Sp5

Overview
NameSp5 (AIZ98420.1)
Smed IDSMED30033839
Length (bp)1336
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sp5 (SMED30033839) t-SNE clustered cells

Violin plots show distribution of expression levels for Sp5 (SMED30033839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sp5 (SMED30033839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sp5 (SMED30033839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cement glandSMED30033839SMESG000023227.1 KP003818.1smed_ncbi_20200123PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30033839SMESG000023227.1 SmedASXL_006379SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30033839SMESG000023227.1 SMED30033839smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30033839SMESG000023227.1 SMED30033839smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30033839SMESG000023227.1 SMED30033839smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30033839SMESG000023227.1 SMED30033839smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30033839SMESG000023227.1 SMED30033839smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30033839SMESG000023227.1 SMED30033839smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30033839SMESG000023227.1 dd_Smed_v4_7824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30033839SMESG000023227.1 dd_Smed_v6_7824_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30033839SMESG000023227.1 Contig49437newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033839SMESG000023227.1 Contig49437uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sp5 vs. Ensembl Human
Match: SP3 (Sp3 transcription factor [Source:HGNC Symbol;Acc:HGNC:11208])

HSP 1 Score: 169.859 bits (429), Expect = 5.665e-46
Identity = 74/106 (69.81%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  507 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 611          
BLAST of Sp5 vs. Ensembl Human
Match: SP3 (Sp3 transcription factor [Source:HGNC Symbol;Acc:HGNC:11208])

HSP 1 Score: 170.629 bits (431), Expect = 7.406e-46
Identity = 74/106 (69.81%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  557 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 661          
BLAST of Sp5 vs. Ensembl Human
Match: SP3 (Sp3 transcription factor [Source:HGNC Symbol;Acc:HGNC:11208])

HSP 1 Score: 170.629 bits (431), Expect = 7.490e-46
Identity = 74/106 (69.81%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  532 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 636          
BLAST of Sp5 vs. Ensembl Human
Match: SP3 (Sp3 transcription factor [Source:HGNC Symbol;Acc:HGNC:11208])

HSP 1 Score: 170.629 bits (431), Expect = 7.946e-46
Identity = 74/106 (69.81%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  532 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 636          
BLAST of Sp5 vs. Ensembl Human
Match: SP3 (Sp3 transcription factor [Source:HGNC Symbol;Acc:HGNC:11208])

HSP 1 Score: 170.629 bits (431), Expect = 1.171e-45
Identity = 74/106 (69.81%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  600 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 704          
BLAST of Sp5 vs. Ensembl Celegans
Match: sptf-3 (SP (Specificity Protein) Transcription Factor [Source:UniProtKB/TrEMBL;Acc:Q9XW26])

HSP 1 Score: 147.517 bits (371), Expect = 1.039e-39
Identity = 69/132 (52.27%), Postives = 92/132 (69.70%), Query Frame = 3
Query:  696 NISTQLNLSSNRANIPQLGQRKCQK---CTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            N    +N+ ++  +I   G  +  K   CTCPNC Q  N + +  G  ++HIC++C+KTYGKTSHL+AH+R H  ++PF C +  C+K FTRSDELQRH RTHTGEKRF C  C K+FMRSDHL KH++TH+
Sbjct:  268 NEDGMMNMGNDYGDINGQGLGEAPKRCACTCPNCLQQNNRQGD--GKSRIHICHLCNKTYGKTSHLRAHLRGHAGNKPFACDWQHCNKKFTRSDELQRHRRTHTGEKRFACNHCGKKFMRSDHLTKHERTHQ 397          
BLAST of Sp5 vs. Ensembl Celegans
Match: sptf-2 (SP (Specificity Protein) Transcription Factor [Source:UniProtKB/TrEMBL;Acc:Q22678])

HSP 1 Score: 115.931 bits (289), Expect = 1.798e-30
Identity = 58/114 (50.88%), Postives = 73/114 (64.04%), Query Frame = 3
Query:  732 ANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKH 1067
            AN     +RKC++CTCPNC      +    G++  H+C +  C KTY KTSHL+AH+R H  DRPFVC +  C K F RSD+L RH RTHT E RF C  C ++F RSDHL +H
Sbjct:   45 ANELTTKRRKCERCTCPNCKA---IKHGDRGSQHTHLCSVPGCGKTYKKTSHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKRTHTKEYRFACKFCIRQFSRSDHLQQH 155          
BLAST of Sp5 vs. Ensembl Celegans
Match: klf-3 (Kruppel-Like Factor (Zinc finger protein) [Source:UniProtKB/TrEMBL;Acc:P91329])

HSP 1 Score: 98.5969 bits (244), Expect = 7.596e-23
Identity = 50/98 (51.02%), Postives = 60/98 (61.22%), Query Frame = 3
Query:  801 NSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGV 1088
            N R   +    VH C    C K Y K+SHLKAH R H+ ++PFVC +  CS  F RSDEL RHMR HTG+K F C LC + F RSDHL+ H K H  +
Sbjct:  212 NKRNPTDKKFVVHACTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRHSTI 309          
BLAST of Sp5 vs. Ensembl Celegans
Match: klf-3 (Kruppel-Like Factor (Zinc finger protein) [Source:UniProtKB/TrEMBL;Acc:P91329])

HSP 1 Score: 98.5969 bits (244), Expect = 7.805e-23
Identity = 50/98 (51.02%), Postives = 60/98 (61.22%), Query Frame = 3
Query:  801 NSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGV 1088
            N R   +    VH C    C K Y K+SHLKAH R H+ ++PFVC +  CS  F RSDEL RHMR HTG+K F C LC + F RSDHL+ H K H  +
Sbjct:  218 NKRNPTDKKFVVHACTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRHSTI 315          
BLAST of Sp5 vs. Ensembl Celegans
Match: klf-2 (Kruppel-Like Factor (Zinc finger protein) [Source:UniProtKB/TrEMBL;Acc:O62259])

HSP 1 Score: 89.7373 bits (221), Expect = 9.111e-20
Identity = 44/86 (51.16%), Postives = 54/86 (62.79%), Query Frame = 3
Query:  831 KVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            +VH C+   C K Y K+SHL AH R H+ ++P+ C +  CS  F RSDEL RH R HTG K F C  C ++F RSDHL  H K HE
Sbjct:  196 RVHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYPCEWPGCSWRFARSDELTRHYRKHTGAKPFACKECSRKFSRSDHLQLHMKRHE 281          

HSP 2 Score: 54.6842 bits (130), Expect = 4.843e-8
Identity = 26/60 (43.33%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  927 CTYHLCSKSFTRSDELQRHMRTHTGEKRFVC--PLCFKRFMRSDHLAKHKKTHEGVDPIV 1100
            C Y  C K +T+S  L  H R H+GEK + C  P C  RF RSD L +H + H G  P  
Sbjct:  200 CFYQGCGKVYTKSSHLTAHERVHSGEKPYPCEWPGCSWRFARSDELTRHYRKHTGAKPFA 259          

HSP 3 Score: 47.7506 bits (112), Expect = 7.560e-6
Identity = 32/117 (27.35%), Postives = 51/117 (43.59%), Query Frame = 3
Query:  717 LSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYI--------CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFM 1043
            + S R +   L + +  KC    C +     ++L   ++VH            C   + ++  L  H R H   +PF C    CS+ F+RSD LQ HM+ H  +++      FK FM
Sbjct:  182 VPSKRRDKATLDRLRVHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYPCEWPGCSWRFARSDELTRHYRKHTGAKPFACK--ECSRKFSRSDHLQLHMKRHETDEQDDGMDDFKDFM 296          
BLAST of Sp5 vs. Ensembl Fly
Match: Spps (gene:FBgn0039169 transcript:FBtr0084565)

