Transporter

Overview
NameTransporter
Smed IDSMED30033804
Length (bp)1608
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transporter (SMED30033804) t-SNE clustered cells

Violin plots show distribution of expression levels for Transporter (SMED30033804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transporter (SMED30033804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transporter (SMED30033804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033804

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033804h1SMcG0010466 SmedASXL_072603SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033804h1SMcG0010466 Contig34618newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033804h1SMcG0010466 Contig34618uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033804h1SMcG0010466 Contig29206uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033804h1SMcG0010466 Contig29206newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033804h1SMcG0010466 Contig29169uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033804h1SMcG0010466 Contig29169newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30033804h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033804h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033804h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033804h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033804h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033804h1SMcG0010466 dd_Smed_v4_5713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transporter vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 208.379 bits (529), Expect = 3.814e-58
Identity = 112/280 (40.00%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ +   G FI  LK    P  DWGP    +R E
Sbjct:  497 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMHLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 768          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.904 bits (507), Expect = 7.012e-57
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM-VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRA 819
            NC RD+VI+++ NCATSV+AGFVIF+ LGFMAN   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    I+     +KT+  + V V GF LGIP+    GIY L L+D   + + L+++  +  + I Y YG R + +DI +M G  P  +++I W  ++P ++ F+LVF       + Y  Y+YP   +     +AL  +L IP   M R CR  G  L   LK   KPS DWGPA   +R 
Sbjct:  207 NCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQ----KKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRT 479          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.134 bits (505), Expect = 1.170e-55
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM-VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRA 819
            NC RD+VI+++ NCATSV+AGFVIF+ LGFMAN   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    I+     +KT+  + V V GF LGIP+    GIY L L+D   + + L+++  +  + I Y YG R + +DI +M G  P  +++I W  ++P ++ F+LVF       + Y  Y+YP   +     +AL  +L IP   M R CR  G  L   LK   KPS DWGPA   +R 
Sbjct:  318 NCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQ----KKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRT 590          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.134 bits (505), Expect = 1.170e-55
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM-VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRA 819
            NC RD+VI+++ NCATSV+AGFVIF+ LGFMAN   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    I+     +KT+  + V V GF LGIP+    GIY L L+D   + + L+++  +  + I Y YG R + +DI +M G  P  +++I W  ++P ++ F+LVF       + Y  Y+YP   +     +AL  +L IP   M R CR  G  L   LK   KPS DWGPA   +R 
Sbjct:  318 NCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQ----KKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRT 590          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 199.134 bits (505), Expect = 1.612e-55
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM-VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRA 819
            NC RD+VI+++ NCATSV+AGFVIF+ LGFMAN   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    I+     +KT+  + V V GF LGIP+    GIY L L+D   + + L+++  +  + I Y YG R + +DI +M G  P  +++I W  ++P ++ F+LVF       + Y  Y+YP   +     +AL  +L IP   M R CR  G  L   LK   KPS DWGPA   +R 
Sbjct:  337 NCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQ----KKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRT 609          
BLAST of Transporter vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 148.673 bits (374), Expect = 3.516e-38
Identity = 100/281 (35.59%), Postives = 149/281 (53.02%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMV-CVVGF--ALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDL 834
            N   DA+  + INCATS  +GFVIF+ LG+M+      I+ VA+ GPGL F+VYPEALS MP AP WS+LFF M++TLG  S F   E +++G  DE            +K   V V C+  F   +GI M   GGI ++  L    + + LLI    E +VI Y YG+RQF  D+  M G RP  YW+  W    P +++ ++   F    +L Y DY YP +        AL    FIP + + ++    G  + +++ + +  +   ++ N+ E+I +
Sbjct:  334 NVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEF--------PILKKNREVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALSGASFIPLVGIYKFVNARGNTISEKWQRVTMPY--RKRPNQTEYIPI 604          
BLAST of Transporter vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 139.043 bits (349), Expect = 1.028e-34
Identity = 96/275 (34.91%), Postives = 152/275 (55.27%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKV-AKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITP--IVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNR 816
            NC RDAV  ++INCATS F+G V+F+ LG+M+ + N  I++V  +    L FIVYP+AL+ M  +  WS +FF M++TLG  S F+ +E  ++GF DE   +  +S  K RK F +++C++ + L  P I  GG +++  LD       +L +   E++ +C+FYG+ QF KDI  M G  P  YWR+ W   +P  I ++F++  Y ++   +Q   Y +P   +    F+ L+ +L IP +F   Y   G   L + +      W    Q  R
Sbjct:  381 NCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDE---SRFLS--KNRKWFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRVCW-TCSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIP-VFAIIYLLSGTGTLYERF-----RWAITPQQRR 643          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 126.716 bits (317), Expect = 1.123e-30
Identity = 85/242 (35.12%), Postives = 131/242 (54.13%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKF-RKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYG--DYKYPRSWLYFAQFVALVPMLFIP 714
            N  + A+ V  +N  TSVFAGFVIF+ +GFMA  +  ++ +VA+ GPGL F+ YP  +  +P    WS LFF M+L LG  SQF  +E   +   DE  +   I  +K+ R+ F  ++CV+ + +G+  +  GG Y+  L D +  SG+ LL L   E + I +  GI ++ + +  M G  P+ +W+  W+  TP V   +L+F       L+    +Y YP     F  F++L  ML IP
Sbjct:  324 NVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQ---IRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCIP 562          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 115.161 bits (287), Expect = 6.284e-27
Identity = 91/295 (30.85%), Postives = 147/295 (49.83%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDE--LMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYK-YPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKP-----SSDWGPAEQN--NRAEFIDLIRSNES 852
            NC +DA+ +  IN  TS+ AGF +F+ LG+M+++    I ++ K G GLAF+ YPE  SN+PM  ++++LFF M+  LG  SQ  M+E + +  +D   ++R       K++K    + C+  F +GIPM+ + G + LTL D +  SGY LL +   E++ + Y +G    +K +  M G          W    P   + L VF       ++Y D K +P     F  F++   M+ IP   +         + LKE ++       S   PA++N  N AE +  I S+  
Sbjct:  313 NCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILR-------KYKKQSLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEVVGLAYGFGAHNIRKALHEMIGVTLPKGIEYVWKFCAPATSLVLFVFCVVYYHPVKYPDGKDFPFWANAFGWFLSSCSMVVIPGYAIYYLFFTNKHLTLKERVRKGLNLDGSFESPAKKNLVNNAEELKFIESSSQ 600          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 106.301 bits (264), Expect = 6.069e-24
Identity = 80/282 (28.37%), Postives = 143/282 (50.71%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVA-KGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFR---VMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWY--WRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEY--MKPSSDWGPAEQNNRAE 822
            N  +D  +V +++   S+    + F+ +GF      +++DK   + G  L F+   EAL+ + +APL++ LFF M+L +   +Q  +VET++S   DE         E+ R+  R     VC +   L IP   + G++ + LL   V  +PL+++  +E + I + YG+     +   + G  P  Y  W+I +  I P+V + +L F +   +S+QY  Y++P   +  A  +A  P++ IP + + ++C   G I  K +  + P   WGPA   +RAE
Sbjct:  363 NIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEY-------PERLRRNRRHVLTTVCALFILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLAILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPDDAWGPAMAIHRAE 637          
BLAST of Transporter vs. Ensembl Fly
Match: Ntl (gene:FBgn0267326 transcript:FBtr0079479)

HSP 1 Score: 154.836 bits (390), Expect = 1.334e-40
Identity = 94/273 (34.43%), Postives = 158/273 (57.88%), Query Frame = 1
Query:   13 DAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNRAEF 825
            D+V++  IN  TS+ AGFV+F+ LGF++    + ++ VA GG GLAF+ YPEA++ +P+  LW+++FFFM+  LG  S F  +E +MS   DE      + S K + T  ++ C++   L   M  NGG+++L L DW  S   ++++ L+EI+++ + YGI+ F  D+  M G RP  YWRI W ++TP++++F+L+       ++ Y +  YP+  +          +++IP        R    +   LK+ +KP  DW PA+  +RAE+
Sbjct:  254 DSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIPVESVATGGAGLAFVTYPEAIALLPVPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYW---VRSHKCKLT--LISCLIFLGLSSIMCTNGGMFILQLFDWYSSAIAVIVICLVEIIMVAWIYGIKNFMLDVEFMLGKRPTLYWRIVWQVVTPVIIIFILITSIVFIRTITYNNIPYPQWAIIIGWASCFTSVMWIPLYIFYIMIRKRATLCDSLKKRLKP-LDWTPADPQDRAEY 520          
BLAST of Transporter vs. Ensembl Fly
Match: Ntl (gene:FBgn0267326 transcript:FBtr0079478)

