Sperm associated antigen 1

Overview
NameSperm associated antigen 1
Smed IDSMED30033795
Length (bp)2375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sperm associated antigen 1 (SMED30033795) t-SNE clustered cells

Violin plots show distribution of expression levels for Sperm associated antigen 1 (SMED30033795) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sperm associated antigen 1 (SMED30033795) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sperm associated antigen 1 (SMED30033795) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033795

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033795SMESG000040141.1 SMESG000040140.1 dd_Smed_v4_2532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033795SMESG000040141.1 SMESG000040140.1 dd_Smed_v4_2532_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sperm associated antigen 1 vs. Ensembl Human
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 204.912 bits (520), Expect = 5.775e-58
Identity = 134/347 (38.62%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVI 1102
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V     DK    +    +  ++DTA +T  E++  A  EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + L++A  D  K++ + P+N  A+  LS   ++L   E  S+ + K GKRMVI
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKM---------HFHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI----DKSHLSK----IETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTK-GKRMVI 341          
BLAST of Sperm associated antigen 1 vs. Ensembl Human
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 204.912 bits (520), Expect = 5.775e-58
Identity = 134/347 (38.62%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVI 1102
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V     DK    +    +  ++DTA +T  E++  A  EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + L++A  D  K++ + P+N  A+  LS   ++L   E  S+ + K GKRMVI
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKM---------HFHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI----DKSHLSK----IETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTK-GKRMVI 341          
BLAST of Sperm associated antigen 1 vs. Ensembl Human
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 203.756 bits (517), Expect = 4.075e-54
Identity = 134/347 (38.62%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVI 1102
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V     DK    +    +  ++DTA +T  E++  A  EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + L++A  D  K++ + P+N  A+  LS   ++L   E  S+ + K GKRMVI
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKM---------HFHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI----DKSHLSK----IETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTK-GKRMVI 341          

HSP 2 Score: 79.7221 bits (195), Expect = 1.370e-14
Identity = 78/298 (26.17%), Postives = 131/298 (43.96%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-EP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GNE F++G   EA   Y+ ++++ EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A    N LS  L EL+    P  ++    +    AS                   + A    KE   K+        +    D K+   F  +K+ GNQ   +  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ L   +  +F+RR  A+K +  Y KS+ DL   + + P+
Sbjct:  449 KSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELD---GPNWREKLSPIPAVPASVP-----------------LQAWHPAKEMISKQAGDSSSHRQQGITDEKT---FKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 723          

HSP 3 Score: 56.6102 bits (135), Expect = 1.897e-7
Identity = 40/128 (31.25%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  629 PASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIE-PISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPN 1009
            PA +  SK   D   + +   +  EK     KE+GN+     +  +A+  Y+  L I     A+Y NR L Y+K   +EEA +D    L+    N+KA  RRA  +  + N Q ++ D  K+I L P+
Sbjct:  597 PAKEMISKQAGDS-SSHRQQGITDEKTFKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 723          
BLAST of Sperm associated antigen 1 vs. Ensembl Human
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 203.756 bits (517), Expect = 4.075e-54
Identity = 134/347 (38.62%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVI 1102
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V     DK    +    +  ++DTA +T  E++  A  EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + L++A  D  K++ + P+N  A+  LS   ++L   E  S+ + K GKRMVI
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKM---------HFHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI----DKSHLSK----IETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTK-GKRMVI 341          

HSP 2 Score: 79.7221 bits (195), Expect = 1.370e-14
Identity = 78/298 (26.17%), Postives = 131/298 (43.96%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-EP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GNE F++G   EA   Y+ ++++ EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A    N LS  L EL+    P  ++    +    AS                   + A    KE   K+        +    D K+   F  +K+ GNQ   +  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ L   +  +F+RR  A+K +  Y KS+ DL   + + P+
Sbjct:  449 KSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELD---GPNWREKLSPIPAVPASVP-----------------LQAWHPAKEMISKQAGDSSSHRQQGITDEKT---FKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 723          

HSP 3 Score: 56.6102 bits (135), Expect = 1.897e-7
Identity = 40/128 (31.25%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  629 PASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIE-PISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPN 1009
            PA +  SK   D   + +   +  EK     KE+GN+     +  +A+  Y+  L I     A+Y NR L Y+K   +EEA +D    L+    N+KA  RRA  +  + N Q ++ D  K+I L P+
Sbjct:  597 PAKEMISKQAGDS-SSHRQQGITDEKTFKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 723          
BLAST of Sperm associated antigen 1 vs. Ensembl Human
Match: RPAP3 (RNA polymerase II associated protein 3 [Source:HGNC Symbol;Acc:HGNC:26151])

HSP 1 Score: 108.612 bits (270), Expect = 7.556e-24
Identity = 92/303 (30.36%), Postives = 138/303 (45.54%), Query Frame = 2
Query:  689 NVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKR--SKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
            +V+ +KA VL KEKGN+ FK G  DEA+  YT+ +  +P + V   NR   Y + K +  A  D ++ +  + S  KA  RR +    +  L++A  D  ++++L PNN  A N L    Q L  +  S P+  D                              +V  S E ER  K+I  E Q  K  AI           KD GN  FKE +YE A+  Y + +    +N +   NRA   L +++  +  +DCT AI LD +   +F RRG A   +G  +++  D E  L + P + Q
Sbjct:  127 HVDSQKALVL-KEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKEAD------------------------------IVIKSTEGER--KQI--EAQQNKQQAISE---------KDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQ 385          

HSP 2 Score: 64.3142 bits (155), Expect = 5.912e-10
Identity = 33/114 (28.95%), Postives = 64/114 (56.14%), Query Frame = 2
Query: 1247 DAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
            D I   S+   + +K+ GN+ FK+ +Y++A+  Y K +D  P NP+   NRA+    L++      DC +A+ L+++   ++ RRG A   +   +++  D E  L++ PN+++
Sbjct:  124 DGIHVDSQKALV-LKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFE 236          

HSP 3 Score: 62.7734 bits (151), Expect = 1.748e-9
Identity = 37/115 (32.17%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  695 EREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLS 1036
            + ++ A+ EK++GN  FK G  + A+  YTR ++ +  +A+   NR + Y+K + +EEA +D +  +  D S  KA  RR +  + +  L +A  D   ++ L P NK A   LS
Sbjct:  277 QNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELS 391          
BLAST of Sperm associated antigen 1 vs. Ensembl Celegans
Match: rpap-3 (Rna (RNA) Polymerase II Associated Protein homolog [Source:UniProtKB/TrEMBL;Acc:Q18405])

HSP 1 Score: 74.7146 bits (182), Expect = 2.414e-14
Identity = 35/101 (34.65%), Postives = 63/101 (62.38%), Query Frame = 2
Query: 1283 KIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKIS--PN 1579
            ++K+ GN+ FK+ +Y  A+ IY+K ++ WP +PI + NRA   L  + P+    DCT A++LD  +  +++RR +A+K + +Y+ +  D++   K S  PN
Sbjct:   10 RLKEQGNEAFKKKKYHKAMTIYSKSLEHWP-DPIVFSNRAQAGLNADLPLLAQIDCTAALNLDSTAAKAYYRRAQAFKALELYELAERDMKTCFKYSNDPN 109          
BLAST of Sperm associated antigen 1 vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 70.0922 bits (170), Expect = 3.280e-12
Identity = 36/116 (31.03%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  695 EREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSIC 1042
            E+EKA ++ K++ N+ FK    D A   Y+ ++ I P + +Y NR   Y+K++ +  A+ D    +  DPS +K   RRA+    +   + A+TD + ++K+ PN+K A      C
Sbjct:   25 EKEKAGMI-KDEANQFFKDQVYDVAADLYSVAIEIHPTAVLYGNRAQAYLKKELYGSALEDADNAIAIDPSYVKGFYRRATANMALGRFKKALTDYQAVVKVCPNDKDARAKFDEC 139          

HSP 2 Score: 55.0694 bits (131), Expect = 1.607e-7
Identity = 32/98 (32.65%), Postives = 52/98 (53.06%), Query Frame = 2
Query: 1286 IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            IKD  NQ FK+  Y+ A  +Y+  ++  P+  + Y NRA   L  E     +ED   AI +D +    F+RR  A   +G + K+++D +  +K+ PN
Sbjct:   32 IKDEANQFFKDQVYDVAADLYSVAIEIHPT-AVLYGNRAQAYLKKELYGSALEDADNAIAIDPSYVKGFYRRATANMALGRFKKALTDYQAVVKVCPN 128          
BLAST of Sperm associated antigen 1 vs. Ensembl Celegans
Match: fkb-6 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O45418])

HSP 1 Score: 55.0694 bits (131), Expect = 1.260e-7
Identity = 45/156 (28.85%), Postives = 74/156 (47.44%), Query Frame = 2
Query:  674 TAKMTNVEREKAAVLEKEKGNEAFKAGDLD---------EAVIYYTRSLSIEPIS-------AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSIC---LQELEKRSKPRLKD 1084
            T +MT  E+  AA   K++G    + G+L          E V+ Y +S   E ++         Y N  LV  KQ    E I+     L+  P N+KAL R+A+    ++ ++DA+    KI+++ P NK A   + +C   ++E  +R K R K+
Sbjct:  242 TWEMTAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNGAYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQNERDKKRFKN 397          
BLAST of Sperm associated antigen 1 vs. Ensembl Celegans
Match: fkb-6 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O45418])

