +VEY+  L+   TL  GE  +YL     +LE IK  
Sbjct:  683 IRLM---MTQLKNYLLQSSELQAMLEPQQCTQDK--------LESIVEAALCKSVLKPLREPIYKTLEKLHTDAGCTKQLASNQSAILGSTTTALGITTS--VPEAPALEKISIKLNDLHQEYSPQRKIQLLLKTCKIIYDSMSVSHPG-------RAHGADDFLPVMMYVLARSNLSAL--QLDVEYMMELM-DPTLTLGEGSYYLTTTYGALEHIKTF 879          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000016903.1 (SMESG000016903.1)

HSP 1 Score: 1812.74 bits (4694), Expect = 0.000e+0
Identity = 947/986 (96.04%), Postives = 951/986 (96.45%), Query Frame = 1
Query:  127 MDAIYAETINSFASDLDHIWKDKNKFKHQNIYQERTDGNCSLNRFLLSASSKFTAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDEIFIKTTDTKTSQPCDYNEVNDSELTPPLPPREYHINDLTYIQGLAEIAEIEESVVYNEIVKEEKLKPKREESKDSPNLPDPPINHYSPIWQYTSCTNLGPTPESKSEKKPVFVKSGYPYESLSNDDTRNSNISESFIGDSVRTEMTLISTKEIPYSDVYEKLPFCSPKKDLCLIRDVIKNYYPQIIDTQYTCELENMAFPCLSKDILNKQNENSTVEQLKLENETMPDSDYSLEVAEYDTPWELKNPWISKYIDIEKYEGVKQSEYMEKIIKLDSQSLSVKEKDYSSLQILKSSNESVNIRNLSEXXXXXXXXXXXXXXISYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXTYKSPDSDEXXXXXXXXXXXXXXXXXXKALYGQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEXXXXXXXXXXXXXXXXXXSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPSLIQER 3084
            MDAIYAETINSFASDLDHIWKDKNKFKHQNIYQERTDGNCSLNRFLLSASSKFTAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDEIFIKTTDTKTSQPCDYNEVNDSELTPPLPPREYHINDLTYIQGLAEIAEIEESVVYNEIVKEEKLKPKREESKDSPNLPDPPINHYSPIWQYTSCTNLGPTPESKSEKKPVFVKSGYPYESLSNDDTRNSNISESFIGDSVRTEMTLISTKEIPYSDVYEKLPFCSPKKDLCLIRDVIKNYYPQIIDTQYTCELENMAFPCLSKDILNKQNENSTVEQLKLENETMPDSDYSLEVAEYDTPWELKNPWISKYIDIEKYEGVKQSEYMEKIIKLDSQSLSVKEKDYSSLQILKSSNESVNIRNLSEKNRNSLKLSRKSSLISYT  +DE +  E E     +     +     Y SP             VTSPVYSQSKALYGQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEKKIAHIISIIEIIFKLVKSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPSLIQER
Sbjct:    1 MDAIYAETINSFASDLDHIWKDKNKFKHQNIYQERTDGNCSLNRFLLSASSKFTAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDEIFIKTTDTKTSQPCDYNEVNDSELTPPLPPREYHINDLTYIQGLAEIAEIEESVVYNEIVKEEKLKPKREESKDSPNLPDPPINHYSPIWQYTSCTNLGPTPESKSEKKPVFVKSGYPYESLSNDDTRNSNISESFIGDSVRTEMTLISTKEIPYSDVYEKLPFCSPKKDLCLIRDVIKNYYPQIIDTQYTCELENMAFPCLSKDILNKQNENSTVEQLKLENETMPDSDYSLEVAEYDTPWELKNPWISKYIDIEKYEGVKQSEYMEKIIKLDSQSLSVKEKDYSSLQILKSSNESVNIRNLSEKNRNSLKLSRKSSLISYT--DDEDEYDEKESEEHLQQELLAEIQQVVYSSP-------------VTSPVYSQSKALYGQSIRKYLIQLCSRKGHSDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALLSIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNNNLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSPEKKIAHIISIIEIIFKLVKSIYPKTPSDSMRNDFKSDYLLPILVYIFSQCKVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSINPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRLVTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEYPLTIKQTYQQKTGETLNFLFKRRNAIFILPSLIQER 971          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000016905.1 (SMESG000016905.1)

HSP 1 Score: 174.096 bits (440), Expect = 6.708e-48