HSP 1 Score: 155.221 bits (391), Expect = 1.818e-40
Identity = 76/136 (55.88%), Postives = 92/136 (67.65%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH----EGVDPIVLGTVISKDTNSSIKSPKALN 1160
            CTCPNC  G          K+ HIC+I  CHK YGKTSHL+AH+RWH  +RPFVC++  C K FTRSDELQRH RTHTGEKRF C  C K+FMRSDHL+KH KTH     GV+ I L   I ++T     +PK+++
Sbjct:  722 CTCPNCTDGEKHSDK----KRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFKSRSGVELIELS--IKQETKGG-NAPKSIS 850          
BLAST of Sp5 vs. Ensembl Fly
Match: Sp1 (gene:FBgn0020378 transcript:FBtr0071381)

HSP 1 Score: 151.754 bits (382), Expect = 2.237e-40
Identity = 71/112 (63.39%), Postives = 79/112 (70.54%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGA----KKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGV 1088
            C CPNC +    R    G     K +H C+I  C K YGKTSHLKAH+RWH  +RPFVC +  C K FTRSDELQRH+RTHTGEKRF CP+C KRFMRSDHLAKH KTH G 
Sbjct:  166 CDCPNCQEA--ERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGT 275          
BLAST of Sp5 vs. Ensembl Fly
Match: Spps (gene:FBgn0039169 transcript:FBtr0330382)

HSP 1 Score: 154.836 bits (390), Expect = 2.308e-40
Identity = 76/136 (55.88%), Postives = 93/136 (68.38%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH----EGVDPIVLGTVISKDTNSSIKSPKALN 1160
            CTCPNC  G       +  K+ HIC+I  CHK YGKTSHL+AH+RWH  +RPFVC++  C K FTRSDELQRH RTHTGEKRF C  C K+FMRSDHL+KH KTH     GV+ I L   I ++T     +PK+++
Sbjct:  722 CTCPNCTDGEKH----SDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFKSRSGVELIELS--IKQETKGG-NAPKSIS 850          
BLAST of Sp5 vs. Ensembl Fly
Match: Sp1 (gene:FBgn0020378 transcript:FBtr0273354)

HSP 1 Score: 152.91 bits (385), Expect = 5.040e-40
Identity = 71/112 (63.39%), Postives = 79/112 (70.54%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGA----KKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGV 1088
            C CPNC +    R    G     K +H C+I  C K YGKTSHLKAH+RWH  +RPFVC +  C K FTRSDELQRH+RTHTGEKRF CP+C KRFMRSDHLAKH KTH G 
Sbjct:  361 CDCPNCQEA--ERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGT 470          
BLAST of Sp5 vs. Ensembl Fly
Match: Sp1 (gene:FBgn0020378 transcript:FBtr0331335)

HSP 1 Score: 153.295 bits (386), Expect = 5.139e-40
Identity = 71/112 (63.39%), Postives = 79/112 (70.54%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGA----KKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGV 1088
            C CPNC +    R    G     K +H C+I  C K YGKTSHLKAH+RWH  +RPFVC +  C K FTRSDELQRH+RTHTGEKRF CP+C KRFMRSDHLAKH KTH G 
Sbjct:  361 CDCPNCQEA--ERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGT 470          
BLAST of Sp5 vs. Ensembl Zebrafish
Match: sp3a (sp3a transcription factor [Source:ZFIN;Acc:ZDB-GENE-070410-111])

HSP 1 Score: 169.859 bits (429), Expect = 7.485e-46
Identity = 72/106 (67.92%), Postives = 84/106 (79.25%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G    +N+ G KK H+C+I  C K YGKTSHL+AH+RWH+ +RPFVCT+  C K FTRSDELQRH RTHTGEK+FVC  C KRFMRSDHLAKH KTH+
Sbjct:  512 CTCPNCKEGGGRGSNM-GKKKQHVCHIAGCGKVYGKTSHLRAHLRWHSGERPFVCTWMFCGKRFTRSDELQRHRRTHTGEKKFVCSECSKRFMRSDHLAKHIKTHQ 616          
BLAST of Sp5 vs. Ensembl Zebrafish
Match: sp3a (sp3a transcription factor [Source:ZFIN;Acc:ZDB-GENE-070410-111])

HSP 1 Score: 169.474 bits (428), Expect = 7.619e-46
Identity = 72/106 (67.92%), Postives = 84/106 (79.25%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G    +N+ G KK H+C+I  C K YGKTSHL+AH+RWH+ +RPFVCT+  C K FTRSDELQRH RTHTGEK+FVC  C KRFMRSDHLAKH KTH+
Sbjct:  500 CTCPNCKEGGGRGSNM-GKKKQHVCHIAGCGKVYGKTSHLRAHLRWHSGERPFVCTWMFCGKRFTRSDELQRHRRTHTGEKKFVCSECSKRFMRSDHLAKHIKTHQ 604          
BLAST of Sp5 vs. Ensembl Zebrafish
Match: sp3b (Sp3b transcription factor [Source:ZFIN;Acc:ZDB-GENE-110815-3])

HSP 1 Score: 167.548 bits (423), Expect = 2.460e-45
Identity = 71/106 (66.98%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +    R +  G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C++  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  469 CTCPNCKEA-GGRGSSMGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICSWSYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 573          
BLAST of Sp5 vs. Ensembl Zebrafish
Match: sp3b (Sp3b transcription factor [Source:ZFIN;Acc:ZDB-GENE-110815-3])

HSP 1 Score: 167.548 bits (423), Expect = 2.852e-45
Identity = 71/106 (66.98%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +    R +  G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C++  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  481 CTCPNCKEA-GGRGSSMGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICSWSYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 585          
BLAST of Sp5 vs. Ensembl Zebrafish
Match: sp3b (Sp3b transcription factor [Source:ZFIN;Acc:ZDB-GENE-110815-3])

HSP 1 Score: 166.007 bits (419), Expect = 1.266e-44
Identity = 71/106 (66.98%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +    R +  G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C++  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  493 CTCPNCKEA-GGRGSSMGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICSWSYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 597          
BLAST of Sp5 vs. Ensembl Xenopus
Match: zp3.2 (zona pellucida glycoprotein 3 (sperm receptor), gene 2 [Source:Xenbase;Acc:XB-GENE-1019608])

HSP 1 Score: 171.014 bits (432), Expect = 2.522e-46
Identity = 75/106 (70.75%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC  G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVCT+  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  484 CTCPNCKDGAGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCTWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 588          
BLAST of Sp5 vs. Ensembl Xenopus
Match: zp3.2 (zona pellucida glycoprotein 3 (sperm receptor), gene 2 [Source:Xenbase;Acc:XB-GENE-1019608])

HSP 1 Score: 171.785 bits (434), Expect = 3.139e-46
Identity = 75/106 (70.75%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC  G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVCT+  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  551 CTCPNCKDGAGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCTWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 655          
BLAST of Sp5 vs. Ensembl Xenopus
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:Xenbase;Acc:XB-GENE-485801])

HSP 1 Score: 171.014 bits (432), Expect = 5.699e-46
Identity = 81/147 (55.10%), Postives = 98/147 (66.67%), Query Frame = 3
Query:  741 PQLGQR-KCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE---GVDPIVLGTVISKDTNSSIKSPKALNP 1163
            PQ G+R + + CTCP C +G    +   G KK HIC+I  C K YGKTSHL+AH+RWH  +RPFVCT+  C K FTRSDELQRH RTHTGEK+F+CP C KRFMRSDHL+KH KTH+   G    V  T ++ DT +      A  P
Sbjct:  535 PQPGRRMRREACTCPYCKEGEGRGSGDPGKKKQHICHIPGCGKVYGKTSHLRAHLRWHTGERPFVCTWVFCGKRFTRSDELQRHKRTHTGEKKFICPECPKRFMRSDHLSKHIKTHQNKKGQGGPVAMTTVNLDTGAGSDGSAASTP 681          
BLAST of Sp5 vs. Ensembl Xenopus
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:Xenbase;Acc:XB-GENE-485801])