HSP 1 Score: 55.0694 bits (131), Expect = 1.260e-7
Identity = 45/156 (28.85%), Postives = 74/156 (47.44%), Query Frame = 2
Query:  674 TAKMTNVEREKAAVLEKEKGNEAFKAGDLD---------EAVIYYTRSLSIEPIS-------AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSIC---LQELEKRSKPRLKD 1084
            T +MT  E+  AA   K++G    + G+L          E V+ Y +S   E ++         Y N  LV  KQ    E I+     L+  P N+KAL R+A+    ++ ++DA+    KI+++ P NK A   + +C   ++E  +R K R K+
Sbjct:  242 TWEMTAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNGAYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQNERDKKRFKN 397          
BLAST of Sperm associated antigen 1 vs. Ensembl Celegans
Match: sti-1 (Stress-induced-phosphoprotein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16259])

HSP 1 Score: 53.5286 bits (127), Expect = 2.907e-7
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            K+ GN+ FK+  Y  A+  YN+ V   P N I Y NRAAC   L    + ++DC   I LD      + R+      +  + K+    E AL++ P++ + ++
Sbjct:  144 KNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEARE 246          

HSP 2 Score: 53.5286 bits (127), Expect = 3.150e-7
Identity = 32/111 (28.83%), Postives = 55/111 (49.55%), Query Frame = 2
Query:  719 EKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAV-YNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQ 1048
            EK KGNE FK GD   A+ +Y  ++  +P +A+ Y+NR     K   ++ A+ D    ++ D   IK   R+A+C   +     A       +++ P+N+ A   +  CL+
Sbjct:  143 EKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLR 253          
BLAST of Sperm associated antigen 1 vs. Ensembl Fly
Match: Spag1 (gene:FBgn0039463 transcript:FBtr0085068)

HSP 1 Score: 128.642 bits (322), Expect = 3.411e-31
Identity = 114/370 (30.81%), Postives = 181/370 (48.92%), Query Frame = 2
Query:   59 ESCESLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEV-----NNNFP-IRKMQSVKLGNSNDQDLKTHSGXXXXXXXX--------XXDYNEWSKI-ADELEKQMILEEKEES----------SKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAV--YNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAEN---HLSICLQELEKRSKPRL 1078
            E  +SL + + IPI YLD+ H+EKCTN  E+EKI   L+SGEEG YP L+   E++L+ L PDS++ R   ++     LD +  + I+     W + I + D +L          NE+     N N P +RK+  + L   +  +    + K +  S            DY +W K   DE   +M L E+ +           SKSV T   DK  S+R+S     +     ++ +E+E+ A   + +GNE+FKA + + A+  Y  S+  +P +AV  YNNR + ++K K +  AI D    L+ DP NIKA  R A  ++      +++   +K++   P+N  A+     L+  L E+   S  RL
Sbjct:    4 EKKKSLLERYNIPIHYLDFAHVEKCTNAREMEKIVQILRSGEEGHYPDLQRCAEEKLKALKPDSKLFRYEEQIKQSTDLDKTELKPIL----DWTDAIKTKDNAL----------NELKKVKQNLNLPSVRKLSKIDLEKESKTEKPKPAPKATSPSNTKNKEARIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHSKSVTT---DKLQSERDSLYERLQAQLKNLSQLEKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLESLNVYKKLLDFEPDNAIAKKAVEKLTSMLGEVAPSSATRL 356          
BLAST of Sperm associated antigen 1 vs. Ensembl Fly
Match: Fkbp59 (gene:FBgn0029174 transcript:FBtr0079872)

HSP 1 Score: 72.7886 bits (177), Expect = 4.475e-13
Identity = 47/137 (34.31%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  680 KMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPIS------------AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL 1054
            K+++ ER   A + KEKG   FK  +   A+  YT+  +I P +            A ++N  L + K  +  EA ++ +  L  D +N+KAL RR  C   I+ L+DA+ D +K+I+L P NK A N + IC Q+L
Sbjct:  242 KLSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVKKIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKL 378          
BLAST of Sperm associated antigen 1 vs. Ensembl Fly
Match: Fkbp59 (gene:FBgn0029174 transcript:FBtr0342837)

HSP 1 Score: 72.7886 bits (177), Expect = 4.475e-13
Identity = 47/137 (34.31%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  680 KMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPIS------------AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL 1054
            K+++ ER   A + KEKG   FK  +   A+  YT+  +I P +            A ++N  L + K  +  EA ++ +  L  D +N+KAL RR  C   I+ L+DA+ D +K+I+L P NK A N + IC Q+L
Sbjct:  242 KLSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVKKIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKL 378          
BLAST of Sperm associated antigen 1 vs. Ensembl Fly
Match: unc-45 (gene:FBgn0010812 transcript:FBtr0081788)

HSP 1 Score: 71.633 bits (174), Expect = 2.253e-12
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI----EPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRS 1066
            K+KGNEAFKA   +EAV +Y +++      + ++  Y NR   Y+K   +E A+ D + +LK  P + KAL RRA  Y  +   ++A  D   + K  P NK  +  L      +E+RS
Sbjct:   17 KDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERS 135          

HSP 2 Score: 56.9954 bits (136), Expect = 6.849e-8
Identity = 33/120 (27.50%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 1244 SDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSN---PIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            ++ I+S+  S+    KD GN+ FK  R+E+A+  Y K +     +    + Y+NRAA  L L +    +EDCT ++        + FRR +AY+ +  ++++  D     K  P +  ++
Sbjct:    2 TNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQ 121          
BLAST of Sperm associated antigen 1 vs. Ensembl Fly
Match: unc-45 (gene:FBgn0010812 transcript:FBtr0347497)

HSP 1 Score: 71.633 bits (174), Expect = 2.253e-12
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI----EPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRS 1066
            K+KGNEAFKA   +EAV +Y +++      + ++  Y NR   Y+K   +E A+ D + +LK  P + KAL RRA  Y  +   ++A  D   + K  P NK  +  L      +E+RS
Sbjct:   17 KDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERS 135          

HSP 2 Score: 56.9954 bits (136), Expect = 6.849e-8
Identity = 33/120 (27.50%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 1244 SDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSN---PIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            ++ I+S+  S+    KD GN+ FK  R+E+A+  Y K +     +    + Y+NRAA  L L +    +EDCT ++        + FRR +AY+ +  ++++  D     K  P +  ++
Sbjct:    2 TNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQ 121          
BLAST of Sperm associated antigen 1 vs. Ensembl Zebrafish
Match: spag1b (sperm associated antigen 1b [Source:ZFIN;Acc:ZDB-GENE-061013-512])

HSP 1 Score: 126.331 bits (316), Expect = 6.705e-30
Identity = 83/287 (28.92%), Postives = 142/287 (49.48%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAK-MTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRA 934
            S    +P+ +LDY  I+ C+++ +LE+I   L+SG+EG YPHL  FCE+R++ L+P S  LR      +           I  D Q W   +   + +L +  +  + +       P+R   S ++  +N +  KT      K SC P+ Y +W +              +  S       R+ PA+      +  ++ +   +T  E++ AA+ EK+KGNEA+++ D +EA+ YY RSLS+   +AV+NNR    ++ + W  A+ D    L+ +P NIK  Q++ 
Sbjct:    7 SSCVSVPVEHLDYSFIQSCSDLKQLEQILRVLRSGQEGVYPHLIGFCERRIETLNPKSAELRTENHPHTAACYTEEEWRSITEDLQVWERSVRMTEAALMRSSIFSSEECVP----PVRS--SHRVLQTNQEKKKT-----VKTSCTPRPYTDWDRF-------------DVDSACAGESVRNAPAAAAVCPEVQQRLSSCTALTAQEKQTAALREKDKGNEAYRSRDYEEALDYYCRSLSLASSAAVFNNRAQTLIRLQQWPAALSDCDAVLQLEPHNIKGEQQQC 269          
BLAST of Sperm associated antigen 1 vs. Ensembl Zebrafish
Match: tomm34 (translocase of outer mitochondrial membrane 34 [Source:ZFIN;Acc:ZDB-GENE-030131-2081])