HSP 1 Score: 154.836 bits (390), Expect = 2.339e-40
Identity = 94/273 (34.43%), Postives = 158/273 (57.88%), Query Frame = 1
Query:   13 DAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNRAEF 825
            D+V++  IN  TS+ AGFV+F+ LGF++    + ++ VA GG GLAF+ YPEA++ +P+  LW+++FFFM+  LG  S F  +E +MS   DE      + S K + T  ++ C++   L   M  NGG+++L L DW  S   ++++ L+EI+++ + YGI+ F  D+  M G RP  YWRI W ++TP++++F+L+       ++ Y +  YP+  +          +++IP        R    +   LK+ +KP  DW PA+  +RAE+
Sbjct:  302 DSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIPVESVATGGAGLAFVTYPEAIALLPVPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYW---VRSHKCKLT--LISCLIFLGLSSIMCTNGGMFILQLFDWYSSAIAVIVICLVEIIMVAWIYGIKNFMLDVEFMLGKRPTLYWRIVWQVVTPVIIIFILITSIVFIRTITYNNIPYPQWAIIIGWASCFTSVMWIPLYIFYIMIRKRATLCDSLKKRLKP-LDWTPADPQDRAEY 568          
BLAST of Transporter vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 156.762 bits (395), Expect = 3.437e-40
Identity = 99/274 (36.13%), Postives = 158/274 (57.66%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRP---NWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI----LLKEYMKPSSDWGPA 801
            NC +D++IVA  N ATS FAG VIF+ +GF+A+  NV ++KV   G GLAFIVYPE ++ +P++P+W++LFF M+LTLG  SQF+++ETV +   D           +++    + V + G+  G+    N G+Y L L+D   + + +L++ + E ++I + YG ++F  DI  M G R    N++W I W  ITP  ++F+L F +      +YG Y YP         V L+P+L I  +  Q   R    +     +K  ++P+++WGPA
Sbjct:  358 NCYKDSLIVAFCNIATSFFAGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQFALMETVTTAILDRFPNL-----RQYKIWVVLSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVLLIAISECILIAWIYGSQRFLNDIQGMIGKRSWFWNFFWGIMWRYITPATLLFILFFNWVEYKPAKYGHYVYPMWADAVGWIVGLLPVLVIFLVAFQEIWRAPMSLSFRDRIKHLLQPTAEWGPA 626          
BLAST of Transporter vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089972)

HSP 1 Score: 151.754 bits (382), Expect = 3.880e-39
Identity = 97/246 (39.43%), Postives = 144/246 (58.54%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDE---LMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMF 723
            N  +DA+IV  +N +TS+FAGFVIF+ +GFMA+ +   +  VA  GPGLAF+VYP A+  +P +P+WS LFFFM+L +G  SQF  +E  ++   DE   L+R       K ++ F  +VC + + +G+  I  GG+Y+  +LD + VSG+ LL L   E + I + YG+ +F   I  M G  P  +W+  W + TP + + +  F     + ++Y DY YP     F  F AL  ML+IP YMF
Sbjct:  353 NVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAHEQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLR-------KRKEIFIAIVCALSYLVGLTCITQGGMYIFQILDSYAVSGFCLLWLIFFECVSISWCYGVDRFYDGIKDMIGYYPTVWWKFCWCVTTPAICLGVFFFNIVQWTPVKYLDYSYPWWAHAFGWFTALSSMLYIPLYMF 591          
BLAST of Transporter vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 146.747 bits (369), Expect = 2.303e-37
Identity = 96/279 (34.41%), Postives = 147/279 (52.69%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAA-----GSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWG---PAEQNN 813
            NC RDA+I + INC TS  AGFVIF+ LG+MA ++  +IDKV   GPGL FIVYPEA++ M  +  WSI+FF M++TLG  S F  +E +++   DE  R  +I   + R+ F +++    F   +P +  GG+ L+  L+    G  +L +  +E   + +FYG+ +F  D+  M G +P  +WRI W  I+P+ ++ + +F         G    Y D+ Y   W      V  +PM  I   F     + G    L+E  +P  + G   P +Q  
Sbjct:  348 NCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPR--VIG--RRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFAS--KGGCRQRLQESFQPEDNCGSVVPGQQGT 620          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 200.29 bits (508), Expect = 1.582e-55
Identity = 111/289 (38.41%), Postives = 171/289 (59.17%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMF-MQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE----FIDLIRSNE 849
            NC RD +IV   N ATS+FAGFVIF+ +GFMA+   V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +       K +  F ++ C+  F LG PMI   G+Y+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +WR+ W  +TP ++ F+L         + Y DY YP   +     + +  +++IP MF ++ +   G  I  LK    P  DWGP    +R E     ID + +N 
Sbjct:  485 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKY----LRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHRGERYKNMIDPLGTNS 769          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 200.29 bits (508), Expect = 1.660e-55
Identity = 111/289 (38.41%), Postives = 171/289 (59.17%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMF-MQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE----FIDLIRSNE 849
            NC RD +IV   N ATS+FAGFVIF+ +GFMA+   V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +       K +  F ++ C+  F LG PMI   G+Y+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +WR+ W  +TP ++ F+L         + Y DY YP   +     + +  +++IP MF ++ +   G  I  LK    P  DWGP    +R E     ID + +N 
Sbjct:  477 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKY----LRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHRGERYKNMIDPLGTNS 761          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 200.29 bits (508), Expect = 1.747e-55
Identity = 111/289 (38.41%), Postives = 171/289 (59.17%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMF-MQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE----FIDLIRSNE 849
            NC RD +IV   N ATS+FAGFVIF+ +GFMA+   V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +       K +  F ++ C+  F LG PMI   G+Y+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +WR+ W  +TP ++ F+L         + Y DY YP   +     + +  +++IP MF ++ +   G  I  LK    P  DWGP    +R E     ID + +N 
Sbjct:  485 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKY----LRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHRGERYKNMIDPLGTNS 769          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 183.341 bits (464), Expect = 3.744e-50
Identity = 110/275 (40.00%), Postives = 170/275 (61.82%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNR 816
            NC RD++I+++ NC TSV+AGFVIF+ LGFMA+   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II ++ +     + V ++GF LG+P+    GIY L L+D   + + L+I+  +  + I Y YG + + KD+ +M G  P  ++RI W  ++P ++ F+L+F       + Y DY YP   L     +AL  ++ IP Y   +    +G   L  LK  +KP  DWGPA Q +R
Sbjct:  313 NCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKTY---VTLGVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHKNYFKDVEMMLGFPPPIFFRICWRYVSPFIITFILIFTVIQYKPITYNDYVYPGWSLVIGFAMALSSVICIPIYALFKIAMSEGSTFLERLKNSVKPDPDWGPALQEHR 584          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 183.341 bits (464), Expect = 4.200e-50
Identity = 110/275 (40.00%), Postives = 170/275 (61.82%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNR 816
            NC RD++I+++ NC TSV+AGFVIF+ LGFMA+   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II ++ +     + V ++GF LG+P+    GIY L L+D   + + L+I+  +  + I Y YG + + KD+ +M G  P  ++RI W  ++P ++ F+L+F       + Y DY YP   L     +AL  ++ IP Y   +    +G   L  LK  +KP  DWGPA Q +R
Sbjct:  318 NCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKTY---VTLGVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHKNYFKDVEMMLGFPPPIFFRICWRYVSPFIITFILIFTVIQYKPITYNDYVYPGWSLVIGFAMALSSVICIPIYALFKIAMSEGSTFLERLKNSVKPDPDWGPALQEHR 589          
BLAST of Transporter vs. Ensembl Xenopus
Match: SLC6A5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:100495275])

