SMED30033802

Overview
NameSMED30033802
Smed IDSMED30033802
Length (bp)1205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30033802 (SMED30033802) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30033802 (SMED30033802) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30033802 vs. Ensembl Celegans
Match: ZC53.4 (pep chromosome:WBcel235:X:1925750:1937689:1 gene:WBGene00022511.1 transcript:ZC53.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC53.4)

HSP 1 Score: 94.3597 bits (233), Expect = 4.476e-32
Identity = 61/185 (32.97%), Postives = 94/185 (50.81%), Query Frame = -2
Query:  308 LADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKSDENTE-----------LLYIDINNLYGWALSQPLPCGEFEWIHQDLENIL-----------EQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLLLT 796
            +AD FE FR  S+   +L+   +F  PG++W ++L   +  +  L D+EMY   E+GIRGG++   K Y K +               LLY+D NNLYGWA+ Q LP G+F++  Q L +IL           +    +   + G   EVD++ P EIH   +D P   E + + +  ++KL  T
Sbjct: 1117 IADVFENFRALSLRVYQLDPCWYFTSPGLAWDAMLKKTKVELDKLHDVEMYLMIEKGIRGGIVNAVKRYSKVNNKYTKNFNEKQLTNFLLYLDANNLYGWAMCQMLPTGDFKFETQSLISILNGEAEVKSDLKDYINYLKKLDRGCIFEVDLEYPKEIHSRHNDSPLCPENVKIDNHVIKKLCNT 1301          

HSP 2 Score: 62.7734 bits (151), Expect = 4.476e-32
Identity = 35/99 (35.35%), Postives = 65/99 (65.66%), Query Frame = -1
Query:    3 KRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVEXXXXXXXXXLCNSKTKMMTYASKRSFR 299
            +  YV+H+  L   + LG+++ KIH  I F ++     Y++ NT  R  +++D +K +YK +NNS++GKT+EN+++R+++RL   + K+   ASK +F+
Sbjct: 1305 REKYVIHYENLLQCLQLGLKLKKIHRIITFKESNWLASYIEMNTNPRKNAKNDFEKDFYKLMNNSVFGKTMENVRERVDVRLVTDEDKIKKLASKPNFK 1403          
BLAST of SMED30033802 vs. Ensembl Celegans
Match: H12I13.3 (pep chromosome:WBcel235:II:6071386:6073251:-1 gene:WBGene00019192.1 transcript:H12I13.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H12I13.3)

HSP 1 Score: 52.373 bits (124), Expect = 3.818e-7
Identity = 21/55 (38.18%), Postives = 39/55 (70.91%), Query Frame = -1
Query:   84 GVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 248
            G+++ KIH  + F ++   KKY+  NT  R ++++D +K ++K +NNS++GKT+E
Sbjct:  299 GLKLKKIHRILTFKESAWMKKYIMLNTNLRKQAKNDFEKDFFKLMNNSVFGKTME 353          
BLAST of SMED30033802 vs. TrEMBL
Match: A0A4Y2ETR7 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_91292_1 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 9.314e-55
Identity = 74/219 (33.79%), Postives = 124/219 (56.62%), Query Frame = -2
Query:  341 LEETYELPP--------IWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNK-----------HYVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCL 940
             EET +LPP        +  G+++ +YE AQN+W     + L +Y  +Y+K DV LL+D FE FR  +    +L++++    PG++W + L   +  + L  D++M+ F E+ IRGG+  ++            +Y  S+ N  + Y+D NNLYGWA+SQPLP  +FEW+  +  ++ + C+       GY +EVD++ P E+HD  ++ P A E+M +
Sbjct:  882 FEET-QLPPRSAFHSSLVNEGISEADYEHAQNVWKCFEIKNLGEYHDLYVKTDVILLSDVFENFRKLTQNFYQLDAVHMLTSPGLAWQAALKMTDVKLDLFTDIDMHLFIEKMIRGGVSMISHRHSEANHPQCPNYDASEANKYITYLDANNLYGWAMSQPLPVSDFEWLSPEEISLQQICQTPDDATTGYILEVDMEYPPELHDLHNNYPLAPERMTI 1099          

HSP 2 Score: 72.4034 bits (176), Expect = 9.314e-55
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = -1
Query:   84 SETFV-NT*KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 326
            SE  V N   K+NYV+H+R LK+++ LG++++KIH  +KF Q    K Y++ NT+ R  +++  +K ++K LNN++YGKT+E
Sbjct: 1123 SEKLVPNLCNKQNYVLHYRNLKLYLSLGLKLIKIHRVMKFTQRCWLKDYINFNTEQRKHAKTAFEKDFFKLLNNAVYGKTME 1204          