HSP 1 Score: 170.244 bits (430), Expect = 1.070e-45
Identity = 81/147 (55.10%), Postives = 98/147 (66.67%), Query Frame = 3
Query:  741 PQLGQR-KCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE---GVDPIVLGTVISKDTNSSIKSPKALNP 1163
            PQ G+R + + CTCP C +G    +   G KK HIC+I  C K YGKTSHL+AH+RWH  +RPFVCT+  C K FTRSDELQRH RTHTGEK+F+CP C KRFMRSDHL+KH KTH+   G    V  T ++ DT +      A  P
Sbjct:  554 PQPGRRMRREACTCPYCKEGEGRGSGDPGKKKQHICHIPGCGKVYGKTSHLRAHLRWHTGERPFVCTWVFCGKRFTRSDELQRHKRTHTGEKKFICPECPKRFMRSDHLSKHIKTHQNKKGQGGPVAMTTVNLDTGAGSDGSAASTP 700          
BLAST of Sp5 vs. Ensembl Xenopus
Match: fxr1 (FMR1 autosomal homolog 1 [Source:Xenbase;Acc:XB-GENE-1004708])

HSP 1 Score: 167.162 bits (422), Expect = 1.702e-44
Identity = 76/127 (59.84%), Postives = 88/127 (69.29%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG--VDPIVLGTVISKDTNSSI 1139
            C+CPNC +G     +  G KK HIC+I  C K YGKTSHL+AH+RWH  +RPFVC +  C K FTRSDELQRH RTHTGEKRF CP C KRFMRSDHL+KH KTH+        L  V S D +SS+
Sbjct:  616 CSCPNCREGEGRGNSEPGKKKQHICHIENCGKVYGKTSHLRAHLRWHTGERPFVCNWIFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGDLDSSV 742          
BLAST of Sp5 vs. Ensembl Mouse
Match: Sp3 (trans-acting transcription factor 3 [Source:MGI Symbol;Acc:MGI:1277166])

HSP 1 Score: 170.629 bits (431), Expect = 6.807e-46
Identity = 73/106 (68.87%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  558 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 662          
BLAST of Sp5 vs. Ensembl Mouse
Match: Sp3 (trans-acting transcription factor 3 [Source:MGI Symbol;Acc:MGI:1277166])

HSP 1 Score: 170.244 bits (430), Expect = 1.037e-45
Identity = 73/106 (68.87%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  602 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 706          
BLAST of Sp5 vs. Ensembl Mouse
Match: Sp4 (trans-acting transcription factor 4 [Source:MGI Symbol;Acc:MGI:107595])

HSP 1 Score: 167.162 bits (422), Expect = 1.251e-44
Identity = 73/127 (57.48%), Postives = 89/127 (70.08%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG--VDPIVLGTVISKDTNSSI 1139
            C+CPNC +G    ++  G KK H+C+I  C K YGKTSHL+AH+RWH  +RPF+C +  C K FTRSDELQRH RTHTGEKRF CP C KRFMRSDHL+KH KTH+        L  V S + +SS+
Sbjct:  623 CSCPNCREGEGRGSSEPGKKKQHVCHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSV 749          
BLAST of Sp5 vs. Ensembl Mouse
Match: Sp4 (trans-acting transcription factor 4 [Source:MGI Symbol;Acc:MGI:107595])

HSP 1 Score: 164.851 bits (416), Expect = 8.417e-44
Identity = 74/127 (58.27%), Postives = 88/127 (69.29%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG--VDPIVLGTVISKDTNSSI 1139
            C+CPNC +G  S     G KK H+C+I  C K YGKTSHL+AH+RWH  +RPF+C +  C K FTRSDELQRH RTHTGEKRF CP C KRFMRSDHL+KH KTH+        L  V S + +SS+
Sbjct:  623 CSCPNCREGEGSSEP--GKKKQHVCHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSV 747          
BLAST of Sp5 vs. Ensembl Mouse
Match: Sp1 (trans-acting transcription factor 1 [Source:MGI Symbol;Acc:MGI:98372])

HSP 1 Score: 158.303 bits (399), Expect = 5.659e-43
Identity = 78/156 (50.00%), Postives = 98/156 (62.82%), Query Frame = 3
Query:  675 SVRNSPPNISTQLNL----------------SSNRANI-PQLGQR-KCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            ++ N+P +  TQL L                  N +++ PQ G+R + + CTCP C       +   G KK HIC+I  C K YGKTSHL+AH+RWH  +RPF+C +  C K FTRSDELQRH RTHTGEK+F CP C KRFMRSDHL+KH KTH+
Sbjct:  238 AIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRREACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQ 393          
BLAST of Sp5 vs. UniProt/SwissProt
Match: sp|Q90WR8|SP3_CHICK (Transcription factor Sp3 OS=Gallus gallus OX=9031 GN=SP3 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.484e-45
Identity = 74/106 (69.81%), Postives = 84/106 (79.25%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G    +NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  590 CTCPNCKEGGGRGSNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 694          
BLAST of Sp5 vs. UniProt/SwissProt
Match: sp|Q02447|SP3_HUMAN (Transcription factor Sp3 OS=Homo sapiens OX=9606 GN=SP3 PE=1 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 5.625e-45
Identity = 74/106 (69.81%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  600 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 704          
BLAST of Sp5 vs. UniProt/SwissProt
Match: sp|O70494|SP3_MOUSE (Transcription factor Sp3 OS=Mus musculus OX=10090 GN=Sp3 PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 7.257e-45
Identity = 73/106 (68.87%), Postives = 83/106 (78.30%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G     NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  602 CTCPNCKEGGGRGTNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 706          
BLAST of Sp5 vs. UniProt/SwissProt
Match: sp|Q02446|SP4_HUMAN (Transcription factor Sp4 OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.066e-44
Identity = 75/127 (59.06%), Postives = 89/127 (70.08%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG--VDPIVLGTVISKDTNSSI 1139
            C+CPNC +G    +N  G KK HIC+I  C K YGKTSHL+AH+RWH  +RPF+C +  C K FTRSDELQRH RTHTGEKRF CP C KRFMRSDHL+KH KTH+        L  V S + +SS+
Sbjct:  625 CSCPNCREGEGRGSNEPGKKKQHICHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSV 751          
BLAST of Sp5 vs. UniProt/SwissProt
Match: sp|Q62445|SP4_MOUSE (Transcription factor Sp4 OS=Mus musculus OX=10090 GN=Sp4 PE=2 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 9.924e-44
Identity = 73/127 (57.48%), Postives = 89/127 (70.08%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG--VDPIVLGTVISKDTNSSI 1139
            C+CPNC +G    ++  G KK H+C+I  C K YGKTSHL+AH+RWH  +RPF+C +  C K FTRSDELQRH RTHTGEKRF CP C KRFMRSDHL+KH KTH+        L  V S + +SS+
Sbjct:  623 CSCPNCREGEGRGSSEPGKKKQHVCHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSV 749          
BLAST of Sp5 vs. TrEMBL
Match: A0A0A7NZ65 (Sp5 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 305/305 (100.00%), Postives = 305/305 (100.00%), Query Frame = 3
Query:  273 MNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAXXXXXXXXXXXXXXXARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQ 1187
            MNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAIPNPTNCPTTPIRPIARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQ
Sbjct:    1 MNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAIPNPTNCPTTPIRPIARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQ 305          
BLAST of Sp5 vs. TrEMBL
Match: A0A224AB84 (Sp5 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 303/377 (80.37%), Postives = 334/377 (88.59%), Query Frame = 3
Query:  150 MNSGPAIINIPTSIHVLPSSPGYFSSKSHHLLSGPISPNIDMNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAXXXXXXXXXXXXXXXARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPN-------ISTQ--LNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQNVKKPRLGLSVSNSAMNSPDHH 1253
            MNSGPAIINIPT+IH LP+SPGYFS+KS H+LSGPISPN+D+NYI + TNCS+RF+M+SNDFWQSPEMAALQRTTEKFFVNQSLI+N +NP+       C  TPIRPIARKPCIELPSLIDSK+Q+ L+NSLSS  +EDCVDHFFRRSINCFSS Y LPNL+ACK+F+L+FPS ++ RN+  N       +S Q  + +S NR NIPQ+GQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKS K LN DK YKKQQN+KKPR GLS +NS +NSPDHH
Sbjct:    1 MNSGPAIINIPTTIHGLPNSPGYFSNKSQHILSGPISPNLDLNYIQSHTNCSSRFVMSSNDFWQSPEMAALQRTTEKFFVNQSLISNNSNPNNSITTNICQNTPIRPIARKPCIELPSLIDSKSQIHLLNSLSSRTIEDCVDHFFRRSINCFSSPYTLPNLLACKDFNLEFPSVENTRNNNNNSPNISGLLSHQKPMTISPNRTNIPQIGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSEKTLNSDKTYKKQQNIKKPRPGLSATNSTINSPDHH 377          
BLAST of Sp5 vs. TrEMBL
Match: A0A448XCY8 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS27380 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 3.867e-49
Identity = 89/137 (64.96%), Postives = 98/137 (71.53%), Query Frame = 3
Query:  735 NIPQLGQRKCQKCTCPNCHQGLNSR------------ANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE---G-VDPI 1097
            + P    RKCQKCTCPNC  G NSR              +   +KVHIC IC KTYGKTSHLKAH+RWHN++RPF C Y  C K+FTRSDELQRHMRTHTGEKRF C LC KRFMRSDHL+KHKKTHE   G VDP+
Sbjct:  593 STPLGAGRKCQKCTCPNCEVGRNSRCGPASGSRASAGPGVGPGRKVHICAICGKTYGKTSHLKAHVRWHNDERPFRCVYDFCDKAFTRSDELQRHMRTHTGEKRFACNLCEKRFMRSDHLSKHKKTHELATGLVDPV 729          
BLAST of Sp5 vs. TrEMBL
Match: A0A5E4Q5Z4 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS4920 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 8.204e-46
Identity = 89/175 (50.86%), Postives = 109/175 (62.29%), Query Frame = 3
Query:  753 QRKCQKCTCPNC---HQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQ----NVKKPRLGLSVSNSAMNSPDH 1250
            QR+C KC CPNC     G       +GAK+ H+C++  C K YGKTSHLKAH+RWH  +RPFVC +  C K FTRSDELQRH+RTHTGEKRF C LC KRFMRSDHLAKH KTH                N + KS KA   DK+  +Q      V++P  GL+   +A+ SP++
Sbjct:   75 QRRCAKCRCPNCLTEAAGFGPNYGKDGAKREHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACQLCTKRFMRSDHLAKHVKTH---------------ANGTRKSKKAKEDDKVVIEQTKTSVEVEQPS-GLNSEATAVGSPNY 233          
BLAST of Sp5 vs. TrEMBL
Match: A0A087VHY4 (Transcription factor Sp3 (Fragment) OS=Balearica regulorum gibbericeps OX=100784 GN=N312_05345 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 6.926e-45
Identity = 76/106 (71.70%), Postives = 86/106 (81.13%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            CTCPNC +G   R+NL G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVCT+  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  509 CTCPNCKEGGGRRSNL-GKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCTWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 613          
BLAST of Sp5 vs. Ensembl Cavefish
Match: sp3a (Sp3 transcription factor [Source:NCBI gene;Acc:103031127])