HSP 1 Score: 207.223 bits (526), Expect = 7.609e-59
Identity = 114/280 (40.71%), Postives = 171/280 (61.07%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            N  RD +IV   N ATS+FAGFVIF+ +GFMA++ NV I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F ++ CV  F +G PMI  GGIY+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +P+ +W++ W  +TP ++ F+L F F     + YG Y YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  317 NVYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKL----LRPHKPLFTLICCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPSRFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYHYPTWSMVMGWLMLACSVIWIPVMFV----IKMYLAPGTFIERLKLVCSPQPDWGPFLAKHRGE 588          
BLAST of Transporter vs. Ensembl Xenopus
Match: SLC6A5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:100495275])

HSP 1 Score: 206.453 bits (524), Expect = 1.008e-58
Identity = 114/280 (40.71%), Postives = 171/280 (61.07%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            N  RD +IV   N ATS+FAGFVIF+ +GFMA++ NV I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F ++ CV  F +G PMI  GGIY+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +P+ +W++ W  +TP ++ F+L F F     + YG Y YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  291 NVYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKL----LRPHKPLFTLICCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPSRFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYHYPTWSMVMGWLMLACSVIWIPVMFV----IKMYLAPGTFIERLKLVCSPQPDWGPFLAKHRGE 562          
BLAST of Transporter vs. Ensembl Xenopus
Match: SLC6A5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:100495275])

HSP 1 Score: 207.223 bits (526), Expect = 8.768e-58
Identity = 114/280 (40.71%), Postives = 171/280 (61.07%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            N  RD +IV   N ATS+FAGFVIF+ +GFMA++ NV I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F ++ CV  F +G PMI  GGIY+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +P+ +W++ W  +TP ++ F+L F F     + YG Y YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  490 NVYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKL----LRPHKPLFTLICCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPSRFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYHYPTWSMVMGWLMLACSVIWIPVMFV----IKMYLAPGTFIERLKLVCSPQPDWGPFLAKHRGE 761          
BLAST of Transporter vs. Ensembl Xenopus
Match: SLC6A5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:100495275])

HSP 1 Score: 206.838 bits (525), Expect = 8.924e-58
Identity = 114/280 (40.71%), Postives = 171/280 (61.07%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            N  RD +IV   N ATS+FAGFVIF+ +GFMA++ NV I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F ++ CV  F +G PMI  GGIY+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +P+ +W++ W  +TP ++ F+L F F     + YG Y YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  478 NVYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKL----LRPHKPLFTLICCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPSRFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYHYPTWSMVMGWLMLACSVIWIPVMFV----IKMYLAPGTFIERLKLVCSPQPDWGPFLAKHRGE 749          
BLAST of Transporter vs. Ensembl Xenopus
Match: SLC6A5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:100495275])