HSP 3 Score: 51.2174 bits (121), Expect = 9.314e-55
Identity = 32/96 (33.33%), Postives = 50/96 (52.08%), Query Frame = -3
Query:  946 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKK---ITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIIN-------SKGIFPYDYAESL 1203
            H++  G+ +     IS IP   EK ++     +K   +T++FIDS+QF+N SL + V+ L       S+ Q CI +        KGI+PY+Y  S 
Sbjct:  786 HLIMQGLGKLQDHEISVIPNNMEKYISFSIRRRKENPVTLQFIDSFQFLNTSLQKLVENLDRSKF--SIMQSCISSPHRDLLLKKGIYPYEYMSSF 879          
BLAST of SMED30033802 vs. TrEMBL
Match: A0A4Y2FCD8 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_49753_1 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.610e-54
Identity = 76/219 (34.70%), Postives = 124/219 (56.62%), Query Frame = -2
Query:  341 LEETYELPP--------IWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGL-IFVNKH----------YVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCL 940
             EET +LPP        +  G+++ +YE AQN+W     + L +Y  +++K DV LL+D FE FR  +    +L++ +    PG++W   L   +  + L  D++M+ F E+GIRGG+ I  ++H          Y  S+ N  + Y+D NNLYGWA+SQPLP  +FEW+  +  ++ + C+       GY +EVD++ P E+HD  ++ P A E+M +
Sbjct:  111 FEET-QLPPRSAFHSSLVNEGISEADYEHAQNVWKCFEIKNLGEYHYLHVKTDVILLSDVFENFRKLTQNFYQLDAAHMLTSPGLAWQEALKMTDVKLDLFTDIDMHLFIEKGIRGGVSIISHRHSEANHPQCPNYDASEANKYITYLDANNLYGWAMSQPLPVSDFEWLSPEEISLQQICQTPDDTTTGYILEVDMEYPPELHDLHNNYPLATERMTI 328          

HSP 2 Score: 71.633 bits (174), Expect = 1.610e-54
Identity = 36/82 (43.90%), Postives = 57/82 (69.51%), Query Frame = -1
Query:   84 SETFV-NT*KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 326
            SE  V N   K+NYV+H+R LK+++ LG+++ KIH  +KF Q    K Y++ NT+ R  ++S  +K ++K LNN++YGKT+E
Sbjct:  352 SEKLVPNLCNKQNYVLHYRNLKLYLSLGLKLTKIHRVMKFTQRCWLKDYINFNTEQRKHAKSAFEKDFFKLLNNAVYGKTME 433          

HSP 3 Score: 53.5286 bits (127), Expect = 1.610e-54
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = -3
Query:  946 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKK---ITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIIN-------SKGIFPYDYAESL 1203
            H++ +G+ +     IS IP   EK ++     +K   +T++FIDS+QF+N SL + V+ L +     S+ Q CI +        KGI+PY+Y  S 
Sbjct:   15 HLIMHGLGKLQDHEISVIPNNMEKYISFSIRRRKENPVTLQFIDSFQFLNTSLQKLVENLDHSKF--SIMQSCISSPHRDLLLKKGIYPYEYMSSF 108          
BLAST of SMED30033802 vs. TrEMBL
Match: A0A4Y2VQ51 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_157213_1 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.744e-54
Identity = 76/219 (34.70%), Postives = 125/219 (57.08%), Query Frame = -2
Query:  341 LEETYELPP--------IWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVN-KH----------YVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCL 940
             EET +LPP        +  G+++ +YE AQN+W     + L +Y  +Y+K+DV LL+D FE FR  +     L++ +    PG++W + L   +  + L  D++M+ F E+GIRGG+  ++ +H          Y  S+ N  + Y+D NNLYGWA+SQPLP  +FEW+  +  ++ + C+       GY +EVD++ P E+HD  ++ P A E+M +
Sbjct:  750 FEET-QLPPRSAFHSSLVNEGISEADYEHAQNVWKCFEIKNLGEYHDLYVKIDVILLSDVFENFRKLTQNFYRLDAAHMLTSPGLAWQAALKMTDVKLDLFTDIDMHLFIEKGIRGGVSMISHRHSEANHPQCPNYDASEANKYITYLDANNLYGWAMSQPLPVSDFEWLSPEEISLQQICQTPDDATTGYILEVDMEYPPELHDLHNNYPLAPERMTI 967          