HSP 1 Score: 170.244 bits (430), Expect = 3.327e-46
Identity = 77/128 (60.16%), Postives = 92/128 (71.88%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE---GVDPIVLGTVISKDTNSSI 1139
            CTCPNC +G   R    G KK H+C+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+   G    V+ T+ +  ++ SI
Sbjct:  492 CTCPNCKEG-GGRGTSIGKKKQHVCHIVGCGKVYGKTSHLRAHLRWHSGERPFVCNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPQCSKRFMRSDHLAKHIKTHQNKKGGGGTVVATMDTSASSDSI 618          
BLAST of Sp5 vs. Ensembl Cavefish
Match: sp3a (Sp3 transcription factor [Source:NCBI gene;Acc:103031127])

HSP 1 Score: 170.244 bits (430), Expect = 4.844e-46
Identity = 77/128 (60.16%), Postives = 92/128 (71.88%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE---GVDPIVLGTVISKDTNSSI 1139
            CTCPNC +G   R    G KK H+C+I  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+   G    V+ T+ +  ++ SI
Sbjct:  528 CTCPNCKEG-GGRGTSIGKKKQHVCHIVGCGKVYGKTSHLRAHLRWHSGERPFVCNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPQCSKRFMRSDHLAKHIKTHQNKKGGGGTVVATMDTSASSDSI 654          
BLAST of Sp5 vs. Ensembl Cavefish
Match: sp3b (transcription factor Sp3-like [Source:NCBI gene;Acc:103030342])

HSP 1 Score: 167.162 bits (422), Expect = 3.605e-45
Identity = 71/105 (67.62%), Postives = 82/105 (78.10%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            CTCPNC +    R +  G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPF+C++  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH
Sbjct:  490 CTCPNCKEA-GGRGSGTGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICSWSYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTH 593          
BLAST of Sp5 vs. Ensembl Cavefish
Match: sp5l (transcription factor Sp5-like [Source:NCBI gene;Acc:103042779])

HSP 1 Score: 159.073 bits (401), Expect = 3.287e-44
Identity = 72/112 (64.29%), Postives = 84/112 (75.00%), Query Frame = 3
Query:  756 RKCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG 1085
            R+C++C CPNC     S     G K++HIC+I  C K Y KTSHLKAH+RWH  +RPFVC +  C KSFTRSDELQRH+RTHTGEKRF C  C KRFMRSDHL+KH KTH+G
Sbjct:  236 RRCRRCKCPNCQTSGGSSLEF-GKKRLHICHIPECGKVYKKTSHLKAHLRWHAGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFGCQQCGKRFMRSDHLSKHVKTHQG 346          
BLAST of Sp5 vs. Ensembl Cavefish
Match: sp5a (Sp5 transcription factor [Source:NCBI gene;Acc:103027627])

HSP 1 Score: 155.606 bits (392), Expect = 7.251e-43
Identity = 71/103 (68.93%), Postives = 80/103 (77.67%), Query Frame = 3
Query:  780 PNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            PNC     S  +  G KK H+C+I  C K YGKTSHLKAH+RWH+ +RPFVC +  C KSFTRSDELQRH+RTHTGEKRFVCP C KRFMRSDHLAKH KTH+
Sbjct:  249 PNCQSSSGSGGDEPGKKKQHVCHIPGCGKVYGKTSHLKAHLRWHSGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFVCPDCCKRFMRSDHLAKHVKTHQ 351          
BLAST of Sp5 vs. Ensembl Sea Lamprey
Match: sp4 (sp4 transcription factor [Source:ZFIN;Acc:ZDB-GENE-031202-3])

HSP 1 Score: 157.147 bits (396), Expect = 5.604e-44
Identity = 68/107 (63.55%), Postives = 79/107 (73.83%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLN-GAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            C CPNC  G   R+    G KK H+C+I  C K YGKTSHL+AH+RWH  +RPFVC +  C K FTRSDELQRH RTHTGEK+F CP C KRFMRSDHL+KH +TH+
Sbjct:  271 CACPNCRDGEGRRSGSEPGKKKQHVCHIPGCSKVYGKTSHLRAHLRWHTGERPFVCGWLFCGKRFTRSDELQRHRRTHTGEKKFPCPHCSKRFMRSDHLSKHIRTHQ 377          
BLAST of Sp5 vs. Ensembl Sea Lamprey
Match: sp4 (sp4 transcription factor [Source:ZFIN;Acc:ZDB-GENE-031202-3])