HSP 1 Score: 193.741 bits (491), Expect = 2.461e-54
Identity = 105/257 (40.86%), Postives = 161/257 (62.65%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI 756
            N  RD +IV   N ATS+FAGFVIF+ +GFMA++ NV I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F ++ CV  F +G PMI  GGIY+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +P+ +W++ W  +TP ++ F+L F F     + YG Y YP       WL  A  V  +P++F+    ++ Y   G FI
Sbjct:  229 NVYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKL----LRPHKPLFTLICCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPSRFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYHYPTWSMVMGWLMLACSVIWIPVMFV----IKMYLAPGTFI 477          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 209.92 bits (533), Expect = 7.268e-59
Identity = 113/280 (40.36%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  491 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 762          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 209.92 bits (533), Expect = 7.268e-59
Identity = 113/280 (40.36%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  491 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 762          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 209.92 bits (533), Expect = 7.268e-59
Identity = 113/280 (40.36%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  491 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 762          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 194.512 bits (493), Expect = 4.934e-55
Identity = 114/277 (41.16%), Postives = 171/277 (61.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM-VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRA 819
            NC RD+VI+++ NCATSV+AGFVIF+ LGFMAN   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    I+     +KT+  + V V GF LGIP+    GIY L L+D   + + L+++  +  + I Y YG R + +DI +M G  P  +++I W  ++P ++ F+L+F       + Y  Y+YP   +     +AL  ++ IP   + + CR  G  L   LK   KPS DWGPA   +R 
Sbjct:  206 NCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQ----KKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRT 478          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 193.741 bits (491), Expect = 6.410e-54
Identity = 114/277 (41.16%), Postives = 171/277 (61.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM-VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRA 819
            NC RD+VI+++ NCATSV+AGFVIF+ LGFMAN   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    I+     +KT+  + V V GF LGIP+    GIY L L+D   + + L+++  +  + I Y YG R + +DI +M G  P  +++I W  ++P ++ F+L+F       + Y  Y+YP   +     +AL  ++ IP   + + CR  G  L   LK   KPS DWGPA   +R 
Sbjct:  322 NCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQ----KKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRT 594          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 6.193e-58
Identity = 113/280 (40.36%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  499 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 770          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 9.697e-58
Identity = 113/280 (40.36%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ Y   G FI  LK    P  DWGP    +R E
Sbjct:  499 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 770          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|A7Y2X0|SC6A5_XENLA (Sodium- and chloride-dependent glycine transporter 2 OS=Xenopus laevis OX=8355 GN=slc6a5 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.246e-57
Identity = 118/280 (42.14%), Postives = 175/280 (62.50%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            N  RD +IV  IN ATS+FAGFVIF+ +GFMA++ NV I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +  ++ + K    F ++ CV  F +G PMI  GGIY+L L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +P+ +W+I W  +TP ++ F+L F F     + YG Y YP       WL  A  V  +P++F+  MF+      G FI  LK    P  DWGP    +R E
Sbjct:  490 NLYRDTLIVTCINSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPK--LLRTHK--PLFTLVCCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPSRFWKICWAFVTPTILTFILGFSFYQWEPMTYGSYHYPSWSMVMGWLMLACSVIWIPIMFVIKMFLA----PGTFIERLKLVCSPQPDWGPFLAKHRGE 761          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 208.379 bits (529), Expect = 1.832e-57
Identity = 112/280 (40.00%), Postives = 169/280 (60.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPR-----SWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI-LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD +IV   N ATS+FAGFVIF+ +GFMAN + V I+ VA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +         +  F +  C+  F +G PMI  GGIY+  L+D   + Y L+I+ + E++ I Y YG+++F +DI +M G +PN +W++ W  +TP ++ F+L F F     + YG Y+YP       WL  A  V  +P++F+    ++ +   G FI  LK    P  DWGP    +R E
Sbjct:  497 NCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPK----YLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFV----IKMHLAPGRFIERLKLVCSPQPDWGPFLAQHRGE 768          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|A7Y2W8|SC6A9_XENLA (Sodium- and chloride-dependent glycine transporter 1 OS=Xenopus laevis OX=8355 GN=slc6a9 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.671e-56
Identity = 116/276 (42.03%), Postives = 175/276 (63.41%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNRA 819
            NC RD++I+++ NCATSV+AGFVIF+ LGFMA    V + +VA  GPGLAF+ YPEAL+ +P++PLWSILFFFM++ LG G+QF ++ET+++   DE+    II   +++    + V ++GF LGIP+    GIY L L+D   + + L+I+  +  + + Y YG R++ KDI +M G  P  +++I W  I+P ++ F+L+F       +QY DY YP   +     +AL  ++ IP Y   + +C +G   L  LK  +KPS DWGPA Q +R 
Sbjct:  314 NCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAVVDEIGNDWII---RWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRKYFKDIEMMLGFPPPLFFQICWRFISPGIIFFILIFTVIQYRPIQYNDYLYPDWAITIGFLMALSSVICIPLYAIFKIWCSEGDTFLQRLKNAVKPSKDWGPALQEHRT 586          
BLAST of Transporter vs. TrEMBL
Match: A0A0H3YIU5 (Transporter OS=Schmidtea mediterranea OX=79327 GN=slc6a-6 PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.744e-116
Identity = 184/335 (54.93%), Postives = 253/335 (75.52%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFI-DLIRSNE---SLKKKCFIRXXXXXXXXXXXXTKFFQSKQSIIDKLNRAATKEIIKNNS 993
            NCCRDAV VA++NCATS+FAGFVIF NLGFMA++KN TID V   GPGLAF+VYPEAL++M MAPLWSI FF MM+TLGFGSQF++VETV++G QDEL R  ++ S+     FRV +C++ F LGIPM C GG+Y+L +LD+ +SGY LL+L L+EI+VICYFYGI +F+KDI+LMT  RPNWYWRI W+ I+P V+  L++FYF +G +L+YGD+ YP+S++    F+AL P++F+P +F+ RYC++GG+I+L+E +KP S+WGPA++ NR  FI  ++R +E   ++      + P+ +N        FFQSK+S++ K +  A KE  KN S
Sbjct:  347 NCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAAKENSKNPS 681          
BLAST of Transporter vs. TrEMBL
Match: A0A419PIS6 (Sodium-and chloride-dependent glycine transporter 2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Slc6a5 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.376e-109
Identity = 184/356 (51.69%), Postives = 239/356 (67.13%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXXX----------------------------TKFFQSKQSIIDKLNRAATKEIIK 984