HSP 1 Score: 97.8265 bits (242), Expect = 7.466e-22
Identity = 80/300 (26.67%), Postives = 137/300 (45.67%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS---------IEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            K+ GNE FKAG   EAV  Y++++           E +  +Y+NR   Y+K  N  E I+D + +L   P   KAL RRA+ +  +   + A  D + ++++  N   A + ++   + L +   P  ++    + T   S  E   +  +    S++  V+        DDK+     + P  DA+          +K+ GN L K+  ++ A+  Y + +   P+    Y NRA C L L+     I DC  A+ LD  +  + +RR +AYK +      + DL   LKI PN+  ++
Sbjct:   14 KQAGNECFKAGQYGEAVTLYSQAIQQLEKSGQKKTEDLGILYSNRAASYLKDGNCNECIKDCTASLDLVPFGFKALLRRAAAFEALERYRQAYVDYKTVLQIDWNIPAAHDGVNRMTKALTEMDGPSWREKLPPIPTVPMSVKEKLGQAASPASSSQQNNVI--------DDKK-----KAPGPDAVKKGRT-----LKEEGNALVKKGEHKKAMEKYTQSLAQDPTEVTTYTNRALCYLALKMYKDAIRDCEEALRLDSANIKALYRRAQAYKELKNKKSCIEDLNSVLKIDPNNTAVQ 295          

HSP 2 Score: 77.7962 bits (190), Expect = 4.264e-15
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSIEPIS-AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEK 1060
            KE+GN   K G+  +A+  YT+SL+ +P     Y NR L Y+  K +++AIRD    L+ D +NIKAL RRA  Y E+ N +  I D   ++K+ PNN   +      LQE++K
Sbjct:  194 KEEGNALVKKGEHKKAMEKYTQSLAQDPTEVTTYTNRALCYLALKMYKDAIRDCEEALRLDSANIKALYRRAQAYKELKNKKSCIEDLNSVLKIDPNNTAVQK----LLQEVQK 303          
BLAST of Sperm associated antigen 1 vs. Ensembl Zebrafish
Match: tomm34 (translocase of outer mitochondrial membrane 34 [Source:ZFIN;Acc:ZDB-GENE-030131-2081])

HSP 1 Score: 97.8265 bits (242), Expect = 7.466e-22
Identity = 80/300 (26.67%), Postives = 137/300 (45.67%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS---------IEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            K+ GNE FKAG   EAV  Y++++           E +  +Y+NR   Y+K  N  E I+D + +L   P   KAL RRA+ +  +   + A  D + ++++  N   A + ++   + L +   P  ++    + T   S  E   +  +    S++  V+        DDK+     + P  DA+          +K+ GN L K+  ++ A+  Y + +   P+    Y NRA C L L+     I DC  A+ LD  +  + +RR +AYK +      + DL   LKI PN+  ++
Sbjct:   14 KQAGNECFKAGQYGEAVTLYSQAIQQLEKSGQKKTEDLGILYSNRAASYLKDGNCNECIKDCTASLDLVPFGFKALLRRAAAFEALERYRQAYVDYKTVLQIDWNIPAAHDGVNRMTKALTEMDGPSWREKLPPIPTVPMSVKEKLGQAASPASSSQQNNVI--------DDKK-----KAPGPDAVKKGRT-----LKEEGNALVKKGEHKKAMEKYTQSLAQDPTEVTTYTNRALCYLALKMYKDAIRDCEEALRLDSANIKALYRRAQAYKELKNKKSCIEDLNSVLKIDPNNTAVQ 295          

HSP 2 Score: 77.7962 bits (190), Expect = 4.264e-15
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSIEPIS-AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEK 1060
            KE+GN   K G+  +A+  YT+SL+ +P     Y NR L Y+  K +++AIRD    L+ D +NIKAL RRA  Y E+ N +  I D   ++K+ PNN   +      LQE++K
Sbjct:  194 KEEGNALVKKGEHKKAMEKYTQSLAQDPTEVTTYTNRALCYLALKMYKDAIRDCEEALRLDSANIKALYRRAQAYKELKNKKSCIEDLNSVLKIDPNNTAVQK----LLQEVQK 303          
BLAST of Sperm associated antigen 1 vs. Ensembl Zebrafish
Match: rpap3 (RNA polymerase II associated protein 3 [Source:ZFIN;Acc:ZDB-GENE-040426-928])

HSP 1 Score: 94.3597 bits (233), Expect = 1.441e-19
Identity = 144/634 (22.71%), Postives = 241/634 (38.01%), Query Frame = 2
Query:  311 EEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDXXXXXXXXXXXXXXXCDIXXXXXXXXXXXXXXXDIIDTFNSHDDSIFEEISL--------VKLED--GDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRS---RTKPMTKC-EFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISD 2167
            +  M D  SW +EI   D+ L+    S N  +      P+R     K      +   +   +   +  K  DY  W K   ++EK +   + EES           P     S         ++  NV+R+  A+ EKEKGN+ FK G  D A+  YT+++  +P + V   NR   + + K +  A  D ++ +  D   +KA  RRA+  + +   ++A+ D   ++KL P N  A+  +    QEL    +                                       +EE E   + I +   + +    + + + E +  KD GN  FKE RYE A+  Y + ++   +N +   NRA   L L R  +  +DC+ A+ LD +   +F RR  A   +G    +  D E  LK+ P + Q                    I                  DT       I +   L        +++E+  G +    L+S+     H ++   EEK  D +   + RS      P   C  F  E +  +I  + +ST   L    P +   +    L+  +L  I+ +   +  H     AS +  VL  L+ V+RF    M +S+
Sbjct:   21 QSFMRDLDSWEDEIKQKDQQLR----SENTGDTQKTLPPVRNKDYKKTKKRAKRQTNSLKEQKETQRIKSYDYQTWDKF--DVEKALESMDAEES-----------PVQSNESD--------SECVNVDRD-LALAEKEKGNQFFKDGRFDSAIECYTKAMDADPYNPVPPTNRATCFYRLKKFAVAESDCNLAIALDSKYVKAYIRRAATRTALQKHREALEDYEMVLKLDPGNSEAQTEVQKLQQELNSSKQ---------------------------------------TEETEEKRESITEPTAEQQQRLQEQQRKQEAVMHKDRGNAYFKEGRYEVAVESYTRGMEADETNALLPANRAMAFLKLNRFAEAEQDCSAALALDPSYTKAFARRATARAALGKCRDARDDFEQVLKLEPGNKQA-------------------ISEIEKLTAEMRSSLAPQEDTLRKTVQPIHKPEHLRSTKPLRRMEIEEVGGAIAQTPLTSS----PHHKIQKMEEK-PDASCPAVARSAEDEVIPPPPCTSFQLEADLRKISHNPQSTYSYLKQISPDSYPKIFQNSLESDVLNRILQTF--HRCHTRPEEASLLLDVLRNLASVKRFDMAVMFMSN 563          
BLAST of Sperm associated antigen 1 vs. Ensembl Zebrafish
Match: spag1a (sperm associated antigen 1a [Source:NCBI gene;Acc:564953])

HSP 1 Score: 87.4261 bits (215), Expect = 8.380e-18
Identity = 69/295 (23.39%), Postives = 134/295 (45.42%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSL---------SIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GN  FK G   +A+  YT+++         S E +  +Y+NR   ++K  N  + I+D +  L+  P ++K L RRA  Y  +   + A  D + ++++  + + A + +    + L ++  P  ++    +                         + A    KE    E+++   +        K+E+ F  +K  GN+L K  +++ A   Y++ +   P+    Y NRA C L LER  +  +DC  A+ ++  +  +F+RR  A+K +  Y  + +DL+  L++ PN
Sbjct:   88 KNQGNMLFKNGQFGDALEKYTQAIDGCIEAGIDSPEDLCVLYSNRAACFLKDGNSADCIQDCTRALELHPFSLKPLLRRAMAYESLERYRKAYVDYKTVLQIDISVQAAHDSVHRITKMLIEQDGPDWREKLPEIPAVP---------------------LSAQQHRKEEPSAELLQARAERAEQEKARKAEARFTILKQEGNELVKNSQFQGASEKYSECLAIKPNECAIYTNRALCFLKLERFAEAKQDCDSALQMEPKNKKAFYRRALAHKGLKDYLSASTDLQEVLQLDPN 361          

HSP 2 Score: 64.3142 bits (155), Expect = 2.256e-10
Identity = 45/143 (31.47%), Postives = 73/143 (51.05%), Query Frame = 2
Query:  632 ASQRNSKGLSDKVDTAKMTNVEREKAAVLE------KEKGNEAFKAGDLDEAVIYYTRSLSIEPI-SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSI 1039
            A Q   +  S ++  A+    E+EKA   E      K++GNE  K      A   Y+  L+I+P   A+Y NR L ++K + + EA +D    L+ +P N KA  RRA  +  + +   A TD +++++L PN + AE  L +
Sbjct:  229 AQQHRKEEPSAELLQARAERAEQEKARKAEARFTILKQEGNELVKNSQFQGASEKYSECLAIKPNECAIYTNRALCFLKLERFAEAKQDCDSALQMEPKNKKAFYRRALAHKGLKDYLSASTDLQEVLQLDPNVQEAEQELEM 371          