HSP 1 Score: 157.918 bits (398), Expect = 1.570e-43
Identity = 68/107 (63.55%), Postives = 79/107 (73.83%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLN-GAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            C CPNC  G   R+    G KK H+C+I  C K YGKTSHL+AH+RWH  +RPFVC +  C K FTRSDELQRH RTHTGEK+F CP C KRFMRSDHL+KH +TH+
Sbjct:  315 CACPNCRDGEGRRSGSEPGKKKQHVCHIPGCSKVYGKTSHLRAHLRWHTGERPFVCGWLFCGKRFTRSDELQRHRRTHTGEKKFPCPHCSKRFMRSDHLSKHIRTHQ 421          
BLAST of Sp5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008916.1 (pep scaffold:Pmarinus_7.0:GL476670:39536:47416:-1 gene:ENSPMAG00000008063.1 transcript:ENSPMAT00000008916.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 1.073e-42
Identity = 68/105 (64.76%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            C CPNC           G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVCT+  C K FTRSDELQRH RTHTGEK+F+C  C KRFMRSDHL+KH KTH
Sbjct:  564 CMCPNCRDSEGKVTGEAGQKKQHICHITGCSKVYGKTSHLRAHLRWHSGERPFVCTWLHCGKRFTRSDELQRHKRTHTGEKKFICSECSKRFMRSDHLSKHMKTH 668          
BLAST of Sp5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000432.1 (pep scaffold:Pmarinus_7.0:GL477956:42837:43256:-1 gene:ENSPMAG00000000389.1 transcript:ENSPMAT00000000432.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 5.408e-39
Identity = 61/116 (52.59%), Postives = 81/116 (69.83%), Query Frame = 3
Query:  738 IPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            + Q   R+C +C CPNC    N+    + +++ H C++  C K YGKTSHL+AH+RWH  +RP+ C + LC++ FTRSDEL+RH RTHTGE+RF C  C KRF RSDHL KH +TH
Sbjct:    5 LAQPSTRRCHRCRCPNCQTASNTATISSSSRRQHTCHVSGCGKAYGKTSHLRAHLRWHAGERPYACAWPLCARRFTRSDELRRHARTHTGERRFACVACGKRFARSDHLGKHARTH 120          
BLAST of Sp5 vs. Ensembl Sea Lamprey
Match: KLF10 (Kruppel like factor 10 [Source:HGNC Symbol;Acc:HGNC:11810])

HSP 1 Score: 119.398 bits (298), Expect = 8.823e-30
Identity = 49/86 (56.98%), Postives = 62/86 (72.09%), Query Frame = 3
Query:  828 KKVHIC--YICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            ++ H+C    C KTY K+SHLKAH+R H  ++PF C++  C + F RSDEL RH R HTGEKRF CP C +RF+RSDHLAKH + H
Sbjct:  343 RRTHVCSHQGCGKTYFKSSHLKAHLRTHTGEKPFRCSWEGCERRFARSDELSRHRRAHTGEKRFACPACARRFLRSDHLAKHARRH 428          

HSP 2 Score: 61.6178 bits (148), Expect = 1.525e-10
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  915 RPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPL--CFKRFMRSDHLAKHKKTHEG 1085
            R  VC++  C K++ +S  L+ H+RTHTGEK F C    C +RF RSD L++H++ H G
Sbjct:  344 RTHVCSHQGCGKTYFKSSHLKAHLRTHTGEKPFRCSWEGCERRFARSDELSRHRRAHTG 402          
BLAST of Sp5 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 88.9669 bits (219), Expect = 2.857e-19
Identity = 40/92 (43.48%), Postives = 55/92 (59.78%), Query Frame = 3
Query:  825 AKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIV 1100
            A K H C  CH+ + + +HL+ H+R H   +PFVC Y  C K FT+   L+ H R HTGEK + C +C K+F R  +LA H  TH+ + P V
Sbjct:  589 AVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFV 678          

HSP 2 Score: 46.2098 bits (108), Expect = 9.689e-6
Identity = 23/67 (34.33%), Postives = 37/67 (55.22%), Query Frame = 3
Query:  792 QGLNSRAN--LNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHM 986
            QG N R +  L+  +K + C IC K + +  +L AH+  H   +PFVC    C+K+FT+   ++ H 
Sbjct:  632 QGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          
BLAST of Sp5 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 79.7221 bits (195), Expect = 1.899e-16
Identity = 37/90 (41.11%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  843 CYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCP---------LCFKRFMRSDHLAKHKKTHEG 1085
            C +C K + +  +LK+H+R H N+RPF+C+  +C K+F R  + +RH   HTG+KR+VC           C K+F RSD L +H KT  G
Sbjct:  571 CDVCGKKFTRPYNLKSHLRTHTNERPFICS--ICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG 658          

HSP 2 Score: 53.1434 bits (126), Expect = 6.133e-8
Identity = 25/62 (40.32%), Postives = 33/62 (53.23%), Query Frame = 3
Query:  921 FVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLG 1106
            F C   +C K FTR   L+ H+RTHT E+ F+C +C K F R     +H+  H G    V G
Sbjct:  569 FAC--DVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCG 628          

HSP 3 Score: 47.3654 bits (111), Expect = 3.572e-6
Identity = 25/69 (36.23%), Postives = 33/69 (47.83%), Query Frame = 3
Query:  840 ICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHL-------CSKSFTRSDELQRHMRTHTGEKRFVCPL 1025
            IC IC K + +    K H   H   + +VC   L       C K F RSD L RH +T +G +R + PL
Sbjct:  598 ICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG-RRCITPL 665          
BLAST of Sp5 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 74.3294 bits (181), Expect = 1.259e-14
Identity = 42/111 (37.84%), Postives = 59/111 (53.15%), Query Frame = 3
Query:  768 KCTCPNCHQGLNSRANLNGAKKVHI------CYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            +C   +CH+    R  L    KVH       C  C + +     L  H R H+ ++P+ C  H+C+K F  S  L+ H+RTHTGEK   C +C KRF  S +L+KH KTH+
Sbjct:  739 QCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ 847          

HSP 2 Score: 65.855 bits (159), Expect = 6.277e-12
Identity = 40/133 (30.08%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  732 ANIPQLGQRKCQKCTCPNCHQGLNSRANLNG-AKKVHIC----------YICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPI 1097
            +NIP + Q +   C    C++  +S   LN   + VH+           + CH+T+ +   L  H++ H+  +P+ C    C + F+  + L +H RTH+GEK + C +C K+F  S  L  H +TH G  P+
Sbjct:  694 SNIPPIKQPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPL 824          
BLAST of Sp5 vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 68.9366 bits (167), Expect = 2.750e-13
Identity = 35/106 (33.02%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  843 CYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALN 1160
            C  CH+ + +  H K H+R H  ++P  C +  C KSF+RSDEL+RHMRTHTG+ +       +R  ++    +   T  G+  I  G +I +     + +  A+N
Sbjct:   19 CDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQ-------RRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAIN 117          
BLAST of Sp5 vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 63.929 bits (154), Expect = 2.334e-11
Identity = 29/58 (50.00%), Postives = 44/58 (75.86%), Query Frame = 3
Query:  912 DRPFVCTYHLCSKSFTRSDELQRHMRT-HTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            ++PF C  H+C KSF RS+ L+RH+R+ H+ E+ F C +C K+F RSD+L++H KTH+
Sbjct:  644 EKPFHC--HICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHK 699          

HSP 2 Score: 62.7734 bits (151), Expect = 5.223e-11
Identity = 26/52 (50.00%), Postives = 39/52 (75.00%), Query Frame = 3
Query:  843 CYICHKTYGKTSHLKAHIR-WHNNDRPFVCTYHLCSKSFTRSDELQRHMRTH 995
            C+IC K++ ++ HLK H+R  H+N+RPF C  H+C K F+RSD L +H++TH
Sbjct:  649 CHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICDKKFSRSDNLSQHIKTH 698          
BLAST of Sp5 vs. Ensembl Nematostella
Match: EDO42885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S016])

HSP 1 Score: 156.762 bits (395), Expect = 8.413e-44
Identity = 80/149 (53.69%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  702 STQLNLSSNRANIPQLGQRKCQK--CTCPNCHQGLNSRANLNGA----KKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKD 1124
             T   L S  + +P+  +R   +  C CPNC    N R + +GA    K  HIC+I  C K YGKTSHLKAH+RWH  +RPFVC +  C K FTRSDELQRH+RTHTGEKRF CP+C KRFMRSDHL+KH KTH  + P    +  S+D
Sbjct:  221 GTAAFLQSTPSLVPRTTRRYTGRATCDCPNCQD--NERMSASGAPFRKKSQHICHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPICSKRFMRSDHLSKHVKTHNNITPKKADSEKSED 367          
BLAST of Sp5 vs. Ensembl Nematostella
Match: EDO42941 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S019])