            NCCRDAVIVA INCATSV+AGFVIFANLGFMA+ KN T+D VAK GPGLAF+VYPEAL+NMPM  +WS+ FFFMM TLGFGSQFS++E V+SG QDEL R G I S   +  FR ++C++ F LGIPM+C GG YL  L+D  +SGYPLL + + E +VICY YG++QF++DI+LM   RPNWYWRI+W+ + P++ + LL+F F AG   +  +Y+YP+  L     +A+ P+  IP  F+ +YCR+GGFILL+E++KP  +WGPA   +RAEFI +IRSNESLK+                                             T FFQSK S+ +KL +A TKE++K
Sbjct:  239 NCCRDAVIVAFINCATSVYAGFVIFANLGFMADAKNTTVDAVAKSGPGLAFVVYPEALTNMPMPAIWSVFFFFMMCTLGFGSQFSILEAVISGLQDELRRFGYIQSNLKQIIFRCLICLINFLLGIPMVCGGGYYLFYLIDNYLSGYPLLFIAIAETVVICYIYGLKQFRRDIALMINERPNWYWRISWMFLVPLISLGLLLFLFVAGEEFKVEEYRYPKWALALGNVIAMSPVAMIPLWFVYKYCREGGFILLREFVKPVQEWGPARDEHRAEFISMIRSNESLKRSRLNNASASILPTTTVMNTGSQLQVGYGLGGSVISGLAGTGIIDDTGFFQSKLSVAEKLTQAHTKEVMK 594          
BLAST of Transporter vs. TrEMBL
Match: A0A183AJP8 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7183 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.897e-109
Identity = 182/355 (51.27%), Postives = 241/355 (67.89%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXX---------------------------XTKFFQSKQSIIDKLNRAATKEIIK 984
            NCCRDAVIVA+INCA+SV+AGFVIFANLGFMA  KN T+D VA+ GPGLAF+VYPEA++NMP+  LWS+LFFFMM TLGFGSQFS++E V+SG QDEL R G + +      FR ++C + F LG+PM+C GG YL  L+D  +SGYPLLI+ + E LVI Y YG+RQF +DI+LM   RPNWYWR+ W+ +TP++ + LL+F F AG       Y+YPR  L     +A  P++ IP  F+ +YCR+GGF+L++E+ KP  +WGPA+  +RAEFI++IRSNESL++   IRN +                                   +T FFQSK S+ +KL +A TKE++K
Sbjct:   61 NCCRDAVIVAVINCASSVYAGFVIFANLGFMAYSKNTTVDAVARSGPGLAFVVYPEAITNMPLPSLWSVLFFFMMCTLGFGSQFSILEAVISGLQDELRRLGYVFTNMKAIFFRCVICTINFLLGLPMLCGGGYYLFYLVDNYLSGYPLLIIAVAETLVIGYVYGMRQFLRDIALMINERPNWYWRLCWMFVTPLISMALLLFLFIAGEEFTLEKYRYPRWALGLGNLIACAPVVLIPIWFLYKYCREGGFLLMREFFKPVHEWGPAQDEHRAEFINMIRSNESLRRS-RIRNTSSHLFPATVGNGSQLQLGFGLGGSVVSGLAGTGIIDDTGFFQSKLSVAEKLTQAHTKEVMK 414          
BLAST of Transporter vs. TrEMBL
Match: G7Y7I2 (Transporter OS=Clonorchis sinensis OX=79923 GN=CLF_102215 PE=3 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.509e-108
Identity = 184/356 (51.69%), Postives = 239/356 (67.13%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXXX----------------------------TKFFQSKQSIIDKLNRAATKEIIK 984
            NCCRDAVIVA INCATSV+AGFVIFANLGFMA+ KN T+D VAK GPGLAF+VYPEAL+NMPM  +WS+ FFFMM TLGFGSQFS++E V+SG QDEL R G I S   +  FR ++C++ F LGIPM+C GG YL  L+D  +SGYPLL + + E +VICY YG++QF++DI+LM   RPNWYWRI+W+ + P++ + LL+F F AG   +  +Y+YP+  L     +A+ P+  IP  F+ +YCR+GGFILL+E++KP  +WGPA   +RAEFI +IRSNESLK+                                             T FFQSK S+ +KL +A TKE++K
Sbjct:  332 NCCRDAVIVAFINCATSVYAGFVIFANLGFMADAKNTTVDAVAKSGPGLAFVVYPEALTNMPMPAIWSVFFFFMMCTLGFGSQFSILEAVISGLQDELRRFGYIQSNLKQIIFRCLICLINFLLGIPMVCGGGYYLFYLIDNYLSGYPLLFIAIAETVVICYIYGLKQFRRDIALMINERPNWYWRISWMFLVPLISLGLLLFLFVAGEEFKVEEYRYPKWALALGNVIAMSPVAMIPLWFVYKYCREGGFILLREFVKPVQEWGPARDEHRAEFISMIRSNESLKRSRLNNASASILPTTTVMNTGSQLQVGYGLGGSVISGLAGTGIIDDTGFFQSKLSVAEKLTQAHTKEVMK 687          
BLAST of Transporter vs. TrEMBL
Match: A0A4S2LK80 (Transporter OS=Opisthorchis felineus OX=147828 GN=CRM22_006605 PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.967e-108
Identity = 184/356 (51.69%), Postives = 239/356 (67.13%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXXX----------------------------TKFFQSKQSIIDKLNRAATKEIIK 984
            NCCRDAVIVA INCATSV+AGFVIFANLGFMA+ KN T+D VAK GPGLAF+VYPEAL+NMPM  +WS+ FFFMM TLGFGSQFS++E V+SG QDEL R G I S   +  FR ++C++ F LGIPM+C GG YL  L+D  +SGYPLL + + E +VICY YG++QF++DI+LM   RPNWYWRI+W+ + P++ + LL+F F AG   +  +Y+YP+  L     +A+ P+  IP  F+ +YCR+GGFILL+E++KP  +WGPA   +RAEFI +IRSNESLK+                                             T FFQSK S+ +KL +A TKE++K
Sbjct:  332 NCCRDAVIVAFINCATSVYAGFVIFANLGFMADAKNTTVDAVAKSGPGLAFVVYPEALTNMPMPAIWSVFFFFMMCTLGFGSQFSILEAVISGLQDELRRFGYIQSNLKQIIFRCLICLINFLLGIPMVCGGGYYLFYLIDNYLSGYPLLFIAIAETVVICYIYGLKQFRRDIALMINERPNWYWRISWMFLVPLISLGLLLFLFVAGEEFKVEEYRYPKWALALGNVIAMSPVAMIPLWFVYKYCREGGFILLREFVKPVQEWGPARDEHRAEFISMIRSNESLKRSRLNNASASILPTTAVMNTGSQLQVGYGLGGSVISGLAGTGIIDDTGFFQSKLSVAEKLTQAHTKEVMK 687          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 187.193 bits (474), Expect = 1.826e-51
Identity = 115/275 (41.82%), Postives = 170/275 (61.82%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNR 816
            NC RD++I+++ NCATSV+AGFVIF+ LGFMA+   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II +   +      V VVGF LG+P+    GIY L L+D   + + L+I+  +  + I Y YG R + KD+ +M G  P  ++RI W  I+P+++ F+L+F       + Y DY YPR  L     +AL  ++ IP Y   +    +G   L  LK  +KP   WGPA Q +R
Sbjct:  322 NCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN---KTIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIPVYALFKIATSEGSTFLERLKYSLKPHPSWGPALQEHR 593          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 186.808 bits (473), Expect = 1.875e-51
Identity = 115/275 (41.82%), Postives = 170/275 (61.82%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNR 816
            NC RD++I+++ NCATSV+AGFVIF+ LGFMA+   V + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II +   +      V VVGF LG+P+    GIY L L+D   + + L+I+  +  + I Y YG R + KD+ +M G  P  ++RI W  I+P+++ F+L+F       + Y DY YPR  L     +AL  ++ IP Y   +    +G   L  LK  +KP   WGPA Q +R
Sbjct:  318 NCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN---KTIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIPVYALFKIATSEGSTFLERLKYSLKPHPSWGPALQEHR 589          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 177.178 bits (448), Expect = 5.628e-48
Identity = 109/283 (38.52%), Postives = 168/283 (59.36%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFR----VMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPN--W-YWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL--LKEYMKPSSDWGPAEQNNRAE 822
            NC +D++IV + NC TS+FAGF IF+ LG MA++    + +VA+ G GLAFI YP+ALS +P++PLWSILFFFM++TLG  SQF+ +E + +  QD        +  KF K+ R    V++CVV F LG+P +   GIY + L+D  V+G+ LL+ GL+E+  +   YG  +F KDI +M G +    W +WR  W  ITP V++ +L +     ++  YG  +YP   +     +    +++IP + + R  +  G +   +K    P+ DWGP  + +R E
Sbjct:  345 NCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQD--------AYPKFLKSKRGLITVIICVVLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGNRFIKDIEMMIGNKSAIFWIWWRSCWFFITPFVLLVILGWSVYTFTAPTYGTVEYPEWGIALGWCMTAFCLMWIPIVAVWRIAKASGGLWQRIKSTCVPTEDWGPYLERHRGE 619          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 171.014 bits (432), Expect = 7.016e-46
Identity = 100/277 (36.10%), Postives = 160/277 (57.76%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCR-DGGFILLKEY-MKPSSDWGPAEQNNRAEF 825
            NC RDA+I + IN  TS F+GFVIF+ LG+M+   NV +DKVA  GPGL FI+YPEA++ +P + +W+++FF M+LTLG  S    +E+V++G  DE          + R+ F + + V+ F + +  + NGGIY+ TLLD   +G  +L   L+E + I +FYG+ +F  DI  M G RP  YWR+ W  ++P  ++F++V  FA  +  +YG Y +P         +++  M+ +P   + ++C   G F     Y + P ++    E+    +F
Sbjct:  335 NCYRDAIITSSINSLTSFFSGFVIFSFLGYMSQKHNVALDKVATDGPGLVFIIYPEAIATLPGSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFKFL-----HRHRELFTLFIVVLTFLISLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGIAWFYGVDRFSDDIQEMIGHRPGLYWRLCWKFVSPCFLLFMVVVSFATFNPPKYGSYYFPTWANMVGWCLSISSMIMVPLYAIYKFCTLPGSFCAKLAYAITPETEHHLVERGEVRQF 606          
BLAST of Transporter vs. Ensembl Cavefish
Match: si:ch211-117c9.5 (sodium- and chloride-dependent creatine transporter 1-like [Source:NCBI gene;Acc:103023618])