HSP 2 Score: 72.0182 bits (175), Expect = 1.744e-54
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = -1
Query:   84 SETFV-NT*KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 326
            SE  V N   K+NYV+H+R LK+++ LG++++KIH  +KF Q    K Y++ NT+ R  +++  +K ++K LNN++YGKT+E
Sbjct:  990 SEKLVPNLYNKQNYVLHYRNLKLYLSLGLKLIKIHRVMKFTQRCWLKDYINFNTEQRKHAKTAFEKDFFKLLNNAVYGKTME 1071          

HSP 3 Score: 51.6026 bits (122), Expect = 1.744e-54
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = -3
Query:  946 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKK---ITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIIN-------SKGIFPYDYAESL 1203
            H++  G+ +     IS IP   EK ++     +K   +T++FIDS+QF+N SL + V+ L +     S+ Q CI +        KGI+PY+Y  S 
Sbjct:  654 HLIMQGLGKLQDHEISVIPNNMEKYISFSIRRRKENPVTLQFIDSFQFLNTSLQKLVENLDHSKF--SIMQSCISSPHRDLLLKKGIYPYEYMSSF 747          
BLAST of SMED30033802 vs. TrEMBL
Match: A0A4Y2LR15 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_266660_1 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.214e-54
Identity = 76/219 (34.70%), Postives = 125/219 (57.08%), Query Frame = -2
Query:  341 LEETYELPP--------IWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVN-KH----------YVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCL 940
             EET +LPP        +  G+++ +YE AQN+W     + L +Y  +Y+K DV LL+D FE FR  +    +L++ +    PG++W + L   +  + L  D++M+ F E+GIRGG+  ++ +H          Y  S+ N  + Y+D NNLYGWA+SQPLP  +FEW+  +  ++ + C+       GY +EVD++ P E+HD  ++ P A E+M +
Sbjct:  774 FEET-QLPPRSAFHSSLVNEGISEADYEHAQNVWKCFEIKNLGEYHDLYVKTDVILLSDVFENFRKLTQNFYQLDAAHMLTSPGLAWQAALKMTDVKLDLFTDIDMHLFIEKGIRGGVSMISHRHSEANHPQCPNYDASEANKYITYLDANNLYGWAMSQPLPVSDFEWLSPEKISLQQICQTPDDATTGYILEVDMEYPPELHDLHNNYPLAPERMTI 991          

HSP 2 Score: 72.0182 bits (175), Expect = 2.214e-54
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = -1
Query:   84 SETFV-NT*KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 326
            SE  V N   K+NYV+H+R LK+++ LG++++KIH  +KF Q    K Y++ NT+ R  +++  +K ++K LNN++YGKT+E
Sbjct: 1015 SEKLVPNLCNKQNYVLHYRNLKLYLSLGLKLIKIHRVMKFTQRCWLKDYINFNTEQRKHAKTAFEKDFFKLLNNAVYGKTME 1096          

HSP 3 Score: 50.8322 bits (120), Expect = 2.214e-54
Identity = 31/96 (32.29%), Postives = 51/96 (53.12%), Query Frame = -3
Query:  946 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKK---ITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIIN-------SKGIFPYDYAESL 1203
            H++  G+ +     IS IP   EK ++     +K   +T++F+DS+QF+N SL + V+ L +     S+ Q CI +        KGI+PY+Y  S 
Sbjct:  678 HLIMQGLGKLQDHEISVIPNNMEKYISFSIRRRKENPVTLQFVDSFQFLNTSLQKLVENLDHSKF--SIMQSCISSPHRDLLLKKGIYPYEYMSSF 771          
BLAST of SMED30033802 vs. TrEMBL
Match: A0A4Y2T410 (DNA_pol_B_2 domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_169350_1 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.747e-54
Identity = 76/219 (34.70%), Postives = 125/219 (57.08%), Query Frame = -2
Query:  341 LEETYELPP--------IWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVN-KH----------YVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCL 940
             EET +LPP        +  G+++ +YE AQN+W     + L +Y  +Y+K DV LL+D FE FR  +    +L++ +    PG++W + L   +  + L  D++M+ F E+GIRGG+  ++ +H          Y  S+ N  + Y+D NNLYGWA+SQPLP  +FEW+  +  ++ + C+       GY +EVD++ P E+HD  ++ P A E+M +
Sbjct:  264 FEET-QLPPRSAFHSSLVNEGISEADYEHAQNVWKCFEIKNLGEYHDLYVKTDVILLSDVFENFRKLTQNFYQLDAAHMLTSPGLAWQAALKMTDVKLDLFTDIDMHLFIEKGIRGGVSMISHRHSEANHPQCPNYDTSEANKYITYLDANNLYGWAMSQPLPVSDFEWLSPEEISLQQICQTPDDATTGYILEVDMEYPPELHDLHNNYPLAPERMTI 481          