HSP 1 Score: 145.206 bits (365), Expect = 2.263e-42
Identity = 68/105 (64.76%), Postives = 79/105 (75.24%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            CTCPNC  G    AN    +K H+C++  C K YGKTSHL+AH+RWH+ +RPFVC +  C K FTRSDELQRH RTHTGEKRF CP C K+FMRSDHL+KH KTH
Sbjct:   12 CTCPNCRDGEGRTAN---GRKQHVCHVPGCGKVYGKTSHLRAHLRWHSGERPFVCNWLFCGKRFTRSDELQRHRRTHTGEKRFTCPECNKKFMRSDHLSKHVKTH 113          
BLAST of Sp5 vs. Ensembl Nematostella
Match: EDO42939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S017])

HSP 1 Score: 134.035 bits (336), Expect = 1.666e-38
Identity = 62/87 (71.26%), Postives = 71/87 (81.61%), Query Frame = 3
Query:  828 KKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            +K H+C+I  C K YGKTSHLKAH+RWH  +RPFVC +  C KSFTRSDELQRH+RTHTGEKRF C  C KRFMRSDHL KH+KTH+
Sbjct:    5 RKQHVCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFQCDECGKRFMRSDHLRKHQKTHQ 91          
BLAST of Sp5 vs. Ensembl Nematostella
Match: EDO32290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVG8])

HSP 1 Score: 115.931 bits (289), Expect = 1.026e-31
Identity = 56/85 (65.88%), Postives = 64/85 (75.29%), Query Frame = 3
Query:  831 KVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            K H C    C+K YGK+SHLKAH R H  +RPF+CT+  C K F RSDEL RH RTHTGEKR+VC +C KRFMRSDHL+KH KTH
Sbjct:    3 KKHACTYAGCNKIYGKSSHLKAHTRTHTGERPFMCTWKDCEKRFARSDELARHYRTHTGEKRYVCKICDKRFMRSDHLSKHSKTH 87          

HSP 2 Score: 58.5362 bits (140), Expect = 4.015e-11
Identity = 30/61 (49.18%), Postives = 38/61 (62.30%), Query Frame = 3
Query:  924 VCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPL--CFKRFMRSDHLAKHKKTHEGVDPIV 1100
             CTY  C+K + +S  L+ H RTHTGE+ F+C    C KRF RSD LA+H +TH G    V
Sbjct:    6 ACTYAGCNKIYGKSSHLKAHTRTHTGERPFMCTWKDCEKRFARSDELARHYRTHTGEKRYV 66          
BLAST of Sp5 vs. Ensembl Nematostella
Match: EDO42119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C5])

HSP 1 Score: 117.087 bits (292), Expect = 1.123e-31
Identity = 62/117 (52.99%), Postives = 73/117 (62.39%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHL-----CSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIV 1100
            C CPNC  G+NS  +     K H C+   C K YGKTSHLKAH+RWH  +RPFVC +       C KSFTRSDELQRH+RTHT EK   C +C K F RSDHL KH + H+    + 
Sbjct:    4 CACPNCVSGINSNPSPT-HPKYHNCHYPGCGKIYGKTSHLKAHLRWHRGERPFVCNWQTILGSTCGKSFTRSDELQRHLRTHTKEKAHTCHVCGKAFGRSDHLTKHLRIHKAKGQLA 119          
BLAST of Sp5 vs. Ensembl Medaka
Match: SP3 (Sp3 transcription factor [Source:NCBI gene;Acc:101162255])

HSP 1 Score: 168.703 bits (426), Expect = 1.251e-45
Identity = 76/119 (63.87%), Postives = 87/119 (73.11%), Query Frame = 3
Query:  744 QLGQRKCQ----KCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            QLGQ   +     CTCPNC      R +  G KK HIC+I  C K YGKTSHL+AH+RWH+ +RPFVC++  C K FTRSDELQRH RTHTGEK+FVCP C KRFMRSDHLAKH KTH+
Sbjct:  482 QLGQEGKRLRRVACTCPNCKDS-GGRGSGTGKKKQHICHIVGCGKVYGKTSHLRAHLRWHSGERPFVCSWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQ 599          
BLAST of Sp5 vs. Ensembl Medaka
Match: sp5l (transcription factor Sp5 [Source:NCBI gene;Acc:101169109])

HSP 1 Score: 154.836 bits (390), Expect = 1.234e-42
Identity = 70/111 (63.06%), Postives = 83/111 (74.77%), Query Frame = 3
Query:  756 RKCQKCTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            R+C++C CPNC    N      G K++HIC+I  C K Y KTSHLKAH+RWH  +RPF+C +  C KSFTRSDELQRH+RTHTGEKRF C  C KRFMRSDHL+KH KTH+
Sbjct:  235 RRCRRCKCPNCQ--ANGGGLEFGKKRLHICHIPECGKVYKKTSHLKAHLRWHAGERPFICNWLFCGKSFTRSDELQRHLRTHTGEKRFGCQQCGKRFMRSDHLSKHVKTHQ 343          
BLAST of Sp5 vs. Ensembl Medaka
Match: sp4 (Sp4 transcription factor [Source:NCBI gene;Acc:101167131])

HSP 1 Score: 159.844 bits (403), Expect = 2.471e-42
Identity = 68/106 (64.15%), Postives = 78/106 (73.58%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            C+CPNC  G    +     KK HIC++  C K YGKTSHL+AH+RWH  +RPFVC +  C K FTRSDELQRH RTHTGEKRF CP C KRFMRSDHL+KH KTH+
Sbjct:  564 CSCPNCRDGEGRNSGDPTKKKQHICHMEGCGKVYGKTSHLRAHLRWHTGERPFVCNWIFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHIKTHQ 669          
BLAST of Sp5 vs. Ensembl Medaka
Match: sp9 (Sp9 transcription factor [Source:NCBI gene;Acc:101162490])

HSP 1 Score: 155.606 bits (392), Expect = 3.164e-42
Identity = 80/153 (52.29%), Postives = 101/153 (66.01%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGA----KKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKK---QQNVKKP 1202
            C CPNC +    R    GA    K +H C+I  C K YGKTSHLKAH+RWH  +RPFVC +  C K FTRSDELQRH+RTHTGEKRF CP+C KRFMRSDHL+KH KTH        G+    DT S++++P++ +P+ I +    + +VK P
Sbjct:  284 CDCPNCQEA--ERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHTAGGGGKKGSDSDTDT-SNLETPRSESPELILEGVNPRISVKDP 433          
BLAST of Sp5 vs. Ensembl Medaka
Match: sp5a (Sp5 transcription factor [Source:NCBI gene;Acc:101158898])

HSP 1 Score: 152.14 bits (383), Expect = 1.571e-41
Identity = 72/103 (69.90%), Postives = 81/103 (78.64%), Query Frame = 3
Query:  780 PNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHE 1082
            PNC    +S  +  G KK HIC+I  C K YGKTSHLKAH+RWH+ +RPFVC +  C KSFTRSDELQRH+RTHTGEKRFVCP C KRFMRSDHLAKH KTH+
Sbjct:  248 PNCQSSTSS--DEPGKKKQHICHIPGCGKVYGKTSHLKAHLRWHSGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFVCPDCCKRFMRSDHLAKHVKTHQ 348          
BLAST of Sp5 vs. Planmine SMEST
Match: SMESG000023227.1 (SMESG000023227.1)

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 373/373 (100.00%), Postives = 373/373 (100.00%), Query Frame = 3
Query:  150 MNSGPAIINIPTSIHVLPSSPGYFSSKSHHLLSGPISPNIDMNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAXXXXXXXXXXXXXXXARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQNVKKPRLGLSVSNSAMNSPDHHHLHGK 1268
            MNSGPAIINIPTSIHVLPSSPGYFSSKSHHLLSGPISPNIDMNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAIPNPTNCPTTPIRPIARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQNVKKPRLGLSVSNSAMNSPDHHHLHGK
Sbjct:    1 MNSGPAIINIPTSIHVLPSSPGYFSSKSHHLLSGPISPNIDMNYIPNQTNCSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAIPNPTNCPTTPIRPIARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSINCFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQLGQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQNVKKPRLGLSVSNSAMNSPDHHHLHGK 373          
BLAST of Sp5 vs. Planmine SMEST
Match: SMESG000050160.1 (SMESG000050160.1)