HSP 3 Score: 57.3806 bits (137), Expect = 3.770e-8
Identity = 42/130 (32.31%), Postives = 57/130 (43.85%), Query Frame = 2
Query: 1226 EIQDPKS-------DAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG--------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            E Q P S       DA          ++K+ GN LFK  ++ DAL  Y + +DG     I         Y NRAAC L        I+DCT A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   60 EPQGPGSAGESCNLDAPCGALPPPLARLKNQGNMLFKNGQFGDALEKYTQAIDGCIEAGIDSPEDLCVLYSNRAACFLKDGNSADCIQDCTRALELHPFSLKPLLRRAMAYESLERYRKAYVDYKTVLQI 189          
BLAST of Sperm associated antigen 1 vs. Ensembl Xenopus
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 182.956 bits (463), Expect = 2.713e-47
Identity = 119/347 (34.29%), Postives = 180/347 (51.87%), Query Frame = 2
Query:   71 SLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWV--NEINSVDESLKKPMLSGNGDNEVNNNFP-IRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVI 1102
             ++KT +IP+ +LDY  IE C+++  LEKI   L+SGEEG YP L  FCE+R+  L+P SR LRK     + +   S     I +D + W+   ++   +ES+  P      D E   N P IR   S  L   N Q  K  +G   K      DY +W K   E E   I +  E       T+++ K      +  +   +DTA ++  +R   A  EKEKGNEAF++GD  EA++YY+RS+S+ P +A YNNR    +K  NW +A+ D    L+ DP N KA  RRA+ +  + N + A TD  +++   P+N  A+   +   + L+K  +     G+++VI
Sbjct:   13 GMTKTHQIPVDHLDYSFIENCSDIKHLEKILWVLRSGEEGHYPELIVFCEERIGNLAPHSRALRKDKPSATASDFSSEDWTNIANDLKEWLVDMKMKEQNESVIPP------DTE---NLPSIRSYTS--LPADNKQRGKERTGLSKKAPR---DYRDWDKFDVEKELSKIEDNPE-------TKQQSKTTINPKTSAIKKTLDTAGLSPTQRRFIAENEKEKGNEAFRSGDYQEAIVYYSRSISVFPSAAAYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDLNRVLSQEPDNPVAKKEFAEVEELLQKAEEASRCKGRKIVI 338          

HSP 2 Score: 92.4337 bits (228), Expect = 1.442e-18
Identity = 116/513 (22.61%), Postives = 207/513 (40.35%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYY---------TRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIK-IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDXXXXXXXXXXXXXXXCDIXXXXXXXXXXXXXXXDIIDTFNSHDDSIFEEISLVKLEDGDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRSRTKPMTKC----EFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVA-SFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQS 2215
            K +GN+ FK G   EA + Y         TRS + E ++ +++NR   ++K  N  E I D +  L+  P ++K L RRA     +   + A  D + ++++  + + A + ++   + L ++  P  ++    +                   + +   V A+S  +             PK      KS  E ++ +K  GN+  K+ +Y +A   Y++ +         Y NRA C L L       +DC  A+  D  +  + +RR +AY+ +  Y    +DL   + + P+  + K                                  D I  F +  D       LVK ++       +    E     E+ D++  +    S  +  +   P+TK     EF ++LN+I+++ D     +LL  +EPK+L +L+  KL+   L  I+ S+     H+  P A + +   L  LSK ERF  V M+ S     E+  L   L Q+
Sbjct:  447 KSEGNQLFKNGQFAEAALKYSEAIENVKNTRSENAEELAILHSNRAACHLKDGNSRECIEDCNRALELQPFSVKPLLRRAMANESLERYRPAYVDYKTVLQIDSSMQVAHDSINRITRTLIEQDGPDWREKLPPI-----------PTVPISVHLQQHGGVPASSSSQ-------------PKILVEHGKSPEEMLQALKTEGNECVKKGQYREAEKKYSECLKINAEECTLYTNRALCYLKLSEYEAARKDCECALQRDALNIKALYRRAQAYRGLEDYQACANDLRKVISVDPSITEAK-------------------------------KLLDEIAPFLTAAD------GLVKEKEKQRKKILIEEVNEANVDGEVSDNKHCNGQERSATLAATTRSPITKPANAYEFGQQLNDIKVRKDETGCAELLSVTEPKDLPALMSNKLEEDTLLLIVRSM----KHSLLPTAPALVFQHLSHLSKAERFKIVIMLSSKSEKDEIRDLFDSLAQN 894          

HSP 3 Score: 56.9954 bits (136), Expect = 1.128e-7
Identity = 37/134 (27.61%), Postives = 65/134 (48.51%), Query Frame = 2
Query: 1211 KEIVKEIQDPKSDAID--------SKSESEFIKI--KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K+  K   +PK+ AI         S ++  FI    K+ GN+ F+   Y++A+  Y++ +  +PS    Y NRA   + L    K + DC   ++LD  +  ++ RR  A+K +  Y  + +DL   L   P++
Sbjct:  176 KQQSKTTINPKTSAIKKTLDTAGLSPTQRRFIAENEKEKGNEAFRSGDYQEAIVYYSRSISVFPS-AAAYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDLNRVLSQEPDN 308          
BLAST of Sperm associated antigen 1 vs. Ensembl Xenopus
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 182.956 bits (463), Expect = 3.255e-47
Identity = 119/347 (34.29%), Postives = 180/347 (51.87%), Query Frame = 2
Query:   71 SLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWV--NEINSVDESLKKPMLSGNGDNEVNNNFP-IRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVI 1102
             ++KT +IP+ +LDY  IE C+++  LEKI   L+SGEEG YP L  FCE+R+  L+P SR LRK     + +   S     I +D + W+   ++   +ES+  P      D E   N P IR   S  L   N Q  K  +G   K      DY +W K   E E   I +  E       T+++ K      +  +   +DTA ++  +R   A  EKEKGNEAF++GD  EA++YY+RS+S+ P +A YNNR    +K  NW +A+ D    L+ DP N KA  RRA+ +  + N + A TD  +++   P+N  A+   +   + L+K  +     G+++VI
Sbjct:   33 GMTKTHQIPVDHLDYSFIENCSDIKHLEKILWVLRSGEEGHYPELIVFCEERIGNLAPHSRALRKDKPSATASDFSSEDWTNIANDLKEWLVDMKMKEQNESVIPP------DTE---NLPSIRSYTS--LPADNKQRGKERTGLSKKAPR---DYRDWDKFDVEKELSKIEDNPE-------TKQQSKTTINPKTSAIKKTLDTAGLSPTQRRFIAENEKEKGNEAFRSGDYQEAIVYYSRSISVFPSAAAYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDLNRVLSQEPDNPVAKKEFAEVEELLQKAEEASRCKGRKIVI 358          

HSP 2 Score: 92.4337 bits (228), Expect = 1.350e-18
Identity = 115/513 (22.42%), Postives = 204/513 (39.77%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYY---------TRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIK-IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDXXXXXXXXXXXXXXXCDIXXXXXXXXXXXXXXXDIIDTFNSHDDSIFEEISLVKLEDGDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRSRTKPMTKC----EFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVA-SFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQS 2215
            K +GN+ FK G   EA + Y         TRS + E ++ +++NR   ++K  N  E I D +  L+  P ++K L RRA     +   + A  D + ++++  + + A + ++   + L ++  P  ++    +                          V  S   ++           PK      KS  E ++ +K  GN+  K+ +Y +A   Y++ +         Y NRA C L L       +DC  A+  D  +  + +RR +AY+ +  Y    +DL   + + P+  + K                                  D I  F +  D       LVK ++       +    E     E+ D++  +    S  +  +   P+TK     EF ++LN+I+++ D     +LL  +EPK+L +L+  KL+   L  I+ S+     H+  P A + +   L  LSK ERF  V M+ S     E+  L   L Q+
Sbjct:  473 KSEGNQLFKNGQFAEAALKYSEAIENVKNTRSENAEELAILHSNRAACHLKDGNSRECIEDCNRALELQPFSVKPLLRRAMANESLERYRPAYVDYKTVLQIDSSMQVAHDSINRITRTLIEQDGPDWREKLPPIP------------------------TVPISVHLQQHGGVPASSSSQPKILVEHGKSPEEMLQALKTEGNECVKKGQYREAEKKYSECLKINAEECTLYTNRALCYLKLSEYEAARKDCECALQRDALNIKALYRRAQAYRGLEDYQACANDLRKVISVDPSITEAK-------------------------------KLLDEIAPFLTAAD------GLVKEKEKQRKKILIEEVNEANVDGEVSDNKHCNGQERSATLAATTRSPITKPANAYEFGQQLNDIKVRKDETGCAELLSVTEPKDLPALMSNKLEEDTLLLIVRSM----KHSLLPTAPALVFQHLSHLSKAERFKIVIMLSSKSEKDEIRDLFDSLAQN 920          

HSP 3 Score: 56.6102 bits (135), Expect = 1.470e-7
Identity = 37/134 (27.61%), Postives = 65/134 (48.51%), Query Frame = 2
Query: 1211 KEIVKEIQDPKSDAID--------SKSESEFIKI--KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K+  K   +PK+ AI         S ++  FI    K+ GN+ F+   Y++A+  Y++ +  +PS    Y NRA   + L    K + DC   ++LD  +  ++ RR  A+K +  Y  + +DL   L   P++
Sbjct:  196 KQQSKTTINPKTSAIKKTLDTAGLSPTQRRFIAENEKEKGNEAFRSGDYQEAIVYYSRSISVFPS-AAAYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDLNRVLSQEPDN 328          
BLAST of Sperm associated antigen 1 vs. Ensembl Xenopus
Match: rpap3 (RNA polymerase II associated protein 3 [Source:NCBI gene;Acc:549434])