HSP 1 Score: 158.303 bits (399), Expect = 2.815e-41
Identity = 105/267 (39.33%), Postives = 152/267 (56.93%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQY-GDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWG 795
            NC +DA ++ALIN  TSVFAGFV+F+ LGFMA  + V I KVA+ GPGLAFI YP+A++ MP+APLW++LFF M+L LG  SQF  VE  ++G  D L     +SS + R+    + C+  F + + M+  GG+Y+  L D ++ SG  LL     E +V+ + YG  +F  D++ M G RP  Y +  W  ITP+V + + +F+      L Y G Y YP         +AL  ML IP   + +     G ++ +     +  WG
Sbjct:  367 NCYQDAFVLALINSGTSVFAGFVVFSVLGFMAAEQGVDISKVAESGPGLAFIAYPKAVTLMPVAPLWAVLFFIMLLVLGLDSQFVGVEGFITGLLDMLPPKSWMSSVR-REVIVAVCCITCFIIDLSMVTEGGMYVFQLFDYYSASGITLLWQAFWECVVVAWVYGADRFMDDVARMIGYRPQPYMKWCWSYITPLVCMGVFLFHLVNYKRLVYNGVYVYPWWGEMVGWALALSSMLCIPLTVLYKILHCKGSLIERWQHLTTPIWG 632          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 154.451 bits (389), Expect = 3.547e-41
Identity = 93/244 (38.11%), Postives = 144/244 (59.02%), Query Frame = 1
Query:   10 RDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP----YMFM 726
            RD++IV  IN  TSVFAGFVIF+ +GFM+++    + ++A  GPGLAF+ YP+A++ +P++PLWSILFF M+L LG  SQF  VE  ++   DE  +         ++ F  ++CV+ + +G+  I  GG+Y+  + D ++ SG  LL L   E + I + YG+ +F  +I  M G + + +W I W+  TP+V+V + +F     + L  G Y YP        F+AL  ML IP    Y+F+
Sbjct:  285 RDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQY----LRGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGSYTYPMWGQGMGWFMALSSMLLIPGYMVYLFL 524          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 5.513e-41
Identity = 108/268 (40.30%), Postives = 149/268 (55.60%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFY-GIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGD-YKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWG 795
            NC RD  I+AL+N  TS FAGFV+F+ LGFMA  + V I +VA+ GPGLAFI YP+A+S MPMAPLW+ LFFFM++ LG  SQF  VE  ++G  D L  A +    + R+ F  + C   F + I M+  GG+Y+  L D ++ SG  LL     E +V+ + Y G  +F  +I+LM G RP  + R  W  +TP V   + +F       L Y   Y YP         +AL  ML IP + + R  R  G +L +  +  +  WG
Sbjct:   78 NCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISD-LFPAALTGGYR-REVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMALSSMLCIPVVAIYRLARTKGNLLERWRILTTPVWG 343          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 145.976 bits (367), Expect = 2.691e-38
Identity = 87/239 (36.40%), Postives = 140/239 (58.58%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKG-GPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP 714
            NC RDA++ + +NC TS  +GFVIF  LG+MA M+NV ++ VAK  GP L FI YPEA++NM  +  W+ILFF MM+TLG  S F  +E +++   DE          K R+ F + +  + F   +  +  GG Y++ LL+   SG  ++ + L+E + + +FYG+++F  DI  M G  P ++WR+ W+ I+P+ + F++V +      L+  DY +P   +    F+A    +F+P
Sbjct:  242 NCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSL----FSKRREYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSKPLKLFDYDFPDWSMILGYFIAASSFMFVP 476          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 1.807e-34
Identity = 94/241 (39.00%), Postives = 142/241 (58.92%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLD-WTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPN-WYWRITWLIITPIVMVFLLVFYFAAGSSLQY-GDYKYPRSWLYFAQFVALVPMLFIP 714
            NC RD++I+ +IN ATS F+GFV+F+ LGFMA  + V I  VA+ GPGL F+VYP A+S +P+  LW+ L F M+L LG  S+F+ +E  ++G  D  +    +S ++ R+ F  + C+V F L + M+  GGIY+  L D +  SG  +L L   E + + + YG  +F +D++ M G RP+ W W   W +++P V + + VF+      L Y G Y+YP         +AL  ML IP
Sbjct:  248 NCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTD--LFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRPHAWVWW-CWSVVSPAVCLGIFVFHLVHYERLVYNGRYEYPGWAEALGWLLALSSMLCIP 485          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001703.1 (pep scaffold:Pmarinus_7.0:GL480466:142226:145960:1 gene:ENSPMAG00000001534.1 transcript:ENSPMAT00000001703.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 5.333e-27
Identity = 73/225 (32.44%), Postives = 116/225 (51.56%), Query Frame = 1
Query:  136 GPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAA--GSSLQYG----DY---------KYPRSWLYFAQFVALVPMLFIPY-----MFMQRYCRDGG 750
            G GLAFIV+ EA++ MP++PLWS+LFF M+  LG  S F  +E V++     L+   I      ++    ++C+    + +  +   G Y LT+ D      PLLI+   E++ + Y YGI +F +DI  M G +PN +W++ W  ++P++M+ + +FYF      +L Y     DY          YP   ++    +A VP L IP+     +   R CR GG
Sbjct:    6 GTGLAFIVFTEAITKMPISPLWSVLFFIMLFCLGLSSMFGNIEGVLT----PLLDLRIFPKSVPKEVLTGLICLFSMLVALLFVSQAGNYWLTVFDNFAGSIPLLIIAFCEMVGVSYIYGIDRFNRDIEWMIGHKPNIFWQVAWRGLSPLIMLAIFIFYFVTQVTQTLSYSAWNPDYVDFPTLESQDYPHWVVFIIALLAGVPSLIIPFWAIVNVVYSRCCRKGG 226          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 192.971 bits (489), Expect = 1.808e-54
Identity = 110/238 (46.22%), Postives = 148/238 (62.18%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP 714
            N  +DA+ ++LINC TSVFAGFVIF+ LGFM+++ N  I++VA  GPGLAF+VYPEA++ MP++PLW+ILFFFM+LTLG  SQF M+E V++G  DE          K ++ F  + C + F LGI  +  GG Y+L L D+   G  LL LG  E + + + YG  +F KDI  M G RP  +WR TW    P VM  +  +       + YG YKYP+   +F   +AL  MLFIP
Sbjct:  315 NIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPVC-----RKRKELFIAVACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGIFFYSIIFWQGVSYGSYKYPQWAEFFGWVIALSSMLFIP 547          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 178.333 bits (451), Expect = 3.489e-49
Identity = 105/251 (41.83%), Postives = 152/251 (60.56%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFV-ALVPMLFIPYMFMQRYCRDGG 750
            NC RDA+ V++INC+TSVFAG VIF+ LGFMA +    + +VA  GPGLAF+VYPE ++ MP++P WSI FFFM+LTLG  +QF+M E V +G  DE +R  ++ + K  + F   +C   F LG+P++   G +++ L  W   G  L+ L   E++V+ + YG  +F  DI  MTG +   +W I W  ITP V+  + +F       + Y DY+YP  W  F  +V AL  ML+IP + + +  R  G
Sbjct:  311 NCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVR--LLRNRK--ELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDDYQYP-PWAEFVGWVMALSSMLWIPGVAIYKMSRAKG 556          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 166.007 bits (419), Expect = 4.913e-45
Identity = 96/263 (36.50%), Postives = 152/263 (57.79%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSD 789
            NC RD +IV++INC TSVFAGFVIF  +GFMA+   V ++ V K GPGLAFI YP+ +  +P +P W+ LFFFM+  LG  SQF  VETV +   D    A      +++    ++ CVV + LGI  +  GG+Y+ T+ D+   G  L+++ L+E++ I +FYG+ +F ++I  M G RPN Y+ + W  I+P+++  + ++     S + YGDY +P    +    +    ++ +P   + R  +  G   L E  + + D
Sbjct:  278 NCQRDTLIVSVINCLTSVFAGFVIFTMMGFMAHELGVEVEDVVKSGPGLAFIAYPQGIKKIPGSPFWAFLFFFMLFNLGLDSQFVGVETVTTVLSDSYKGA-----RRYKAHLTLLFCVVSYILGISNVTQGGVYIFTMFDYQGGGISLILIALLEVIAIGWFYGVERFARNIESMIGHRPNIYFLLCWKYISPLIIGVIFIWNCVDWSGISYGDYVFPAWAEFCGWLLCFSSIVCVPICAIYRCVKGKG--TLAEVKRATRD 533          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 163.696 bits (413), Expect = 7.673e-44
Identity = 96/251 (38.25%), Postives = 155/251 (61.75%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRK-TFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDG 747
            N  +DA+++++ NC+TS FAGFV+F+ LGFMA   + T+ KVA  GPGLAF+ YPEA+S MP++ LW++LFFFM++TLG  SQF+ +E V++   DE      +   K+RK  F +++C+    LG+P +  GG+++  L+D+ V+G  LLI+ L+EI+ I + YG+ +F  D+  MTG RP  ++RI W  ++P+  + +++        ++Y    YP         + L  +L IP +   + Y R G
Sbjct:  324 NVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPW---VRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYKRSG 571          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 150.214 bits (378), Expect = 2.744e-39
Identity = 100/273 (36.63%), Postives = 154/273 (56.41%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPY-MFMQRYCRDGGFILLKEYMKPSSDWGPA-EQNN 813
            N   DA+++++INCATSVFAGFVIFA +G+MA+++  ++ +VA  GPGL FIVYP A+S +P   +W+++FF M++ LG  SQF  VE V +   ++  R       K R+   +++C V F LG+  +  GG+++  L D    G  LL +   E+LVI + YG R++  +IS M G     +W I W  I+PI+++ + VF  A    + Y +  YP         +AL  ML IP  M  + Y  +G F+   E +     +  A EQ+N
Sbjct:  294 NVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWPR----QLHKHRELVVLVICFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQMIGRPVLQWWVICWKYISPIMVLGIFVFSLAKYKRITYENVPYPAWAEGVGWLLALSSMLCIPVTMCYKIYKAEGTFLQNSETISGFMHYTYAVEQSN 562          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 196.052 bits (497), Expect = 5.023e-54
Identity = 109/276 (39.49%), Postives = 163/276 (59.06%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFI--LLKEYMKPSSDWGPAEQNNRAE 822
            NC RD VIV   N ATS+FAGFVIF+ +GFMA+   V I+KVA  GPG+AF+VYPEAL+ +P++P W+I+FF M+LTLG  + F+ +ET+++   DE  +       K +  F ++ C   F LG PMI   G+Y+L L+D   + Y L+I+ + E+L I Y YG+++F  DI +M G +PN +WR+ W  +TP ++  +L         + Y DY YP   +     + +  +++IP MF+ +     G I   LK    P  DWGP    +R +
Sbjct:  478 NCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPK----YLRKHKPVFTLICCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGLQRFCADIEMMIGFQPNRFWRLCWAFVTPTILTGILGLSLYQWKVMTYEDYTYPTWSMIMGWLMVICSVIWIPIMFLIKMYLAPGTIGERLKLVCSPQPDWGPFLMKHRGD 749          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 187.578 bits (475), Expect = 1.262e-51
Identity = 109/293 (37.20%), Postives = 175/293 (59.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCF 870
            NC RD++I+++ NCATSV+AGFVIF+ LGFMA+  NV + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II +   +    + V VVGF LG+P+    GIY L L+D   + + L+++  +  + I Y YG R + +D+ +M G  P  ++++ W  I+P+++ F+L+F       + Y DY YP   L     +AL  ++ IP   + +  R  G      LK   +    WGPA   +R      + S ++++ + F
Sbjct:  324 NCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN---KTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPALLEHRTGHYAPMASEDTVEARPF 613          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 187.193 bits (474), Expect = 1.785e-51
Identity = 109/293 (37.20%), Postives = 175/293 (59.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCF 870
            NC RD++I+++ NCATSV+AGFVIF+ LGFMA+  NV + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II +   +    + V VVGF LG+P+    GIY L L+D   + + L+++  +  + I Y YG R + +D+ +M G  P  ++++ W  I+P+++ F+L+F       + Y DY YP   L     +AL  ++ IP   + +  R  G      LK   +    WGPA   +R      + S ++++ + F
Sbjct:  320 NCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN---KTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPALLEHRTGHYAPMASEDTVEARPF 609          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 187.193 bits (474), Expect = 1.785e-51
Identity = 109/293 (37.20%), Postives = 175/293 (59.73%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFIL---LKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCF 870
            NC RD++I+++ NCATSV+AGFVIF+ LGFMA+  NV + +VA  GPGLAF+ YPEAL+ +P++PLWS+LFFFM++ LG G+QF ++ET+++   DE+    II +   +    + V VVGF LG+P+    GIY L L+D   + + L+++  +  + I Y YG R + +D+ +M G  P  ++++ W  I+P+++ F+L+F       + Y DY YP   L     +AL  ++ IP   + +  R  G      LK   +    WGPA   +R      + S ++++ + F
Sbjct:  320 NCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN---KTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPALLEHRTGHYAPMASEDTVEARPF 609          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 170.629 bits (431), Expect = 3.979e-46
Identity = 100/277 (36.10%), Postives = 154/277 (55.60%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIP-YMFMQRYCRDGGFILLKEY-MKPSSDWGPAEQNNRAEF 825
            NC RDA++ + +NC TS  +GF IF+ LG+MA   N+ I  VA  GPGL FI+YPEA+S +P +  W+I+FF M+LTLG  S    +E V++G  D+         ++ RK F        F + +  + NGGIY+LTLLD   +G  +L   L+E + + +FYG+ +F +DI  M G +P  YWR+ W  ++P+ ++F+++      S L+YGDY +P         VA+  MLF+P Y   + +   G F     Y + P  +     + N  +F
Sbjct:  287 NCYRDAILTSAVNCITSFVSGFAIFSVLGYMAQKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSMGGMEAVITGLSDDFKFL-----KRNRKLFTFATAFGTFLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKPGLYWRLCWKFVSPVFLLFVVIASTVTSSGLKYGDYVFPNGANLLGWGVAMSSMLFVPFYAIYKFFSVRGTFTERIAYCITPEHEHHKVAEGNVRQF 558          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000003011.1 (SMESG000003011.1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 366/366 (100.00%), Postives = 366/366 (100.00%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXXXTKFFQSKQSIIDKLNRAATKEIIKNNSFIGSEFQLNKKNSMSSPPDEKLIKSACNLASAALK 1098
            NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSILFFFMMLTLGFGSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRNPNDENGEENEETKFFQSKQSIIDKLNRAATKEIIKNNSFIGSEFQLNKKNSMSSPPDEKLIKSACNLASAALK
Sbjct:  342 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSILFFFMMLTLGFGSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRNPNDENGEENEETKFFQSKQSIIDKLNRAATKEIIKNNSFIGSEFQLNKKNSMSSPPDEKLIKSACNLASAALK 707          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000050382.1 (SMESG000050382.1)