HSP 2 Score: 72.0182 bits (175), Expect = 3.747e-54
Identity = 35/82 (42.68%), Postives = 58/82 (70.73%), Query Frame = -1
Query:   84 SETFV-NT*KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 326
            SE  V N   K+NYV+H+R LK+++ LG++++KIH  +KF Q    K Y++ NT+ R  +++  +K ++K LNN++YGKT+E
Sbjct:  505 SEKLVPNLCNKQNYVLHYRNLKLYLSLGLKLIKIHRVMKFTQRCWLKDYINFNTEQRKHAKTAFEKDFFKLLNNAVYGKTME 586          

HSP 3 Score: 50.8322 bits (120), Expect = 3.747e-54
Identity = 32/96 (33.33%), Postives = 49/96 (51.04%), Query Frame = -3
Query:  946 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKK---ITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIIN-------SKGIFPYDYAESL 1203
            H +  G+ +     IS IP   EK ++     +K   +T++FIDS+QF+N SL + V+ L       S+ Q CI +        KGI+PY+Y  S 
Sbjct:  168 HFIMQGLGKLQDHEISVIPNNMEKYISFSIRRRKENPVTLQFIDSFQFLNTSLQKLVENLDRSKF--SIMQSCISSPHRDLLLKKGIYPYEYMSSF 261          
BLAST of SMED30033802 vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 113.62 bits (283), Expect = 1.576e-45
Identity = 71/207 (34.30%), Postives = 108/207 (52.17%), Query Frame = -2
Query:  314 VNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKS--------DENTE---LLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLL 901
            +++ +Y+ AQ +W      T+ DY  +YL+ DV LLAD FE FR+  + +  L+   ++  PG++W + L      + LL D +M   +E GIRGG+  ++  + K+        D N     + Y+D NNLYGWA+S+PLP   F W+        ++ K  G       VEVD+  P  +HD  DD P A E   +K  KV KL+
Sbjct: 1097 ISEEDYQHAQKVWETFKMSTMRDYHDLYLESDVLLLADVFENFRDVCLENYGLDPAWYYTAPGLAWDAALKITRVELELLTDCDMLLMFEEGIRGGVSMISTRHSKANNPYMREYDPNLPTKYITYLDANNLYGWAMSKPLPTHGFRWMTD------QELKEWGRHPC--VVEVDMAYPRHLHDSHDDYPLAPE--SIKINKVGKLI 1293          

HSP 2 Score: 70.8626 bits (172), Expect = 1.576e-45
Identity = 30/72 (41.67%), Postives = 49/72 (68.06%), Query Frame = -1
Query:   84 KRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVE 299
            K  YVVH   LK++  LG+++ K+H  I F ++   K Y+D NT  RA++ +D +K ++K +NNS++GKT+E
Sbjct: 1299 KTKYVVHHETLKLYESLGLKVTKVHRGITFEESGWLKTYIDLNTSLRAKATNDFEKDFFKLMNNSVFGKTME 1370          

HSP 3 Score: 37.3502 bits (85), Expect = 1.576e-45
Identity = 27/87 (31.03%), Postives = 40/87 (45.98%), Query Frame = -3
Query:  958 ISCIPTASEKVLTLIDHCK--------------KITIKFIDSYQFINDSLVRAVKTL-----TNLPLTNSVFQGCIINSKGIFPYDY 1161
            I+CIP   EK ++                    K  I+FIDS++F++ SL   VK L      NL +     Q  ++  KG+FPYD+
Sbjct:  984 INCIPNNEEKYISFTKQVVVDRFTNKEGKQVDVKRDIRFIDSFKFMSASLDSLVKNLPRESFKNLTIHYKGEQLQLLLRKGVFPYDW 1070          
BLAST of SMED30033802 vs. Planmine SMEST
Match: SMESG000062279.1 (SMESG000062279.1)