HSP 1 Score: 116.316 bits (290), Expect = 3.057e-26
Identity = 97/300 (32.33%), Postives = 147/300 (49.00%), Query Frame = 2
Query:  692 VEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
            V+ EKA +LEKEKGN  FK+G  DEA+  YTR +  +P +AV   NR   + + K +  A  D ++ +  + +  KA  RR +    + +LQ A  D  K+++L  NN  A+N L    +EL+  +                        D  +++  E+   V N EEK    K+I  EIQ  K  AI           KD GN  FKE +YE A+  Y++ ++   +N +   NRA   L +++  +   DCT+AI LD +   +F RRG A  M+G   ++  D EM LK+ P + Q
Sbjct:  127 VDTEKA-LLEKEKGNNYFKSGQYDEAIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAARLALKDLQGAKEDYEKVLELDVNNFEAKNELRKINKELQSST-----------------------SDVQEKEAIEEKITVENEEEK----KQI--EIQQRKQQAIMQ---------KDLGNAYFKEGKYEIAIDCYSQGMEADTTNALLPANRAMAYLKIQKYKEAETDCTLAISLDASYCKAFARRGTARIMLGKQKEAKEDFEMVLKLDPGNKQ 387          

HSP 2 Score: 55.4546 bits (132), Expect = 3.109e-7
Identity = 37/136 (27.21%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 1190 EEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            E+ ++D+ E   E +    D I   +E   ++ K+ GN  FK  +Y++A+  Y + +D  P N +   NRA+    L++      DC +AI L+ N   ++ RRG A   +     +  D E  L++  N+++ K+
Sbjct:  104 EDIDKDNNESSSESECGDEDGITVDTEKALLE-KEKGNNYFKSGQYDEAIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAARLALKDLQGAKEDYEKVLELDVNNFEAKN 238          
BLAST of Sperm associated antigen 1 vs. Ensembl Xenopus
Match: SPAG1 (sperm associated antigen 1 [Source:HGNC Symbol;Acc:HGNC:11212])

HSP 1 Score: 100.523 bits (249), Expect = 3.530e-21
Identity = 45/103 (43.69%), Postives = 67/103 (65.05%), Query Frame = 2
Query:  719 EKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAEN 1027
            EKEKGNEAF++GD  EA++YY+RS+S+ P +A YNNR    +K  NW +A+ D    L+ DP N KA  RRA+ +  + N + A TD  +++   P+N  A++
Sbjct:  142 EKEKGNEAFRSGDYQEAIVYYSRSISVFPSAAAYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDLNRVLSQEPDNPVAKD 244          

HSP 2 Score: 72.7886 bits (177), Expect = 1.475e-12
Identity = 32/63 (50.79%), Postives = 44/63 (69.84%), Query Frame = 2
Query:   71 SLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVL 259
             ++KT +IP+ +LDY  IE C+++  LEKI   L+SGEEG YP L  FCE+R+  L+P SR L
Sbjct:   13 GMTKTHQIPVDHLDYSFIENCSDIKHLEKILWVLRSGEEGHYPELIVFCEERIGNLAPHSRWL 75          

HSP 3 Score: 68.5514 bits (166), Expect = 2.967e-11
Identity = 65/296 (21.96%), Postives = 122/296 (41.22%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYY---------TRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIK-IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GN+ FK G   EA + Y         TRS + E ++ +++NR   ++K  N  E I D +  L+  P ++K L RRA     +   + A  D + ++++  + + A + ++   + L ++  P  ++    +                          V  S   ++           PK      KS  E ++ +K  GN+  K+ +Y +A   Y++ +         Y NRA C L L       +DC  A+  D  +  + +RR +AY+ +  Y    +DL   + + P+
Sbjct:  351 KSEGNQLFKNGQFAEAALKYSEAIENVKNTRSENAEELAILHSNRAACHLKDGNSRECIEDCNRALELQPFSVKPLLRRAMANESLERYRPAYVDYKTVLQIDSSMQVAHDSINRITRTLIEQDGPDWREKLPPIP------------------------TVPISVHLQQHGGVPASSSSQPKILVEHGKSPEEMLQALKTEGNECVKKGQYREAEKKYSECLKINAEECTLYTNRALCYLKLSEYEAARKDCECALQRDALNIKALYRRAQAYRGLEDYQACANDLRKVISVDPS 622          

HSP 4 Score: 57.7658 bits (138), Expect = 7.365e-8
Identity = 33/116 (28.45%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 1256 DSKSESEFIKI--KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            D+ ++  FI    K+ GN+ F+   Y++A+  Y++ +  +PS    Y NRA   + L    K + DC   ++LD  +  ++ RR  A+K +  Y  + +DL   L   P++   KD
Sbjct:  130 DNPTQRRFIAENEKEKGNEAFRSGDYQEAIVYYSRSISVFPSA-AAYNNRAQAEIKLSNWRKALNDCERVLELDPGNTKAYLRRATAHKNLANYKAATTDLNRVLSQEPDNPVAKD 244          
BLAST of Sperm associated antigen 1 vs. Ensembl Xenopus
Match: rpap3 (RNA polymerase II associated protein 3 [Source:NCBI gene;Acc:549434])

HSP 1 Score: 89.3521 bits (220), Expect = 6.953e-18
Identity = 77/267 (28.84%), Postives = 121/267 (45.32%), Query Frame = 2
Query:  728 KGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIG 1525
            +GN  FK+G  DEA+  YTR +  +P +AV   NR   + + K +  A  D ++ +  + +  KA  RR +    + +LQ A  D  K+++L  NN  A+N       EL K +K      +++ +                              E E + K+I  EIQ  K  AI           KD GN  FKE +YE A+  Y++ ++   +N +   NRA   L +++  +   DCT+AI LD +   +F RRG A  M+G
Sbjct:  121 QGNNYFKSGQYDEAIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAARLALKDLQGAKEDYEKVLELDVNNFEAKN-------ELRKINKVLFSIEEKITV------------------------------ENEEEKKQI--EIQQRKQQAIMQ---------KDLGNAYFKEGKYEIAIDCYSQGMEADTTNALLPANRAMAYLKIQKYKEAETDCTLAISLDASYCKAFARRGTARIMLG 339          

HSP 2 Score: 51.9878 bits (123), Expect = 3.538e-6
Identity = 29/101 (28.71%), Postives = 51/101 (50.50%), Query Frame = 2
Query: 1295 HGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
             GN  FK  +Y++A+  Y + +D  P N +   NRA+    L++      DC +AI L+ N   ++ RRG A   +     +  D E  L++  N+++ K+
Sbjct:  121 QGNNYFKSGQYDEAIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAARLALKDLQGAKEDYEKVLELDVNNFEAKN 221          
BLAST of Sperm associated antigen 1 vs. Ensembl Mouse
Match: Spag1 (sperm associated antigen 1 [Source:MGI Symbol;Acc:MGI:1349387])

HSP 1 Score: 199.904 bits (507), Expect = 3.800e-53
Identity = 135/354 (38.14%), Postives = 197/354 (55.65%), Query Frame = 2
Query:   65 CESL-----SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLK---DGKRMVI 1102
            C SL     +KTFKIPI +LD+ +IE C++V  LEKI   L+SGEEG YP L +FCEK L  L+P SR LRK     + +   +   E+I SD +SWV+EI   + +        + +N      P+  ++       + ++  T+S   + K   P+DY EW K   E E   I E+ +E  K+V         ++ +   +  K++TA +T  E+   A  EK KGNEAF +GD +EAV+YYTRSLS  P +  YNNR    +K + W  A+ D    L+ DP N+KAL RRA+ Y   + LQ+A+ D RK++++ P+N  A+  LS   ++L K S+P  +    GKRMVI
Sbjct:    8 CPSLWGFGTTKTFKIPIEHLDFKYIENCSDVKHLEKILYVLRSGEEGYYPELTEFCEKCLTNLAPKSRALRKDKPAETASSFSAEEWEKIDSDLKSWVSEIKREENTCH----FHDPENHPGVEDPLPPVRGSTCCPHSGKE--TYSKSKTAKKRIPRDYAEWDKFDVEKECSKIDEDYKE--KTVIN-------NKAHLSKIETKIETAGLTEKEKSFLANREKGKGNEAFYSGDYEEAVMYYTRSLSALPTAIAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQVEPDNDLAKKTLSEVERDL-KNSEPVSELQTKGKRMVI 345          

HSP 2 Score: 71.2478 bits (173), Expect = 3.619e-12
Identity = 69/278 (24.82%), Postives = 120/278 (43.17%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS-IEP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLD----KNSH-LSFFRRG 1504
            K +GNE F+ G   EA   Y+ +++ +EP        +S +Y+NR   Y+K+ N  + I+D +  L+  P ++K L RRA  Y  +   ++A  D + ++++    + A    N ++  L EL         DG +        +           +        A + +++      +  I D          E  F  +K+ GNQL K+  Y+DA+  YN+ +         Y NRA C L L +  +   DC  A+ +D    K SH L+  ++G
Sbjct:  434 KRRGNELFRGGQFAEAAAQYSVAIAQLEPTGSANADELSILYSNRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYETLEQYRNAYVDYKTVLQIDCGIQLASDSANRIARILTEL---------DGSKW------RERLPPIPAVPTSEPLRVWLPAAETPDQDPCPNNCMPSITD----------EKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKG 686          