HSP 1 Score: 368.622 bits (945), Expect = 4.747e-120
Identity = 184/335 (54.93%), Postives = 253/335 (75.52%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFI-DLIRSNE---SLKKKCFIRXXXXXXXXXXXXTKFFQSKQSIIDKLNRAATKEIIKNNS 993
            NCCRDAV VA++NCATS+FAGFVIF NLGFMA++KN TID V   GPGLAF+VYPEAL++M MAPLWSI FF MM+TLGFGSQF++VETV++G QDEL R  ++ S+     FRV +C++ F LGIPM C GG+Y+L +LD+ +SGY LL+L L+EI+VICYFYGI +F+KDI+LMT  RPNWYWRI W+ I+P V+  L++FYF +G +L+YGD+ YP+S++    F+AL P++F+P +F+ RYC++GG+I+L+E +KP S+WGPA++ NR  FI  ++R +E   ++      + P+ +N        FFQSK+S++ K +  A KE  KN S
Sbjct:  334 NCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAAKENSKNPS 668          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000050382.1 (SMESG000050382.1)

HSP 1 Score: 369.007 bits (946), Expect = 4.849e-120
Identity = 184/335 (54.93%), Postives = 253/335 (75.52%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFI-DLIRSNE---SLKKKCFIRXXXXXXXXXXXXTKFFQSKQSIIDKLNRAATKEIIKNNS 993
            NCCRDAV VA++NCATS+FAGFVIF NLGFMA++KN TID V   GPGLAF+VYPEAL++M MAPLWSI FF MM+TLGFGSQF++VETV++G QDEL R  ++ S+     FRV +C++ F LGIPM C GG+Y+L +LD+ +SGY LL+L L+EI+VICYFYGI +F+KDI+LMT  RPNWYWRI W+ I+P V+  L++FYF +G +L+YGD+ YP+S++    F+AL P++F+P +F+ RYC++GG+I+L+E +KP S+WGPA++ NR  FI  ++R +E   ++      + P+ +N        FFQSK+S++ K +  A KE  KN S
Sbjct:  347 NCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAAKENSKNPS 681          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000009986.1 (SMESG000009986.1)

HSP 1 Score: 274.248 bits (700), Expect = 5.328e-84
Identity = 151/356 (42.42%), Postives = 220/356 (61.80%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXXXTKFFQSKQSIIDKLNRAATKEIIKNNSFIGSEFQLNKKNSMSSPPDEKLIKS 1068
            NC RDAV+VA+INCATSV+ G VIF+N+GFMA  KNV++  V KGGPGLAF VYPEAL+ MP++PLWS+LFF MM+ LG GSQ ++VETV++G QDEL+RA  + +   +  +R+++C++ F LG+PM C GG+Y+L + D  VSG P+LIL L+E+LV+ Y YGI +F+ DI LM G +PN +W+ +W+II+P  ++F+L+      S L+     +P  ++     ++L+P+ F+  +F   YC+ GG++L  E  KP   WGPA   ++  F   I+                        + FFQSK+SI+ K +R  ++          SE   N+ NS      EKLI  
Sbjct:  315 NCLRDAVLVAVINCATSVYGGLVIFSNMGFMAFAKNVSMTDVVKGGPGLAFKVYPEALTKMPLSPLWSVLFFLMMIILGIGSQIALVETVLAGLQDELVRAKKLVTSNQKILYRLVMCLILFVLGVPMTCRGGMYVLEIFDGAVSGSPMLILALVEVLVVSYCYGIERFRMDIKLMIGYKPNKFWKYSWMIISPF-LIFILIIGLTVLSILK--KSTFPIGFVILQIVLSLLPIFFVISIFAFVYCKKGGWLLFSELKKPLHHWGPAHDEHKQNFYSSIQDESKTN------------------SNFFQSKESILKKFHRRLSQ----------SENDKNRINSSQEMEMEKLIND 639          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000009987.1 (SMESG000009987.1)