HSP 1 Score: 249.21 bits (635), Expect = 4.747e-121
Identity = 129/231 (55.84%), Postives = 163/231 (70.56%), Query Frame = -2
Query:  281 LCRKLRILEETYELPPIWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQC-KLMGLENL--GYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLLLTH-EKKETMLY 961
              + L +LE T ELPPIW  V+ +EY  AQ IWT+ +CET+LDYM+ YLKLDV+LLADYF+QFR K+IA+N LE LNF              +E+L     DMEM+ FYE GIRGGL FVNKHYV S E+TE LYIDINNLYGWALSQ LP  +F W++  L+++L +C  +  +E L  GYT+EVDIDIPD +H+FL+D P   EKMC  ++KV KL+LTH  KK  +L+
Sbjct: 1580 FAKSLEVLESTTELPPIWGSVSVDEYATAQQIWTQQNCETMLDYMLTYLKLDVFLLADYFQQFRAKAIAYNTLEPLNF--------------MEFL-----DMEMFNFYEGGIRGGLTFVNKHYVASFEDTEFLYIDINNLYGWALSQYLPYADFVWVYDGLDDVLNECMNVADIEILPYGYTMEVDIDIPDYLHNFLNDFPIGPEKMCPPNSKVEKLMLTHWPKKNHVLH 1791          

HSP 2 Score: 115.546 bits (288), Expect = 4.747e-121
Identity = 61/100 (61.00%), Postives = 81/100 (81.00%), Query Frame = -1
Query:    3 KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVEXXXXXXXXXLCNSKTKMMTYASKRSFR 302
             K+N+V+HWRLL++++ LGV ++K+H AIKF QAPIF  Y+D NTK RA+S S+L ++ +K  NNSLYGK+VENLKK +NLRLCNS  KM+ YASK +FR
Sbjct: 1784 PKKNHVLHWRLLRLYLSLGVNVVKVHRAIKFKQAPIFHAYIDKNTKLRAQSTSELYRNLFKLYNNSLYGKSVENLKKWMNLRLCNSDEKMIVYASKPTFR 1883          

HSP 3 Score: 112.079 bits (279), Expect = 4.747e-121
Identity = 52/90 (57.78%), Postives = 70/90 (77.78%), Query Frame = -3
Query:  934 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKKITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIINSKGIFPYDYAESLEFLK 1203
            HILKYG+N F    ++ IPT +EK ++LI +  K+ ++FIDS QFIN SL +AVKTLT+LPLT+SVF G I+ +K IFPYD+A+SLE L+
Sbjct: 1499 HILKYGLNNFSSWELNIIPTTTEKFISLIAYINKLPVRFIDSMQFINSSLAKAVKTLTDLPLTDSVFDGAIVRAKAIFPYDFAKSLEVLE 1588          
BLAST of SMED30033802 vs. Planmine SMEST
Match: SMESG000053372.1 (SMESG000053372.1)

HSP 1 Score: 251.136 bits (640), Expect = 3.070e-119
Identity = 125/220 (56.82%), Postives = 158/220 (71.82%), Query Frame = -2
Query:  293 ILEETYELPPIWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCK-LMGLENL--GYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLLLTHEKKE 943
            +LE TYELPPIW GV+++EY+KAQ IWT+ +C TL DYM+IYLKLDV+LLADYF+QFR K+I +N LE LNF+GIPG                        FYE GIRGGL FVNKHY+ + E+TELLYIDINNLYGWALSQ LP  +F W++  L+ +L +C  ++ +E L  GYT+EVDI+IPD +HDFL+D P   EKMC  ++KV KL+LTH  K+
Sbjct: 1276 VLETTYELPPIWEGVSEDEYDKAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGHGNVQ-------------------FYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDGLDEVLNECANVVDIEILPYGYTMEVDIEIPDNLHDFLNDFPIGPEKMCPPNSKVEKLMLTHYPKK 1476          

HSP 2 Score: 111.694 bits (278), Expect = 3.070e-119
Identity = 53/90 (58.89%), Postives = 72/90 (80.00%), Query Frame = -3
Query:  934 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKKITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIINSKGIFPYDYAESLEFLK 1203
            HILKYG++RF   N+  IPT++EK ++LI H  K+ ++FIDS QF+N SL +AVKTLT+LPLT+SVFQG I++ KGIFPY++A S E L+
Sbjct: 1189 HILKYGLDRFLSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLE 1278          

HSP 3 Score: 107.457 bits (267), Expect = 3.070e-119
Identity = 58/100 (58.00%), Postives = 78/100 (78.00%), Query Frame = -1
Query:    3 KKRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVEXXXXXXXXXLCNSKTKMMTYASKRSFR 302
             K+NYV+HWRLL++++ LG ++  IH AIK+ QAP FK Y+D NT  RA + S+L +  +K  NNSLYGK+VENLKKR+NLRLCNS  K++TY+SK +FR
Sbjct: 1474 PKKNYVLHWRLLRLYLSLGAKVTHIHRAIKYKQAPTFKHYIDKNTNLRANAVSELYRDLFKLYNNSLYGKSVENLKKRMNLRLCNSAEKLITYSSKPAFR 1573          
BLAST of SMED30033802 vs. Planmine SMEST
Match: SMESG000051837.1 (SMESG000051837.1)