HSP 3 Score: 58.5362 bits (140), Expect = 3.213e-8
Identity = 31/98 (31.63%), Postives = 50/98 (51.02%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K  GN+ F    YE+A+  Y + +   P+  I Y NRA   + L+R    +EDC  A++LD  +  +  RR   YK      ++V DL   L++ P++
Sbjct:  217 KGKGNEAFYSGDYEEAVMYYTRSLSALPTA-IAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQVEPDN 313          

HSP 4 Score: 54.299 bits (129), Expect = 7.296e-7
Identity = 38/118 (32.20%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  683 MTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEP-ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            M ++  EK     KE+GN+  K  +  +A+  Y   L I     A+Y NR L Y+K   +EEA  D    L+ D  N+KA  R A     + N +++  D  +++ LSP++  A  HL
Sbjct:  597 MPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKGLENCRESGVDPSQVL-LSPDSSEAARHL 713          
BLAST of Sperm associated antigen 1 vs. Ensembl Mouse
Match: Spag1 (sperm associated antigen 1 [Source:MGI Symbol;Acc:MGI:1349387])

HSP 1 Score: 199.904 bits (507), Expect = 3.800e-53
Identity = 135/354 (38.14%), Postives = 197/354 (55.65%), Query Frame = 2
Query:   65 CESL-----SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLK---DGKRMVI 1102
            C SL     +KTFKIPI +LD+ +IE C++V  LEKI   L+SGEEG YP L +FCEK L  L+P SR LRK     + +   +   E+I SD +SWV+EI   + +        + +N      P+  ++       + ++  T+S   + K   P+DY EW K   E E   I E+ +E  K+V         ++ +   +  K++TA +T  E+   A  EK KGNEAF +GD +EAV+YYTRSLS  P +  YNNR    +K + W  A+ D    L+ DP N+KAL RRA+ Y   + LQ+A+ D RK++++ P+N  A+  LS   ++L K S+P  +    GKRMVI
Sbjct:    8 CPSLWGFGTTKTFKIPIEHLDFKYIENCSDVKHLEKILYVLRSGEEGYYPELTEFCEKCLTNLAPKSRALRKDKPAETASSFSAEEWEKIDSDLKSWVSEIKREENTCH----FHDPENHPGVEDPLPPVRGSTCCPHSGKE--TYSKSKTAKKRIPRDYAEWDKFDVEKECSKIDEDYKE--KTVIN-------NKAHLSKIETKIETAGLTEKEKSFLANREKGKGNEAFYSGDYEEAVMYYTRSLSALPTAIAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQVEPDNDLAKKTLSEVERDL-KNSEPVSELQTKGKRMVI 345          

HSP 2 Score: 71.2478 bits (173), Expect = 3.619e-12
Identity = 69/278 (24.82%), Postives = 120/278 (43.17%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS-IEP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLD----KNSH-LSFFRRG 1504
            K +GNE F+ G   EA   Y+ +++ +EP        +S +Y+NR   Y+K+ N  + I+D +  L+  P ++K L RRA  Y  +   ++A  D + ++++    + A    N ++  L EL         DG +        +           +        A + +++      +  I D          E  F  +K+ GNQL K+  Y+DA+  YN+ +         Y NRA C L L +  +   DC  A+ +D    K SH L+  ++G
Sbjct:  434 KRRGNELFRGGQFAEAAAQYSVAIAQLEPTGSANADELSILYSNRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYETLEQYRNAYVDYKTVLQIDCGIQLASDSANRIARILTEL---------DGSKW------RERLPPIPAVPTSEPLRVWLPAAETPDQDPCPNNCMPSITD----------EKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKG 686          

HSP 3 Score: 58.5362 bits (140), Expect = 3.213e-8
Identity = 31/98 (31.63%), Postives = 50/98 (51.02%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K  GN+ F    YE+A+  Y + +   P+  I Y NRA   + L+R    +EDC  A++LD  +  +  RR   YK      ++V DL   L++ P++
Sbjct:  217 KGKGNEAFYSGDYEEAVMYYTRSLSALPTA-IAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQVEPDN 313          

HSP 4 Score: 54.299 bits (129), Expect = 7.296e-7
Identity = 38/118 (32.20%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  683 MTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEP-ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            M ++  EK     KE+GN+  K  +  +A+  Y   L I     A+Y NR L Y+K   +EEA  D    L+ D  N+KA  R A     + N +++  D  +++ LSP++  A  HL
Sbjct:  597 MPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKGLENCRESGVDPSQVL-LSPDSSEAARHL 713          
BLAST of Sperm associated antigen 1 vs. Ensembl Mouse
Match: Spag1 (sperm associated antigen 1 [Source:MGI Symbol;Acc:MGI:1349387])

HSP 1 Score: 78.1814 bits (191), Expect = 2.501e-17
Identity = 39/74 (52.70%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   53 QMESCESL-----SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVL 259
            + + C SL     +KTFKIPI +LD+ +IE C++V  LEKI   L+SGEEG YP L +FCEK L  L+P SR L
Sbjct:    4 KAKDCPSLWGFGTTKTFKIPIEHLDFKYIENCSDVKHLEKILYVLRSGEEGYYPELTEFCEKCLTNLAPKSRAL 77          
BLAST of Sperm associated antigen 1 vs. Ensembl Mouse
Match: Tomm34 (translocase of outer mitochondrial membrane 34 [Source:MGI Symbol;Acc:MGI:1914395])

HSP 1 Score: 78.9518 bits (193), Expect = 2.312e-15
Identity = 82/299 (27.42%), Postives = 136/299 (45.48%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI---------EPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKP--RLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIK-IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            +  GN++F+ G   EA   Y R+L +         E  S +Y+NR   Y+K  N  + I+D +  L   P +IK L RRAS Y  +     A  D + ++++  +   A   ++   + L     P  RLK     V+   A                   +    S+  +   K   KE    KS  + S  + E  K +K+ GN L K+  ++ A+  Y++ +         Y NRA C+LVL++  + ++DCT A+ LD  +  +F+RR +AYK +  Y  S+SD+   L+I P +
Sbjct:   13 RAAGNQSFRNGQYAEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALVPFSIKPLLRRASAYEALEKYALAYVDYKTVLQIDNSVASALEGINRITRALMDSLGPEWRLKLPPIPVVPVSAQKR----------------WNSLPSDNHKETAKTKSKEATATKSR-VPSAGDVERAKALKEEGNDLVKKGNHKKAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLSDISSLLQIEPRN 294          

HSP 2 Score: 60.4622 bits (145), Expect = 3.021e-9
Identity = 42/142 (29.58%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  602 SVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPI-SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE 1024
            S+ ++   + A  ++ +  + K       +VER KA    KE+GN+  K G+  +A+  Y+ SL    + SA Y+NR L ++  K ++EA++D +  LK D  N+KA  RRA  Y  + + + +++D   ++++ P N  A+
Sbjct:  160 SLPSDNHKETAKTKSKEATATKSRVPSAGDVERAKAL---KEEGNDLVKKGNHKKAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLSDISSLLQIEPRNGPAQ 298          
BLAST of Sperm associated antigen 1 vs. Ensembl Mouse
Match: Tomm34 (translocase of outer mitochondrial membrane 34 [Source:MGI Symbol;Acc:MGI:1914395])

HSP 1 Score: 77.7962 bits (190), Expect = 5.213e-15
Identity = 82/299 (27.42%), Postives = 135/299 (45.15%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI---------EPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKP--RLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIK-IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            +  GN+ F+ G   EA   Y R+L +         E  S +Y+NR   Y+K  N  + I+D +  L   P +IK L RRAS Y  +     A  D + ++++  +   A   ++   + L     P  RLK     V+   A                   +    S+  +   K   KE    KS  + S  + E  K +K+ GN L K+  ++ A+  Y++ +         Y NRA C+LVL++  + ++DCT A+ LD  +  +F+RR +AYK +  Y  S+SD+   L+I P +
Sbjct:   13 RAAGNQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALVPFSIKPLLRRASAYEALEKYALAYVDYKTVLQIDNSVASALEGINRITRALMDSLGPEWRLKLPPIPVVPVSAQKR----------------WNSLPSDNHKETAKTKSKEATATKSR-VPSAGDVERAKALKEEGNDLVKKGNHKKAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLSDISSLLQIEPRN 294          

HSP 2 Score: 60.4622 bits (145), Expect = 3.048e-9
Identity = 42/142 (29.58%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  602 SVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPI-SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE 1024
            S+ ++   + A  ++ +  + K       +VER KA    KE+GN+  K G+  +A+  Y+ SL    + SA Y+NR L ++  K ++EA++D +  LK D  N+KA  RRA  Y  + + + +++D   ++++ P N  A+
Sbjct:  160 SLPSDNHKETAKTKSKEATATKSRVPSAGDVERAKAL---KEEGNDLVKKGNHKKAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLSDISSLLQIEPRNGPAQ 298          
BLAST of Sperm associated antigen 1 vs. UniProt/SwissProt
Match: sp|Q5U2X2|SPAG1_RAT (Sperm-associated antigen 1 OS=Rattus norvegicus OX=10116 GN=Spag1 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 5.703e-54
Identity = 136/347 (39.19%), Postives = 192/347 (55.33%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDES--LKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLK---DGKRMVI 1102
            +KTFKIPI +LD+ +IE C++V +LEKI   L+SGEEG YP L +FCEKRL  L+P SR LRK     + +   +   E+I SD +SWV+EI   + +     P      ++ +    P+R   S   G       +T S   + K   P+DY EW K   E E   I E+ +E  K+V         ++ +   +  K+DTA +T  E+   A  EK KGNEAF +GD +EAV+YYTRSLS  P +  YNNR    +K + W  A+ D    L+ +P NIKAL RRA+ Y   +   +A+ D RK+++  P+N  A+  LS   +EL K S+P  +    GKRMVI
Sbjct:   17 TKTFKIPIEHLDFKYIENCSDVKQLEKILCVLRSGEEGYYPELTEFCEKRLTGLAPRSRALRKDKPAATASSFSAEEWEKIDSDLKSWVSEIKREENTRHFHDPEKHPGVEDPLP---PVRGSNSCPRGGK-----ETSSKSKTAKKRIPRDYAEWDKFDVEKECSKIDEDYKE--KTVIN-------NKAHLSKIETKIDTAGLTEKEKNFLANREKGKGNEAFYSGDYEEAVMYYTRSLSALPTATAYNNRAQAEIKLQRWSSALEDCEKALELEPGNIKALLRRATTYKHQNKFLEAVDDLRKVLQAEPDNDLAKKTLSEVEREL-KNSEPASELQTKGKRMVI 345          

HSP 2 Score: 73.559 bits (179), Expect = 4.670e-12
Identity = 71/297 (23.91%), Postives = 124/297 (41.75%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS-IEP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDS--KSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GNE F+ G   EA + Y+ +++ +EP        +S +Y+NR   Y+K+ N    I+D    L+  P  +K L RRA  Y  +   + A  D   ++K+    + A + ++   + L +   P+ ++    +                          V  SE             QDP  ++       E  F  +K+ GNQL K+  Y+DA+  YN+ +         Y NRA C L L +  +   DC  A+ +D  +  + +R   A K +    + V+D    + +SP+
Sbjct:  433 KSRGNELFRGGQFAEAAVQYSGAIAQLEPTGSENADELSILYSNRAACYLKEGNCRGCIQDCDRALELQPFAVKPLLRRAMAYETLEQYRSAYVDYITVLKIDCRIQLASDSVNRITRILTELDGPKWRERLPPIP------------------------AVPASEPLRVWHPAAETPDQDPCPNSCTPTITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCDKALQIDSKNVKASYRLELAQKGLENCRERVADPSQVVLLSPD 705          

HSP 3 Score: 55.0694 bits (131), Expect = 2.342e-6
Identity = 34/105 (32.38%), Postives = 53/105 (50.48%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSIEP-ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            KE+GN+  K  +  +A+  Y   L I     A+Y NR L Y+K   +EEA  D    L+ D  N+KA  R       + N ++ + D  +++ LSP++  A  HL
Sbjct:  609 KEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCDKALQIDSKNVKASYRLELAQKGLENCRERVADPSQVVLLSPDSSEAARHL 713          

HSP 4 Score: 53.9138 bits (128), Expect = 6.518e-6
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K  GN+ F    YE+A+  Y + +   P+    Y NRA   + L+R    +EDC  A++L+  +  +  RR   YK    + ++V DL   L+  P++
Sbjct:  217 KGKGNEAFYSGDYEEAVMYYTRSLSALPTA-TAYNNRAQAEIKLQRWSSALEDCEKALELEPGNIKALLRRATTYKHQNKFLEAVDDLRKVLQAEPDN 313          
BLAST of Sperm associated antigen 1 vs. UniProt/SwissProt
Match: sp|Q07617|SPAG1_HUMAN (Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3)

HSP 1 Score: 203.756 bits (517), Expect = 1.957e-53
Identity = 134/347 (38.62%), Postives = 193/347 (55.62%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVI 1102
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V     DK    +    +  ++DTA +T  E++  A  EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + L++A  D  K++ + P+N  A+  LS   ++L   E  S+ + K GKRMVI
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKM---------HFHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI----DKSHLSK----IETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTK-GKRMVI 341          

HSP 2 Score: 79.7221 bits (195), Expect = 6.578e-14
Identity = 78/298 (26.17%), Postives = 131/298 (43.96%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-EP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GNE F++G   EA   Y+ ++++ EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A    N LS  L EL+    P  ++    +    AS                   + A    KE   K+        +    D K+   F  +K+ GNQ   +  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ L   +  +F+RR  A+K +  Y KS+ DL   + + P+
Sbjct:  449 KSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELD---GPNWREKLSPIPAVPASVP-----------------LQAWHPAKEMISKQAGDSSSHRQQGITDEKT---FKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 723          

HSP 3 Score: 56.6102 bits (135), Expect = 9.112e-7
Identity = 40/128 (31.25%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  629 PASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIE-PISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPN 1009
            PA +  SK   D   + +   +  EK     KE+GN+     +  +A+  Y+  L I     A+Y NR L Y+K   +EEA +D    L+    N+KA  RRA  +  + N Q ++ D  K+I L P+
Sbjct:  597 PAKEMISKQAGDS-SSHRQQGITDEKTFKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 723          
BLAST of Sperm associated antigen 1 vs. UniProt/SwissProt
Match: sp|Q80ZX8|SPAG1_MOUSE (Sperm-associated antigen 1 OS=Mus musculus OX=10090 GN=Spag1 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 2.658e-52
Identity = 135/354 (38.14%), Postives = 197/354 (55.65%), Query Frame = 2
Query:   65 CESL-----SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLK---DGKRMVI 1102
            C SL     +KTFKIPI +LD+ +IE C++V  LEKI   L+SGEEG YP L +FCEK L  L+P SR LRK     + +   +   E+I SD +SWV+EI   + +        + +N      P+  ++       + ++  T+S   + K   P+DY EW K   E E   I E+ +E  K+V         ++ +   +  K++TA +T  E+   A  EK KGNEAF +GD +EAV+YYTRSLS  P +  YNNR    +K + W  A+ D    L+ DP N+KAL RRA+ Y   + LQ+A+ D RK++++ P+N  A+  LS   ++L K S+P  +    GKRMVI
Sbjct:    8 CPSLWGFGTTKTFKIPIEHLDFKYIENCSDVKHLEKILYVLRSGEEGYYPELTEFCEKCLTNLAPKSRALRKDKPAETASSFSAEEWEKIDSDLKSWVSEIKREENTCH----FHDPENHPGVEDPLPPVRGSTCCPHSGKE--TYSKSKTAKKRIPRDYAEWDKFDVEKECSKIDEDYKE--KTVIN-------NKAHLSKIETKIETAGLTEKEKSFLANREKGKGNEAFYSGDYEEAVMYYTRSLSALPTAIAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQVEPDNDLAKKTLSEVERDL-KNSEPVSELQTKGKRMVI 345          

HSP 2 Score: 71.2478 bits (173), Expect = 2.532e-11
Identity = 69/278 (24.82%), Postives = 120/278 (43.17%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS-IEP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLD----KNSH-LSFFRRG 1504
            K +GNE F+ G   EA   Y+ +++ +EP        +S +Y+NR   Y+K+ N  + I+D +  L+  P ++K L RRA  Y  +   ++A  D + ++++    + A    N ++  L EL         DG +        +           +        A + +++      +  I D          E  F  +K+ GNQL K+  Y+DA+  YN+ +         Y NRA C L L +  +   DC  A+ +D    K SH L+  ++G
Sbjct:  434 KRRGNELFRGGQFAEAAAQYSVAIAQLEPTGSANADELSILYSNRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYETLEQYRNAYVDYKTVLQIDCGIQLASDSANRIARILTEL---------DGSKW------RERLPPIPAVPTSEPLRVWLPAAETPDQDPCPNNCMPSITD----------EKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKG 686          

HSP 3 Score: 58.5362 bits (140), Expect = 2.248e-7
Identity = 31/98 (31.63%), Postives = 50/98 (51.02%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K  GN+ F    YE+A+  Y + +   P+  I Y NRA   + L+R    +EDC  A++LD  +  +  RR   YK      ++V DL   L++ P++
Sbjct:  217 KGKGNEAFYSGDYEEAVMYYTRSLSALPTA-IAYNNRAQAEIKLQRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQVEPDN 313          