HSP 1 Score: 267.7 bits (683), Expect = 1.471e-81
Identity = 150/335 (44.78%), Postives = 216/335 (64.48%), Query Frame = 1
Query:    1 NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSIXXXXXXXXXXXXSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYK----YPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRXXXXXXXXXXXXTKFFQSKQSIIDK-----LNRAATKEI 978
            +CCRDAV+ A+I+C TSV+AGFVIF N+GFM+   NV++ +V   GPGLAF +YPEAL+ MP++PLWSILFF MML+LGFGSQ ++VETV+S FQDEL R G ++S+     +R++VC++ F +GIPM C GGIYLL L D +VS Y +LILGL EI VI Y YG+ +F  D+ LM G +PN +W+  WL++TP+ ++ LLV       S+ Y +YK    +P S++     +   P+  +  +F+  YC+ GG+ LL E  KP   W PA+++++ +FI  + S ++ +K                   FFQSK+SI +K     +N+    EI
Sbjct:  318 DCCRDAVLFAVIDCLTSVYAGFVIFCNMGFMSQSLNVSMAQVVTEGPGLAFKIYPEALTKMPLSPLWSILFFMMMLSLGFGSQIAIVETVLSSFQDELRRIGKMTSKTRVMLYRILVCLIMFIIGIPMTCRGGIYLLELFDTSVSQYSMLILGLAEICVISYVYGVNRFISDVHLMIGRKPNIFWKACWLVVTPLFILILLV-------SMIYYNYKEVPAFPPSFMALQHCLTCSPIAALVIIFLIVYCKSGGWTLLTEIKKPLIQWAPAKEDHKQDFIHSLNSFDNPEK------------------GFFQSKESIANKFSSKLINKNTNSEI 627          
The following BLAST results are available for this feature:
BLAST of Transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A53.814e-5840.00solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A97.012e-5742.60solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A91.170e-5542.60solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A91.170e-5542.60solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A91.612e-5542.60solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of Transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-13.516e-3835.59Sodium-dependent dopamine transporter [Source:Uni... [more]
mod-51.028e-3434.91Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-111.123e-3035.12Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-36.284e-2730.85Sodium- and chloride-dependent betaine transporter... [more]
snf-66.069e-2428.37Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of Transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntl1.334e-4034.43gene:FBgn0267326 transcript:FBtr0079479[more]
Ntl2.339e-4034.43gene:FBgn0267326 transcript:FBtr0079478[more]
GlyT3.437e-4036.13gene:FBgn0034911 transcript:FBtr0301162[more]
Gat3.880e-3939.43gene:FBgn0039915 transcript:FBtr0089972[more]
SerT2.303e-3734.41gene:FBgn0010414 transcript:FBtr0072362[more]
back to top
BLAST of Transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a51.582e-5538.41solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a51.660e-5538.41solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a51.747e-5538.41solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a93.744e-5040.00solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a94.200e-5040.00solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A57.609e-5940.71solute carrier family 6 member 5 [Source:NCBI gene... [more]
SLC6A51.008e-5840.71solute carrier family 6 member 5 [Source:NCBI gene... [more]
SLC6A58.768e-5840.71solute carrier family 6 member 5 [Source:NCBI gene... [more]
SLC6A58.924e-5840.71solute carrier family 6 member 5 [Source:NCBI gene... [more]
SLC6A52.461e-5440.86solute carrier family 6 member 5 [Source:NCBI gene... [more]
back to top
BLAST of Transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a57.268e-5940.36solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.268e-5940.36solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.268e-5940.36solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a94.934e-5541.16solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a96.410e-5441.16solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of Transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q761V0|SC6A5_MOUSE6.193e-5840.36Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT9.697e-5840.36Sodium- and chloride-dependent glycine transporter... [more]
sp|A7Y2X0|SC6A5_XENLA1.246e-5742.14Sodium- and chloride-dependent glycine transporter... [more]
sp|Q9Y345|SC6A5_HUMAN1.832e-5740.00Sodium- and chloride-dependent glycine transporter... [more]
sp|A7Y2W8|SC6A9_XENLA2.671e-5642.03Sodium- and chloride-dependent glycine transporter... [more]
back to top
BLAST of Transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIU51.744e-11654.93Transporter OS=Schmidtea mediterranea OX=79327 GN=... [more]
A0A419PIS61.376e-10951.69Sodium-and chloride-dependent glycine transporter ... [more]
A0A183AJP81.897e-10951.27Uncharacterized protein OS=Echinostoma caproni OX=... [more]
G7Y7I21.509e-10851.69Transporter OS=Clonorchis sinensis OX=79923 GN=CLF... [more]
A0A4S2LK801.967e-10851.69Transporter OS=Opisthorchis felineus OX=147828 GN=... [more]
back to top
BLAST of Transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a91.826e-5141.82solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.875e-5141.82solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a145.628e-4838.52solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a37.016e-4636.10solute carrier family 6 member 3 [Source:NCBI gene... [more]
si:ch211-117c9.52.815e-4139.33sodium- and chloride-dependent creatine transporte... [more]
back to top
BLAST of Transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a3.547e-4138.11solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
ENSPMAT00000004857.15.513e-4140.30pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
slc6a4b2.691e-3836.40solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.11.807e-3439.00pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000001703.15.333e-2732.44pep scaffold:Pmarinus_7.0:GL480466:142226:145960:1... [more]
back to top
BLAST of Transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315451.808e-5446.22Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO492183.489e-4941.83Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO397084.913e-4536.50Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
EDO397077.673e-4438.25Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO401512.744e-3936.63Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
back to top
BLAST of Transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a55.023e-5439.49solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a91.262e-5137.20solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.785e-5137.20solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.785e-5137.20solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a23.979e-4636.10solute carrier family 6 member 2 [Source:NCBI gene... [more]
back to top
BLAST of Transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003011.10.000e+0100.00SMESG000003011.1[more]
SMESG000050382.14.747e-12054.93SMESG000050382.1[more]
SMESG000050382.14.849e-12054.93SMESG000050382.1[more]
SMESG000009986.15.328e-8442.42SMESG000009986.1[more]
SMESG000009987.11.471e-8144.78SMESG000009987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033804 ID=SMED30033804|Name=Transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1608bp
AATTGTTGTCGCGATGCTGTTATTGTTGCGTTAATCAATTGTGCAACGTC
GGTTTTTGCAGGATTTGTGATATTTGCAAATCTCGGTTTCATGGCCAATA
TGAAAAATGTGACAATTGACAAAGTTGCTAAAGGAGGTCCTGGGTTAGCC
TTTATTGTCTACCCTGAAGCATTATCAAATATGCCAATGGCTCCGTTGTG
GTCAATTTTATTTTTCTTCATGATGTTGACTCTAGGATTTGGCTCGCAAT
TTTCAATGGTGGAAACGGTCATGTCAGGGTTTCAGGATGAGCTTATGAGG
GCCGGAATCATATCAAGTGAGAAATTCCGAAAAACTTTCAGAGTAATGGT
ATGCGTGGTTGGATTCGCCCTGGGAATTCCGATGATCTGTAACGGAGGAA
TTTATTTGCTCACTTTACTGGACTGGACTGTCAGTGGTTACCCTCTTTTA
ATTCTTGGTTTGATGGAGATTCTTGTAATTTGTTATTTTTATGGTATTCG
ACAATTTAAAAAAGATATCTCTTTGATGACAGGAGGCAGACCGAATTGGT
ATTGGAGAATAACTTGGCTCATTATTACCCCAATTGTTATGGTGTTCCTG
TTGGTATTTTACTTTGCCGCAGGCTCATCTCTACAGTATGGAGATTATAA
ATATCCTAGGTCGTGGCTGTATTTTGCTCAATTTGTCGCATTAGTACCGA
TGTTGTTTATCCCATACATGTTCATGCAAAGGTATTGCCGTGATGGGGGA
TTTATTCTGTTGAAAGAGTACATGAAGCCGTCCTCAGACTGGGGGCCAGC
AGAACAGAATAATAGAGCAGAATTCATTGACCTCATTAGATCTAATGAAT
CTTTGAAAAAAAAATGTTTTATTCGTAATCCTAATGATGAAAACGGAGAA
GAAAATGAAGAAACTAAATTTTTCCAAAGCAAACAAAGCATTATCGATAA
ACTAAATCGTGCCGCCACGAAAGAGATTATAAAGAACAACAGTTTCATAG
GTAGTGAATTCCAGCTCAATAAAAAGAATTCTATGTCATCTCCGCCCGAT
GAGAAACTGATTAAAAGTGCATGTAACTTGGCATCTGCGGCTTTAAAATG
ATAGATGTACTAAATAATAAATATAACTCATGTTCCATTTCTTTATATTC
GGTGAAGTGCATCAGAATTGATAATTATTTGCACTGAAAAACTTGATCAC
CAGTCCTGCTGTAATTGTCTTCAACGACATTTTTTGATTCGATAAATTTT
AATGTTTTGTGTGTGCAGACGTGCAAGTGTCGGGACGTGTGAGTGTGCGC
CAATTAAATGAATGTAGTGTGTATTCTGTGTCAACGTTAGTGTTAGCCTG
TTGTATTCATCATCATCATCATCATCATCATCATGCTGTTTCATTCGATG
AGGTTTTGTCTAGTTTTCATTTTTTGTTCAAATAGGCATTCATTATAATT
ATTATGATTACTTGATAAATATCATGCAAAGATTTCTGATAATAATCGCA
AATAATTTGGGATACAGTATACGGGCTTGAATAATAACTTCAATTTGGAG
TTATTATTCTAAGTTGTGTGAAGGACGGCTTTTCCCTATTATATAATAAT
GCCGACAA
back to top

protein sequence of SMED30033804-orf-1

>SMED30033804-orf-1 ID=SMED30033804-orf-1|Name=SMED30033804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=367bp
NCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLA
FIVYPEALSNMPMAPLWSILFFFMMLTLGFGSQFSMVETVMSGFQDELMR
AGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLL
ILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFL
LVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGG
FILLKEYMKPSSDWGPAEQNNRAEFIDLIRSNESLKKKCFIRNPNDENGE
ENEETKFFQSKQSIIDKLNRAATKEIIKNNSFIGSEFQLNKKNSMSSPPD
EKLIKSACNLASAALK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
GO:0015293symporter activity
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 3..23
score: 46.99
coord: 182..202
score: 25.14
coord: 57..76
score: 54.75
coord: 142..162
score: 34.04
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 1..243
e-value: 1.4E-67
score: 228.6
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 1..280
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 1..246
score: 38.835
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 1..280
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 219..238
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 113..135
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 1..243