Identity = 89/208 (42.79%), Postives = 131/208 (62.98%), Query Frame = 1
Query:  127 MDAIYAETINSFASDLDHIWKDKNKFKHQNIYQERTDGNCSLNRFL----LSASSKFTAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDEIFI 738
            MD ++A+TI + ASD+D  W  K  +   +I+   T  +    R L    +   +    Q +     ++N  RL KT+S+W QP +TR   E IL  FE GIFI+R+NSD+ TMVLSY    +V H+KIKVD ++GF++DGS+ IFK+++ ++ +Y ++ I  PD+ LKLPR L E +  +HFKFFENLKSDFW T +    ++EIF+
Sbjct:    1 MDDLFAKTIKALASDIDRKWNVKKGYDDDDIFL--THAHDLPKRLLPPIPVEKPNPIPQQTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQICQLKLNEIFV 206          
The following BLAST results are available for this feature:
BLAST of FERM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIN27.437e-1824.18Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:H... [more]
RIN27.730e-1824.18Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:H... [more]
RIN21.050e-1625.00Ras and Rab interactor 2 [Source:HGNC Symbol;Acc:H... [more]
AL159141.16.031e-1232.86Ras and Rab interactor 3 [Source:NCBI gene;Acc:798... [more]
AL159141.16.033e-1232.86Ras and Rab interactor 3 [Source:NCBI gene;Acc:798... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rin-15.961e-2423.99RIN (Ras/Rab INteractor) homolog [Source:UniProtK... [more]
rin-16.197e-2423.99RIN (Ras/Rab INteractor) homolog [Source:UniProtK... [more]
rin-12.189e-2323.99RIN (Ras/Rab INteractor) homolog [Source:UniProtK... [more]
rin-13.181e-2323.99RIN (Ras/Rab INteractor) homolog [Source:UniProtK... [more]
rin-13.427e-2323.99RIN (Ras/Rab INteractor) homolog [Source:UniProtK... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spri2.393e-3826.00gene:FBgn0085443 transcript:FBtr0336902[more]
spri1.391e-3726.00gene:FBgn0085443 transcript:FBtr0336903[more]
spri1.962e-3726.00gene:FBgn0085443 transcript:FBtr0112690[more]
spri2.571e-3626.00gene:FBgn0085443 transcript:FBtr0310293[more]
spri3.282e-3626.00gene:FBgn0085443 transcript:FBtr0310438[more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rin31.989e-1425.13Ras and Rab interactor 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
rin21.474e-821.75Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
rin21.474e-821.75Ras and Rab interactor 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
RIN21.330e-721.79si:ch211-85n16.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
RIN22.289e-721.79si:ch211-85n16.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rin22.384e-1824.32Ras and Rab interactor 2 [Source:NCBI gene;Acc:100... [more]
rin22.738e-1824.32Ras and Rab interactor 2 [Source:NCBI gene;Acc:100... [more]
rpn21.149e-1025.08ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
rpn24.362e-1025.08ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
rpn24.729e-1025.08ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rin28.224e-1723.63Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MG... [more]
Rin28.316e-1723.63Ras and Rab interactor 2 [Source:MGI Symbol;Acc:MG... [more]