HSP 1 Score: 114.005 bits (284), Expect = 4.896e-29
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:  771 CTCPNCHQGLNSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTH 1079
            C+CPNC +  N    L      H C+I  C K Y K SHLKAH+RWH  +RPFVC +  C K F RSDELQ+H++ HT EK+  CP C K F+RS+ L+KH +TH
Sbjct:  114 CSCPNCQEMENLSGYL-SKNNSHNCHIAGCGKLYSKPSHLKAHLRWHTGERPFVCNWLFCGKRFNRSDELQKHLKVHTDEKKLNCPKCGKHFVRSEQLSKHIQTH 217          
BLAST of Sp5 vs. Planmine SMEST
Match: SMESG000025482.1 (SMESG000025482.1)

HSP 1 Score: 106.301 bits (264), Expect = 1.276e-26
Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 3
Query:  852 CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG 1085
            C K Y K+SHLKAHIR H  D+P++C +  C + FTRSDEL RH RTHTGEK F C +C ++F RSDHL+KH KTH+ 
Sbjct:  101 CLKAYYKSSHLKAHIRVHTGDKPYICNWENCQRRFTRSDELSRHKRTHTGEKLFSCSICQRKFNRSDHLSKHIKTHKN 178          

HSP 2 Score: 60.077 bits (144), Expect = 2.943e-10
Identity = 26/59 (44.07%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  915 RPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPL--CFKRFMRSDHLAKHKKTHEG 1085
            + F C Y  C K++ +S  L+ H+R HTG+K ++C    C +RF RSD L++HK+TH G
Sbjct:   92 KSFKCNYKSCLKAYYKSSHLKAHIRVHTGDKPYICNWENCQRRFTRSDELSRHKRTHTG 150          
BLAST of Sp5 vs. Planmine SMEST
Match: SMESG000025482.1 (SMESG000025482.1)

HSP 1 Score: 106.686 bits (265), Expect = 1.335e-26
Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 3
Query:  852 CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRSDHLAKHKKTHEG 1085
            C K Y K+SHLKAHIR H  D+P++C +  C + FTRSDEL RH RTHTGEK F C +C ++F RSDHL+KH KTH+ 
Sbjct:  115 CLKAYYKSSHLKAHIRVHTGDKPYICNWENCQRRFTRSDELSRHKRTHTGEKLFSCSICQRKFNRSDHLSKHIKTHKN 192          