HSP 1 Score: 241.891 bits (616), Expect = 2.044e-118
Identity = 123/231 (53.25%), Postives = 158/231 (68.40%), Query Frame = -2
Query:  281 LCRKLRILEETYELPPIWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCK-LMGLENL--GYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLLLTH-EKKETMLY 961
              + L +LE T ELP IW  V+ +EY  AQ IWT+ +CET+LDYM+ YLKLDV+LL DYF+QFR K+IA+N LE LNF+GIPG+SW+S LMTL+  I LLQDMEM+ FYE GIRGGL FVNKHY                    AL+Q  P  +F W++  L+N+L +C  ++ +E L  GYT+EVDI+IPD +HDFL+D P   EKMC   +KV KL+LTH  KK  +L+
Sbjct:  446 FAKSLEVLESTTELPAIWGSVSADEYATAQQIWTQQNCETMLDYMLTYLKLDVFLLVDYFQQFRAKAIAYNTLEPLNFYGIPGMSWASALMTLQEPIELLQDMEMFNFYEGGIRGGLTFVNKHY--------------------ALNQYFPYADFVWVNDGLDNVLSECANVVDIEILPYGYTMEVDIEIPDNLHDFLNDFPIGPEKMCPPSSKVEKLMLTHWPKKNHVLH 656          

HSP 2 Score: 117.087 bits (292), Expect = 2.044e-118
Identity = 63/99 (63.64%), Postives = 82/99 (82.83%), Query Frame = -1
Query:    3 KRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVEXXXXXXXXXLCNSKTKMMTYASKRSFR 299
            K+N+V+HWRLLK+++ LGV+++K+H AIKF QAPIF  Y+D NTK RA+S S+L +  +K  NNSLYGK+VENLKKR+NLRLCNS  KM+ YASK +FR
Sbjct:  650 KKNHVLHWRLLKLYLSLGVKVVKVHRAIKFKQAPIFHAYIDKNTKLRAQSTSELYRDLFKLYNNSLYGKSVENLKKRMNLRLCNSDEKMIVYASKPTFR 748          

HSP 3 Score: 108.997 bits (271), Expect = 2.044e-118
Identity = 50/90 (55.56%), Postives = 68/90 (75.56%), Query Frame = -3
Query:  934 HILKYGINRFPQ*NISCIPTASEKVLTLIDHCKKITIKFIDSYQFINDSLVRAVKTLTNLPLTNSVFQGCIINSKGIFPYDYAESLEFLK 1203
            HILKYG+N F    ++ IPT +EK ++LI +  K+ ++FIDS QF+N SL +AVKTLT+LPLT+ VF G I  +K IFPYD+A+SLE L+
Sbjct:  365 HILKYGLNNFSSWELNIIPTTTEKFISLIAYINKLPVRFIDSMQFVNSSLAKAVKTLTDLPLTDPVFDGAIFRAKAIFPYDFAKSLEVLE 454          
BLAST of SMED30033802 vs. Planmine SMEST
Match: SMESG000076680.1 (SMESG000076680.1)

HSP 1 Score: 284.263 bits (726), Expect = 6.425e-117
Identity = 144/221 (65.16%), Postives = 172/221 (77.83%), Query Frame = -2
Query:  293 LRILEETYELPPIWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENL--GYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLLLTHEKKE 949
            L  LE TYELPPIW GV++ EYEK+Q IWTET C  LLDYMMIYLKLDV+LLAD+F+QFR KSIAHN LE LN+FGIPG+ WSS L+TL+  I   QDME+Y FYE  IRGGL FVNKH+VK+DE TELLYIDINNLY WALSQPLPCG+F WI    ++IL  C  + LE+L  GYT+EV+++IP ++H  LD+   AAEKM  + +KV KLLLTH  K+
Sbjct: 1018 LEFLENTYELPPIWEGVSEVEYEKSQLIWTETKCVNLLDYMMIYLKLDVFLLADFFQQFRAKSIAHNSLEPLNYFGIPGMFWSSALITLDKPI--EQDMEIYNFYEGDIRGGLTFVNKHFVKTDETTELLYIDINNLYDWALSQPLPCGKFSWILDGFDSILSDCFSLNLESLSYGYTLEVNLEIPSDLHYKLDEFSIAAEKMKPEGSKVEKLLLTHYPKK 1236          