Rin32.407e-929.25Ras and Rab interactor 3 [Source:MGI Symbol;Acc:MG... [more]
Rin39.306e-829.01Ras and Rab interactor 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MQW8|SPRI_DROME1.433e-3426.00Protein sprint OS=Drosophila melanogaster OX=7227 ... [more]
sp|Q8WYP3|RIN2_HUMAN3.572e-1724.18Ras and Rab interactor 2 OS=Homo sapiens OX=9606 G... [more]
sp|Q9D684|RIN2_MOUSE5.817e-1623.63Ras and Rab interactor 2 OS=Mus musculus OX=10090 ... [more]
sp|Q8TB24|RIN3_HUMAN2.897e-1132.86Ras and Rab interactor 3 OS=Homo sapiens OX=9606 G... [more]
sp|P59729|RIN3_MOUSE1.684e-829.25Ras and Rab interactor 3 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of FERM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z5L0X47.771e-4528.92Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A293M1F91.347e-4329.40RAB GDP/GTP exchange factor (Fragment) OS=Ornithod... [more]
A0A2R5L7T39.286e-4330.69Putative ras effector rin1 (Fragment) OS=Ornithodo... [more]
A0A1Z5L5V22.928e-4228.92Actin (Fragment) OS=Ornithodoros moubata OX=6938 P... [more]
B7QI189.538e-4129.95RAB GDP/GTP exchange factor, putative OS=Ixodes sc... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-85n16.46.336e-1323.35ras and Rab interactor 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-85n16.41.100e-1223.35ras and Rab interactor 2 [Source:NCBI gene;Acc:103... [more]
rin28.005e-1021.68Ras and Rab interactor 2 [Source:NCBI gene;Acc:103... [more]
rin28.723e-1021.68Ras and Rab interactor 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-168d1.31.894e-622.71Ras and Rab interactor 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002461.12.740e-623.93pep scaffold:Pmarinus_7.0:GL476414:561132:574898:1... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-85n16.42.074e-1021.99Ras and Rab interactor 2 [Source:NCBI gene;Acc:101... [more]
si:ch211-85n16.43.844e-1021.52Ras and Rab interactor 2 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000033324.19.430e-930.10SH2 domain-containing protein 7-like [Source:NCBI ... [more]
ENSORLT00000022356.24.423e-627.27ras and Rab interactor 3 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000042520.14.787e-627.27ras and Rab interactor 3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of FERM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016903.10.000e+096.04SMESG000016903.1[more]
SMESG000016905.16.708e-4842.79SMESG000016905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033841 ID=SMED30033841|Name=FERM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3189bp
CCTTTGAATCCTTTTAATCTTTGATTAATTTGAACTTGTCATTACAATTT
CATTTTATGTAATATTCTCTCATATTATTAAATAAAAACTAATAATAATA
AATATATTTTTAAACTTACAACTGAAATGGATGCAATCTATGCTGAGACC
ATAAATTCCTTTGCTTCTGATCTGGATCATATATGGAAGGATAAGAACAA
ATTCAAACATCAAAATATTTATCAAGAAAGGACTGATGGAAATTGTTCGC
TTAATCGCTTCTTATTATCGGCATCGTCGAAATTCACAGCACAGAAATCT
CACAATCCCGAAATGATTAATAATACTCAAAGACTAACTAAAACTTCATC