HSP 2 Score: 60.077 bits (144), Expect = 3.475e-10
Identity = 26/59 (44.07%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  915 RPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPL--CFKRFMRSDHLAKHKKTHEG 1085
            + F C Y  C K++ +S  L+ H+R HTG+K ++C    C +RF RSD L++HK+TH G
Sbjct:  106 KSFKCNYKSCLKAYYKSSHLKAHIRVHTGDKPYICNWENCQRRFTRSDELSRHKRTHTG 164          
BLAST of Sp5 vs. Planmine SMEST
Match: SMESG000067314.1 (SMESG000067314.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.005e-20
Identity = 58/182 (31.87%), Postives = 83/182 (45.60%), Query Frame = 3
Query:  660 FPSADSVRNSPPNISTQLN-LSSNRANIPQ---LGQRKCQKCTCPNC---------HQGL-----NSRANLNGAKKVHICYI--CHKTYGKTSHLKAHIRWHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEK-----------------------RFVCPLCFKRFMRSDHLAKHKKT 1076
            + +  S+ N P  + T +N    +  N P+    G      C CPNC         HQ L     N+  +L     +H C++  C K Y K+SHLKAH+RWH  +RPFVC +  C K F RSDELQ+H+R H   K                       +  C  C++ + ++D L KH K+
Sbjct:  121 YSNVSSLLNFPTMLETSINSWPLSNINYPRSSTRGYSSVGNCECPNCQETPFIENTHQKLLPTIMNASESLGQYPILHNCHVPGCGKVYKKSSHLKAHLRWHTGERPFVCNWLFCGKRFARSDELQQHIRLHQETKDNTNSTALSPKKELKTVDKDLGIKLTCEFCYRSYSKNDLLLKHIKS 302          
The following BLAST results are available for this feature:
BLAST of Sp5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SP35.665e-4669.81Sp3 transcription factor [Source:HGNC Symbol;Acc:H... [more]
SP37.406e-4669.81Sp3 transcription factor [Source:HGNC Symbol;Acc:H... [more]
SP37.490e-4669.81Sp3 transcription factor [Source:HGNC Symbol;Acc:H... [more]
SP37.946e-4669.81Sp3 transcription factor [Source:HGNC Symbol;Acc:H... [more]
SP31.171e-4569.81Sp3 transcription factor [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Sp5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptf-31.039e-3952.27SP (Specificity Protein) Transcription Factor [So... [more]
sptf-21.798e-3050.88SP (Specificity Protein) Transcription Factor [So... [more]
klf-37.596e-2351.02Kruppel-Like Factor (Zinc finger protein) [Source... [more]
klf-37.805e-2351.02Kruppel-Like Factor (Zinc finger protein) [Source... [more]
klf-29.111e-2051.16Kruppel-Like Factor (Zinc finger protein) [Source... [more]
back to top
BLAST of Sp5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spps1.818e-4055.88gene:FBgn0039169 transcript:FBtr0084565[more]
Sp12.237e-4063.39gene:FBgn0020378 transcript:FBtr0071381[more]
Spps2.308e-4055.88gene:FBgn0039169 transcript:FBtr0330382[more]
Sp15.040e-4063.39gene:FBgn0020378 transcript:FBtr0273354[more]
Sp15.139e-4063.39gene:FBgn0020378 transcript:FBtr0331335[more]
back to top
BLAST of Sp5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sp3a7.485e-4667.92sp3a transcription factor [Source:ZFIN;Acc:ZDB-GEN... [more]
sp3a7.619e-4667.92sp3a transcription factor [Source:ZFIN;Acc:ZDB-GEN... [more]
sp3b2.460e-4566.98Sp3b transcription factor [Source:ZFIN;Acc:ZDB-GEN... [more]
sp3b2.852e-4566.98Sp3b transcription factor [Source:ZFIN;Acc:ZDB-GEN... [more]
sp3b1.266e-4466.98Sp3b transcription factor [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Sp5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zp3.22.522e-4670.75zona pellucida glycoprotein 3 (sperm receptor), ge... [more]
zp3.23.139e-4670.75zona pellucida glycoprotein 3 (sperm receptor), ge... [more]
nr2e35.699e-4655.10nuclear receptor subfamily 2 group E member 3 [Sou... [more]
nr2e31.070e-4555.10nuclear receptor subfamily 2 group E member 3 [Sou... [more]
fxr11.702e-4459.84FMR1 autosomal homolog 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Sp5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sp36.807e-4668.87trans-acting transcription factor 3 [Source:MGI Sy... [more]
Sp31.037e-4568.87trans-acting transcription factor 3 [Source:MGI Sy... [more]
Sp41.251e-4457.48trans-acting transcription factor 4 [Source:MGI Sy... [more]
Sp48.417e-4458.27trans-acting transcription factor 4 [Source:MGI Sy... [more]
Sp15.659e-4350.00trans-acting transcription factor 1 [Source:MGI Sy... [more]
back to top
BLAST of Sp5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90WR8|SP3_CHICK3.484e-4569.81Transcription factor Sp3 OS=Gallus gallus OX=9031 ... [more]
sp|Q02447|SP3_HUMAN5.625e-4569.81Transcription factor Sp3 OS=Homo sapiens OX=9606 G... [more]
sp|O70494|SP3_MOUSE7.257e-4568.87Transcription factor Sp3 OS=Mus musculus OX=10090 ... [more]
sp|Q02446|SP4_HUMAN1.066e-4459.06Transcription factor Sp4 OS=Homo sapiens OX=9606 G... [more]
sp|Q62445|SP4_MOUSE9.924e-4457.48Transcription factor Sp4 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Sp5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7NZ650.000e+0100.00Sp5 (Fragment) OS=Schmidtea mediterranea OX=79327 ... [more]
A0A224AB840.000e+080.37Sp5 OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A448XCY83.867e-4964.96Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A5E4Q5Z48.204e-4650.86Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
A0A087VHY46.926e-4571.70Transcription factor Sp3 (Fragment) OS=Balearica r... [more]
back to top
BLAST of Sp5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sp3a3.327e-4660.16Sp3 transcription factor [Source:NCBI gene;Acc:103... [more]
sp3a4.844e-4660.16Sp3 transcription factor [Source:NCBI gene;Acc:103... [more]
sp3b3.605e-4567.62transcription factor Sp3-like [Source:NCBI gene;Ac... [more]
sp5l3.287e-4464.29transcription factor Sp5-like [Source:NCBI gene;Ac... [more]
sp5a7.251e-4368.93Sp5 transcription factor [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Sp5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sp45.604e-4463.55sp4 transcription factor [Source:ZFIN;Acc:ZDB-GENE... [more]
sp41.570e-4363.55sp4 transcription factor [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000008916.11.073e-4264.76pep scaffold:Pmarinus_7.0:GL476670:39536:47416:-1 ... [more]
ENSPMAT00000000432.15.408e-3952.59pep scaffold:Pmarinus_7.0:GL477956:42837:43256:-1 ... [more]
KLF108.823e-3056.98Kruppel like factor 10 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Sp5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF12.857e-1943.48Zinc-finger transcription factor; involved in diau... [more]
CRZ11.899e-1641.11Transcription factor, activates transcription of s... [more]
ZAP11.259e-1437.84Zinc-regulated transcription factor; binds to zinc... [more]
MIG22.750e-1333.02Zinc finger transcriptional repressor; cooperates ... [more]
MSN22.334e-1150.00Stress-responsive transcriptional activator; activ... [more]
back to top
BLAST of Sp5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428858.413e-4453.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429412.263e-4264.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429391.666e-3871.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322901.026e-3165.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421191.123e-3152.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sp5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SP31.251e-4563.87Sp3 transcription factor [Source:NCBI gene;Acc:101... [more]
sp5l1.234e-4263.06transcription factor Sp5 [Source:NCBI gene;Acc:101... [more]
sp42.471e-4264.15Sp4 transcription factor [Source:NCBI gene;Acc:101... [more]
sp93.164e-4252.29Sp9 transcription factor [Source:NCBI gene;Acc:101... [more]
sp5a1.571e-4169.90Sp5 transcription factor [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Sp5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023227.10.000e+0100.00SMESG000023227.1[more]
SMESG000050160.14.896e-2951.43SMESG000050160.1[more]
SMESG000025482.11.276e-2660.26SMESG000025482.1[more]
SMESG000025482.11.335e-2660.26SMESG000025482.1[more]
SMESG000067314.14.005e-2031.87SMESG000067314.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033839
GenBankAIZ98420.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033839 ID=SMED30033839|Name=Sp5|organism=Schmidtea mediterranea sexual|type=transcript|length=1336bp
TGTTTTTTATTTTCAAGTATTAATATATTCAAAATTCAAGTCCAATAAGA
ATTTATTATTATTATTTTTTTATTATTGTATTTTTTAAACCAAAACCCAT
TCAAAAGAAATTGATTGATTTTCGAAATTGAAATTATCCAAAAACAAAAA
TGAATTCCGGACCAGCTATAATAAACATTCCAACGTCGATTCACGTTTTA
CCATCGTCACCGGGATATTTCTCCAGCAAATCCCATCATTTACTTTCTGG
TCCAATTTCTCCAAATATCGATATGAATTACATCCCAAATCAGACTAATT
GCTCGACGAGATTCTTAATGAATTCCAACGATTTTTGGCAGAGTCCAGAA
ATGGCGGCCCTTCAAAGAACGACTGAAAAGTTTTTCGTCAATCAAAGTCT
TATAAATAACCCAACCAATCCATCGGCTATTCCTAATCCCACTAACTGTC
CGACCACTCCTATTAGACCTATCGCTAGAAAGCCTTGCATTGAACTTCCT
TCATTAATAGATTCTAAAAATCAAATGCAATTGATGAATTCTTTGTCTTC
CCATGCTTTAGAAGATTGCGTTGACCATTTCTTTCGTAGATCTATTAACT
GTTTTTCGTCTGGTTACAATCTTCCAAATTTAATGGCTTGCAAAGAGTTT
TCTTTAGACTTTCCATCAGCCGACAGCGTTAGAAACAGCCCACCAAACAT
ATCGACACAATTGAACTTATCATCAAACCGAGCAAACATTCCACAATTGG
GTCAGAGAAAATGTCAGAAGTGTACTTGTCCGAACTGTCATCAAGGTCTC
AATTCTCGAGCCAATCTCAATGGAGCGAAAAAAGTTCACATTTGTTACAT
TTGTCACAAAACATATGGAAAAACCAGTCATTTAAAAGCCCATATCAGGT
GGCACAACAACGATCGGCCGTTTGTTTGTACGTATCACTTATGTTCGAAA
TCTTTCACCAGATCAGATGAATTACAGAGACACATGAGAACTCACACAGG
AGAAAAGCGATTCGTTTGTCCTTTGTGTTTTAAAAGATTCATGCGCAGTG
ATCATCTAGCAAAACACAAGAAAACACACGAAGGCGTCGATCCGATAGTT
CTCGGTACAGTCATATCGAAAGACACAAATTCTTCCATTAAATCACCAAA
AGCTCTGAATCCAGACAAAATTTATAAAAAGCAGCAGAATGTAAAGAAAC
CGAGACTTGGTCTTTCTGTCTCAAACAGCGCTATGAATTCTCCAGATCAT
CACCATCTCCATGGGAAAGAAAACATTATCATTGAAGAAGATGTTGACAT
AGAATCTATTTGATTTTCATTTTGTGTAAAATCGTG
back to top

protein sequence of SMED30033839-orf-1

>SMED30033839-orf-1 ID=SMED30033839-orf-1|Name=SMED30033839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MNSGPAIINIPTSIHVLPSSPGYFSSKSHHLLSGPISPNIDMNYIPNQTN
CSTRFLMNSNDFWQSPEMAALQRTTEKFFVNQSLINNPTNPSAIPNPTNC
PTTPIRPIARKPCIELPSLIDSKNQMQLMNSLSSHALEDCVDHFFRRSIN
CFSSGYNLPNLMACKEFSLDFPSADSVRNSPPNISTQLNLSSNRANIPQL
GQRKCQKCTCPNCHQGLNSRANLNGAKKVHICYICHKTYGKTSHLKAHIR
WHNNDRPFVCTYHLCSKSFTRSDELQRHMRTHTGEKRFVCPLCFKRFMRS
DHLAKHKKTHEGVDPIVLGTVISKDTNSSIKSPKALNPDKIYKKQQNVKK
PRLGLSVSNSAMNSPDHHHLHGKENIIIEEDVDIESI*
back to top
Aliases
The feature 'Sp5' has the following synonyms
Synonym
sp5*
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000224cement gland
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR013087Znf_C2H2_type
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
GO:0043565sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0036342post-anal tail morphogenesis
GO:0060349bone morphogenesis
GO:0071407cellular response to organic cyclic compound
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 288..310
e-value: 0.028
score: 23.6
coord: 230..252
e-value: 30.0
score: 9.1
coord: 258..282
e-value: 0.0041
score: 26.4
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 258..282
e-value: 9.2E-6
score: 25.8
coord: 288..310
e-value: 0.0022
score: 18.4
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 290..310
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 232..252
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 260..282
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 288..315
score: 13.09
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 230..257
score: 12.03
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 258..287
score: 15.521
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 285..315
e-value: 8.7E-10
score: 40.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 222..259
e-value: 5.5E-6
score: 28.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 260..284
e-value: 7.4E-15
score: 56.5
NoneNo IPR availablePANTHERPTHR23235TRANSCRIPTION FACTOR SP3coord: 107..346
NoneNo IPR availablePANTHERPTHR23235:SF15SP1, ISOFORM F-RELATEDcoord: 107..346
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 239..297