HSP 2 Score: 120.168 bits (300), Expect = 6.425e-117
Identity = 63/99 (63.64%), Postives = 86/99 (86.87%), Query Frame = -1
Query:    3 KRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVEXXXXXXXXXLCNSKTKMMTYASKRSFR 299
            K+NYV+HWRLLK+++ L V++  ++ A++F Q+PIFK Y+DTNT+ RA+S + LDK+YYK LNNSLYGKTVENLKKR+NLRLCN++ KM+TYASK +F+
Sbjct: 1235 KKNYVIHWRLLKLYLSLSVKVTHVNRAVRFKQSPIFKNYMDTNTELRAKSTNTLDKNYYKLLNNSLYGKTVENLKKRMNLRLCNTEKKMITYASKPTFQ 1333          

HSP 3 Score: 58.151 bits (139), Expect = 6.425e-117
Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = -3
Query:  934 SLVRAVKTLTNLPLTNSVFQGCIINSKGIFPYDYAESLEFLK 1059
            +L  AVKTLT+LPLT SVF G I+N K IFPY++A SLEFL+
Sbjct:  981 NLRGAVKTLTSLPLTKSVFTGTIVNEKCIFPYNFATSLEFLE 1022          
BLAST of SMED30033802 vs. Planmine SMEST
Match: SMESG000076680.1 (SMESG000076680.1)

HSP 1 Score: 284.263 bits (726), Expect = 6.588e-117
Identity = 144/221 (65.16%), Postives = 172/221 (77.83%), Query Frame = -2
Query:  293 LRILEETYELPPIWNGVNKNEYEKAQNIWTETHCETLLDYMMIYLKLDVYLLADYFEQFRNKSIAHNELESLNFFGIPGVSWSSVLMTLEWLI*LLQDMEMYCFYERGIRGGLIFVNKHYVKSDENTELLYIDINNLYGWALSQPLPCGEFEWIHQDLENILEQCKLMGLENL--GYTVEVDIDIPDEIHDFLDDLPDAAEKMCLKDTKVRKLLLTHEKKE 949
            L  LE TYELPPIW GV++ EYEK+Q IWTET C  LLDYMMIYLKLDV+LLAD+F+QFR KSIAHN LE LN+FGIPG+ WSS L+TL+  I   QDME+Y FYE  IRGGL FVNKH+VK+DE TELLYIDINNLY WALSQPLPCG+F WI    ++IL  C  + LE+L  GYT+EV+++IP ++H  LD+   AAEKM  + +KV KLLLTH  K+
Sbjct: 1000 LEFLENTYELPPIWEGVSEVEYEKSQLIWTETKCVNLLDYMMIYLKLDVFLLADFFQQFRAKSIAHNSLEPLNYFGIPGMFWSSALITLDKPI--EQDMEIYNFYEGDIRGGLTFVNKHFVKTDETTELLYIDINNLYDWALSQPLPCGKFSWILDGFDSILSDCFSLNLESLSYGYTLEVNLEIPSDLHYKLDEFSIAAEKMKPEGSKVEKLLLTHYPKK 1218          

HSP 2 Score: 120.168 bits (300), Expect = 6.588e-117
Identity = 63/99 (63.64%), Postives = 86/99 (86.87%), Query Frame = -1
Query:    3 KRNYVVHWRLLKIFMMLGVQILKIHIAIKFNQAPIFKKYVDTNTKFRAESRSDLDKSYYKFLNNSLYGKTVEXXXXXXXXXLCNSKTKMMTYASKRSFR 299
            K+NYV+HWRLLK+++ L V++  ++ A++F Q+PIFK Y+DTNT+ RA+S + LDK+YYK LNNSLYGKTVENLKKR+NLRLCN++ KM+TYASK +F+
Sbjct: 1217 KKNYVIHWRLLKLYLSLSVKVTHVNRAVRFKQSPIFKNYMDTNTELRAKSTNTLDKNYYKLLNNSLYGKTVENLKKRMNLRLCNTEKKMITYASKPTFQ 1315          