AATTTGGATTCAACCGGATTTCACACGTTATGACGTGGAAAAAATACTGA
ACGAATTCGAAACAGGGATATTCATAATTCGAGTTAATTCTGACAGTAAA
ACAATGGTGCTTTCTTATAAAACCGAAGACCGAGTCCAGCACGTTAAAAT
AAAAGTTGATCTTAGAAGGGGATTTTACATGGATGGTTCGTCTAATATTT
TTAAAAGCGTTAATGAAATGATTGCTCATTATATGGTACATACAATACAG
TCTCCAGATTTGTTACTAAAACTTCCTAGAGCGTTAAGAGAAGCAAGTGA
TGCAACTCATTTTAAATTTTTTGAAAATTTAAAATCAGATTTTTGGAAAA
CCTCTTTGCCCAATAAAAGTATTGACGAGATATTCATAAAAACTACTGAT
ACTAAAACCAGTCAGCCTTGTGATTACAATGAAGTCAATGATAGTGAACT
GACCCCTCCATTGCCACCTCGTGAGTACCACATTAACGATTTGACATATA
TTCAAGGTCTAGCGGAAATTGCGGAAATAGAAGAAAGTGTTGTTTACAAC
GAAATCGTTAAAGAAGAGAAATTAAAGCCTAAAAGGGAAGAATCCAAAGA
TTCTCCTAATTTACCAGACCCCCCTATAAACCATTATAGTCCTATTTGGC
AATATACATCATGTACCAATCTCGGACCGACTCCAGAATCAAAATCTGAA
AAAAAGCCGGTTTTTGTGAAAAGCGGATATCCTTATGAATCTCTCAGTAA
TGATGACACACGAAATTCTAATATATCAGAATCATTTATTGGTGATTCTG
TAAGAACGGAAATGACTTTGATATCCACAAAGGAAATTCCATACTCGGAC
GTGTACGAAAAGTTACCTTTTTGTTCACCGAAAAAAGATTTGTGTCTAAT
TAGAGATGTAATTAAAAATTATTATCCTCAAATCATTGATACTCAATATA
CTTGTGAACTTGAAAATATGGCATTTCCATGTCTCTCAAAAGACATTCTC
AACAAGCAAAATGAGAATTCGACGGTTGAGCAGCTGAAGTTAGAAAATGA
AACCATGCCGGACTCTGATTATTCTCTTGAAGTTGCAGAATATGACACTC
CTTGGGAACTAAAAAATCCTTGGATTTCCAAATACATTGACATAGAAAAA
TACGAAGGTGTAAAGCAGTCGGAATATATGGAGAAAATTATAAAACTGGA
TAGTCAGTCACTATCTGTGAAGGAAAAAGACTATTCATCTCTACAGATAT
TAAAGTCATCGAATGAATCAGTGAACATTAGGAACCTGTCAGAAAAAAAT
CGGAACTCATTAAAGCTATCAAGAAAGTCCAGTTTAATATCTTACACTGA
CGATGAAGATGAATACGATGAGAAAGAAAGTGAAGAACATTTACAACAAG
AGTTATTGGCAGAAATACAACAAGCCTCTGAGACGTATAAGTCACCCGAC
TCTGATGAAACTCCTAGCATCGTATATTCTTCTCCGGTGACTTCTCCTGT
CTATAGTCAAAGTAAAGCTCTTTATGGTCAGTCGATAAGGAAGTATCTCA
TCCAGCTCTGTTCGAGAAAAGGTCACAGTGACATATCAAATTCGGTCCGA
ACATTCATCCAGTGCACAATGGAGCGAACAGACCTAAGTCCATATACGAC
AATGAGACTGATGCGTCAATATATGTCCGGCTTGAAAAATATGATCAAAC
AACAAAAATCCGAATTTGCATTGCTCTCGATTATAGAAGAAGAAAGAAAA
AAAACTCCGAAAAATGTTTTCATCAATTTCGAGTCGATTATTGAATCAGT
CTTGACGAAAGCCGTTGTGAAGCCGTTGTCGAGTTACGTTTATCGGTTGT
TGGTTCTCGAGCACTATAAGAACAACAATTTGAAACTGATTTCTGATGGA
GTTGAACGAGCGACAAAATCGGAACCCACAAAATTGGGGTTAGAGAAATC
CTCAATATTAATAATCGATTCCAAAGTGCAATTGATCCAGAAAAAGTTTC
TCCAAATGGCCAAGCAATATTCTCCCGAAAAGAAAATTGCTCACATCATT
TCGATTATTGAAATTATTTTTAAACTAGTTAAATCGATTTATCCTAAAAC
TCCATCTGATTCAATGAGAAATGATTTTAAGTCCGATTACCTGTTGCCAA
TATTGGTGTACATATTTTCACAGTGTAAAGTTGATGCCATATCCACACAA
TGCGAGGTTGAGTATATCGAAGGATTGATATGGTCATCAACGTTGGTTGA
TGGAGAACCGGGTTTCTATTTGATGAACATTATGTCGTCTTTGGAAGCCA
TTAAGGTTCTAGGACGACCTTCAATAAATCCAACTGACGCAGTTGATTTA
CGAAATAACGAACCGATTAAAATTAACAACTCAGCATTTTTCTCCAAGAT
AAATCCCTCGACGCTTTCTGCAGCCGCAGTTGGATCAGTCAATGTTATAA
TATTGGATGAAAAACTGAACCGGCTCGTGACGAAAACGTTTCCAGTGCGA
TCAACTGTGACTGTTGGAAATTTATGTAACGCAATCGCTCATAGATTGGG
GATTTTCAATCCTAAAGAATACAATTTATATAAATATACTGGAAATGATG
AAGTGCTCCTTGATGAGTATGAATACCCTCTGACCATCAAGCAAACCTAC
CAACAGAAAACCGGAGAAACATTAAATTTCCTTTTCAAGCGAAGAAACGC
CATATTTATTTTACCGTCTCTCATCCAAGAGAGATAGACGGAATCCAGAG
AATTATTATATAACACATTTTTGATTGCTGATTTATGCTCATTTAATTTT
TGTAACAATATTTTTATATTAAAAATTATTGATTTTCAA
back to top

protein sequence of SMED30033841-orf-1

>SMED30033841-orf-1 ID=SMED30033841-orf-1|Name=SMED30033841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=987bp
MDAIYAETINSFASDLDHIWKDKNKFKHQNIYQERTDGNCSLNRFLLSAS
SKFTAQKSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFI
IRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIA
HYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFWKTSLPNKSID
EIFIKTTDTKTSQPCDYNEVNDSELTPPLPPREYHINDLTYIQGLAEIAE
IEESVVYNEIVKEEKLKPKREESKDSPNLPDPPINHYSPIWQYTSCTNLG
PTPESKSEKKPVFVKSGYPYESLSNDDTRNSNISESFIGDSVRTEMTLIS
TKEIPYSDVYEKLPFCSPKKDLCLIRDVIKNYYPQIIDTQYTCELENMAF
PCLSKDILNKQNENSTVEQLKLENETMPDSDYSLEVAEYDTPWELKNPWI
SKYIDIEKYEGVKQSEYMEKIIKLDSQSLSVKEKDYSSLQILKSSNESVN
IRNLSEKNRNSLKLSRKSSLISYTDDEDEYDEKESEEHLQQELLAEIQQA
SETYKSPDSDETPSIVYSSPVTSPVYSQSKALYGQSIRKYLIQLCSRKGH
SDISNSVRTFIQCTMERTDLSPYTTMRLMRQYMSGLKNMIKQQKSEFALL
SIIEEERKKTPKNVFINFESIIESVLTKAVVKPLSSYVYRLLVLEHYKNN
NLKLISDGVERATKSEPTKLGLEKSSILIIDSKVQLIQKKFLQMAKQYSP
EKKIAHIISIIEIIFKLVKSIYPKTPSDSMRNDFKSDYLLPILVYIFSQC
KVDAISTQCEVEYIEGLIWSSTLVDGEPGFYLMNIMSSLEAIKVLGRPSI
NPTDAVDLRNNEPIKINNSAFFSKINPSTLSAAAVGSVNVIILDEKLNRL
VTKTFPVRSTVTVGNLCNAIAHRLGIFNPKEYNLYKYTGNDEVLLDEYEY
PLTIKQTYQQKTGETLNFLFKRRNAIFILPSLIQER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037191VPS9_dom_sf
IPR036860SH2_dom_sf
IPR000980SH2
IPR003123VPS9
IPR000159RA_dom
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0009226nucleotide-sugar biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016491oxidoreductase activity
GO:0050662coenzyme binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 533..553
NoneNo IPR availableCOILSCoilCoilcoord: 405..425
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 888..973
e-value: 5.1E-5
score: 25.4
NoneNo IPR availablePANTHERPTHR23101RAB GDP/GTP EXCHANGE FACTORcoord: 66..947
NoneNo IPR availablePANTHERPTHR23101:SF104PROTEIN SPRINTcoord: 66..947
NoneNo IPR availableCDDcd00173SH2coord: 77..152
e-value: 6.15175E-14
score: 65.9399
NoneNo IPR availableCDDcd01776RA_Rincoord: 885..972
e-value: 3.79289E-16
score: 72.3271
IPR000980SH2 domainSMARTSM00252SH2_5coord: 75..158
e-value: 5.7E-9
score: 45.8
IPR000980SH2 domainPFAMPF00017SH2coord: 77..152
e-value: 5.3E-9
score: 36.1
IPR000980SH2 domainPROSITEPS50001SH2coord: 77..168
score: 13.459
IPR003123VPS9 domainSMARTSM00167vps9_2coord: 733..860
e-value: 1.3E-6
score: 37.9
IPR003123VPS9 domainPFAMPF02204VPS9coord: 736..843
e-value: 1.1E-14
score: 54.5
IPR003123VPS9 domainPROSITEPS51205VPS9coord: 699..851
score: 19.739
IPR037191VPS9 domain superfamilyGENE3DG3DSA:1.20.1050.80coord: 703..864
e-value: 1.2E-15
score: 59.7
IPR037191VPS9 domain superfamilySUPERFAMILYSSF109993VPS9 domaincoord: 601..848
IPR000159Ras-associating (RA) domainPFAMPF00788RAcoord: 895..974
e-value: 3.6E-6
score: 27.5
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 48..178
e-value: 6.9E-16
score: 60.0
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 73..167