HSP 3 Score: 57.7658 bits (138), Expect = 6.588e-117
Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = -3
Query:  934 SLVRAVKTLTNLPLTNSVFQGCIINSKGIFPYDYAESLEFLK 1059
            +L  AVKTLT+LPLT SVF G I+N K IFPY++A SLEFL+
Sbjct:  963 NLRGAVKTLTSLPLTKSVFTGTIVNEKCIFPYNFATSLEFLE 1004          
The following BLAST results are available for this feature:
BLAST of SMED30033802 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZC53.44.476e-3232.97pep chromosome:WBcel235:X:1925750:1937689:1 gene:W... [more]
H12I13.33.818e-738.18pep chromosome:WBcel235:II:6071386:6073251:-1 gene... [more]
back to top
BLAST of SMED30033802 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2ETR79.314e-5533.79Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2FCD81.610e-5434.70Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2VQ511.744e-5434.70Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2LR152.214e-5434.70Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2T4103.747e-5434.70DNA_pol_B_2 domain-containing protein OS=Araneus v... [more]
back to top
BLAST of SMED30033802 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO461091.576e-4534.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30033802 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033802 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062279.14.747e-12155.84SMESG000062279.1[more]
SMESG000053372.13.070e-11956.82SMESG000053372.1[more]
SMESG000051837.12.044e-11853.25SMESG000051837.1[more]
SMESG000076680.16.425e-11765.16SMESG000076680.1[more]
SMESG000076680.16.588e-11765.16SMESG000076680.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033802 ID=SMED30033802|Name=SMED30033802|organism=Schmidtea mediterranea sexual|type=transcript|length=1205bp
TTTCGAAACGATCTTTTAGAAGCATAAGTCATCATTTTGGTTTTGGAATT
ACAAAGCCTTAAATTTAATCGTTTCTTCAAATTTTCCACTGTTTTTCCAT
AAAGGCTATTATTTAAAAATTTATAATAGCTCTTATCCAAATCACTTCGG
GATTCTGCTCGGAATTTTGTGTTGGTGTCCACATATTTCTTAAATATTGG
AGCTTGATTGAACTTGATTGCTATATGAATCTTTAATATTTGAACACCCA
GCATCATAAAAATCTTTAATAATCGCCAATGTACAACATAGTTTCTTTTT
TTTCATGTGTTAACAAAAGTTTCCGAACCTTTGTATCTTTAAGGCACATC
TTTTCTGCAGCATCAGGTAGATCATCCAAAAAATCATGGATTTCATCAGG
AATATCTATGTCAACCTCTACAGTATATCCGAGGTTTTCAAGACCCATTA
ACTTACATTGTTCTAGAATATTCTCCAAATCTTGATGAATCCATTCAAAT
TCTCCACATGGCAAAGGTTGACTTAAAGCCCACCCATACAAGTTGTTGAT
GTCAATGTACAACAACTCTGTGTTTTCATCCGATTTTACATAATGTTTGT
TGACAAATATCAACCCACCTCTGATTCCTCTTTCATAGAAACAGTACATT
TCCATATCTTGTAACAACTATATAAGCCATTCCAAAGTCATAAGCACTGA
TGACCATGACACACCTGGAATCCCAAAGAAGTTTAATGATTCCAGTTCAT
TGTGTGCTATAGACTTATTGCGAAATTGTTCAAAATAATCAGCTAGAAGA
TATACATCAAGCTTTAAGTATATCATCATGTAGTCTAGCAATGTTTCACA
ATGTGTTTCGGTCCATATGTTCTGAGCCTTTTCATATTCATTTTTATTGA
CTCCATTCCATATTGGTGGTAATTCATAGGTTTCTTCAAGAATTCTAAGC
TTTCTGCATAATCATAAGGAAAAATACCCTTAGAGTTAATGATACATCCT
TGGAAGACTGAATTTGTTAAAGGTAAGTTGGTTAAAGTCTTCACTGCTCG
AACCAATGAATCATTGATAAACTGGTAAGAATCTATGAATTTTATAGTTA
TCTTCTTGCAATGATCGATCAGTGTAAGAACTTTTTCTGATGCTGTTGGA
ATACAACTAATGTTCTATTGAGGAAATCTATTTATTCCATATTTTAATAT
ATGGT
back to top

protein sequence of SMED30033802-orf-1

>SMED30033802-orf-1 ID=SMED30033802-orf-1|Name=SMED30033802-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MEMYCFYERGIRGGLIFVNKHYVKSDENTELLYIDINNLYGWALSQPLPC
GEFEWIHQDLENILEQCKLMGLENLGYTVEVDIDIPDEIHDFLDDLPDAA
EKMCLKDTKVRKLLLTHEKKETMLYIGDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR004868DNA-dir_DNA_pol_B_mt/vir
IPR023211DNA_pol_palm_dom_sf
IPR013019MAD_homology_MH1
Vocabulary: molecular function
TermDefinition
GO:0003887DNA-directed DNA polymerase activity
GO:00084083'-5' exonuclease activity
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006355regulation of transcription, DNA-templated
GO:0007179transforming growth factor beta receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005667transcription factor complex