HSP 4 Score: 54.299 bits (129), Expect = 5.103e-6
Identity = 38/118 (32.20%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  683 MTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEP-ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            M ++  EK     KE+GN+  K  +  +A+  Y   L I     A+Y NR L Y+K   +EEA  D    L+ D  N+KA  R A     + N +++  D  +++ LSP++  A  HL
Sbjct:  597 MPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKLGQFEEAKLDCEQALQIDGENVKASHRLALAQKGLENCRESGVDPSQVL-LSPDSSEAARHL 713          
BLAST of Sperm associated antigen 1 vs. UniProt/SwissProt
Match: sp|Q28IV3|RPAP3_XENTR (RNA polymerase II-associated protein 3 OS=Xenopus tropicalis OX=8364 GN=rpap3 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.620e-25
Identity = 97/300 (32.33%), Postives = 147/300 (49.00%), Query Frame = 2
Query:  692 VEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
            V+ EKA +LEKEKGN  FK+G  DEA+  YTR +  +P +AV   NR   + + K +  A  D ++ +  + +  KA  RR +    + +LQ A  D  K+++L  NN  A+N L    +EL+  +                        D  +++  E+   V N EEK    K+I  EIQ  K  AI           KD GN  FKE +YE A+  Y++ ++   +N +   NRA   L +++  +   DCT+AI LD +   +F RRG A  M+G   ++  D EM LK+ P + Q
Sbjct:  127 VDTEKA-LLEKEKGNNYFKSGQYDEAIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAARLALKDLQGAKEDYEKVLELDVNNFEAKNELRKINKELQSST-----------------------SDVQEKEAIEEKITVENEEEK----KQI--EIQQRKQQAIMQ---------KDLGNAYFKEGKYEIAIDCYSQGMEADTTNALLPANRAMAYLKIQKYKEAETDCTLAISLDASYCKAFARRGTARIMLGKQKEAKEDFEMVLKLDPGNKQ 387          

HSP 2 Score: 55.4546 bits (132), Expect = 1.647e-6
Identity = 37/136 (27.21%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 1190 EEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            E+ ++D+ E   E +    D I   +E   ++ K+ GN  FK  +Y++A+  Y + +D  P N +   NRA+    L++      DC +AI L+ N   ++ RRG A   +     +  D E  L++  N+++ K+
Sbjct:  104 EDIDKDNNESSSESECGDEDGITVDTEKALLE-KEKGNNYFKSGQYDEAIECYTRGMDADPYNAVLPTNRASAFFRLKKYAVAESDCNLAIALNHNYAKAYARRGAARLALKDLQGAKEDYEKVLELDVNNFEAKN 238          
BLAST of Sperm associated antigen 1 vs. UniProt/SwissProt
Match: sp|Q6NU95|RPAP3_XENLA (RNA polymerase II-associated protein 3 OS=Xenopus laevis OX=8355 GN=rpap3 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.672e-25
Identity = 102/302 (33.77%), Postives = 147/302 (48.68%), Query Frame = 2
Query:  692 VEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRD--LSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
            V+ EKA + EKEKGN  FK+G  DEA+  YTR +  +P +A+   NR   + + K +  A  D  L+I L +D +  KA  RR +    + NLQ A  D  K+++L  NN  A+N L    QEL                        +S+ D  +   +E    V N EEK    K+I  EIQ  K  AI           KD GN  FKE +YE A+  Y++ ++   +N +   NRA   L +++  +   DCT+AI LD +   +F RRG A  M+G   ++  D EM LK+ P + Q
Sbjct:  127 VDTEKA-LSEKEKGNNYFKSGKYDEAIECYTRGMDADPYNAILPTNRASAFFRLKKFAVAESDCNLAIALNRDYA--KAYARRGAARLALKNLQGAKEDYEKVLELDANNFEAKNELRKINQEL-----------------------YSSASDVQENMATEAKITVENEEEK----KQI--EIQQRKQQAIMQ---------KDLGNAYFKEGKYEIAIECYSQGMEADNTNALLPANRAMAYLKIQKYKEAEADCTLAISLDASYCKAFARRGTASIMLGKQKEAKEDFEMVLKLDPGNKQ 387          

HSP 2 Score: 60.4622 bits (145), Expect = 5.381e-8
Identity = 38/128 (29.69%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  695 EREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPR 1075
            +R++ A+++K+ GN  FK G  + A+  Y++ +  +  +A+   NR + Y+K + ++EA  D ++ +  D S  KA  RR +    +   ++A  D   ++KL P NK A   L+   QEL    K R
Sbjct:  279 QRKQQAIMQKDLGNAYFKEGKYEIAIECYSQGMEADNTNALLPANRAMAYLKIQKYKEAEADCTLAISLDASYCKAFARRGTASIMLGKQKEAKEDFEMVLKLDPGNKQAVLELAKISQELRSIEKDR 406          

HSP 3 Score: 55.0694 bits (131), Expect = 2.080e-6
Identity = 30/103 (29.13%), Postives = 54/103 (52.43%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            K+ GN  FK  +Y++A+  Y + +D  P N I   NRA+    L++      DC +AI L+++   ++ RRG A   +     +  D E  L++  N+++ K+
Sbjct:  136 KEKGNNYFKSGKYDEAIECYTRGMDADPYNAILPTNRASAFFRLKKFAVAESDCNLAIALNRDYAKAYARRGAARLALKNLQGAKEDYEKVLELDANNFEAKN 238          
BLAST of Sperm associated antigen 1 vs. TrEMBL
Match: G7MZV4 (Uncharacterized protein OS=Macaca mulatta OX=9544 GN=EGK_19168 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 9.074e-63
Identity = 175/513 (34.11%), Postives = 258/513 (50.29%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG----------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK L+ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V          + +   +  ++DTA +T  E++  A+ EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P NIKAL RRA+ Y   + LQ+AI D  K++ + P+N+ A+  LS   ++L   E  SK + K GKRMVI E                       + NSE++E  D    ++ +D   D     S +    +K  GN+LF+  ++ +A   Y+  +      P G          Y NRAAC L        I+DC  A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLEALAPESRALRKDKPAATAASFTAEEWEKIDDDIKSWVSEIKKEEDKMH---------FHETETFPAMKDNLPPVRGSNSCLHVGKEKCSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI--------DKSHLSKIETRIDTAGLTEKEKDFLAIREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNIKALLRRATTYKHQNKLQEAIEDLSKVLDVEPDNELAKKTLSEVERDLKNSEAVSKTQTK-GKRMVIQE-----------------------IENSEDEEGKDS--GRQHEDGSGDKAAPLSPA---GLKSQGNELFRSGQFAEAASKYSAAIALL--EPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQI 477          

HSP 2 Score: 73.559 bits (179), Expect = 1.664e-9
Identity = 82/307 (26.71%), Postives = 133/307 (43.32%), Query Frame = 2
Query:  701 EKAAVLE----KEKGNEAFKAGDLDEAVIYYTRSLSI-EP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNR---AACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMAL 1564
            +KAA L     K +GNE F++G   EA   Y+ ++++ EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A    N LS  L ELE    P  ++    +    AS                   + A     E   K+        + D  D K+   F  +K+ GNQ   +  Y+DAL  Y++ +         Y NR   + C L L +  +  +DC  A+ LD  +  + +RR  A+K +  Y KS+ DL   L
Sbjct:  365 DKAAPLSPAGLKSQGNELFRSGQFAEAASKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELE---GPNWREKLSPIPAVPASVP-----------------LQAWHPATEMISKQAGDSSSHHQQDITDEKT---FKALKEEGNQCVNDKNYKDALRKYSECLKINNKECAIYTNRQVLSLCYLKLCQFEEAKQDCDQALQLDDGNVKACYRRALAHKGLKNYQKSLIDLNKVL 648          
BLAST of Sperm associated antigen 1 vs. TrEMBL
Match: A0A2K5IWV9 (Sperm associated antigen 1 OS=Colobus angolensis palliatus OX=336983 GN=SPAG1 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.508e-62
Identity = 177/513 (34.50%), Postives = 257/513 (50.10%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG----------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+   S     K    K   K   P+DY EW K   ++EK+ +  +++   K+V     DK    +    +  ++DTA +T  E++  A+ EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P NIKAL RRA+ Y   + LQ+AI D  K++ + P+N+ A+  LS   ++L   E  SK + K GKRMVI E                       + NSE++E  D    ++ +D   D            +K  GN+LF+  ++ +A G Y+  +      P G          Y NRAAC L        I+DC  A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGCYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDDDIKSWVSEIKKEEDKMH---------FHETETFPAMKDNLPPVRGSKSCLHVGKEKCSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI----DKSHLSK----IETRIDTAGLTEKEKDFLAIHEKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNIKALLRRATTYKHQNKLQEAIEDLSKVLDVEPDNELAKKTLSEVERDLKNSEAVSKTQTK-GKRMVIQE-----------------------IENSEDEEGKDS--GRKHEDGGGDKPAG--------LKSQGNELFRSGQFAEAAGKYSAAIALL--EPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQI 472          

HSP 2 Score: 79.7221 bits (195), Expect = 1.643e-11
Identity = 78/293 (26.62%), Postives = 129/293 (44.03%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-EP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMAL 1564
            K +GNE F++G   EA   Y+ ++++ EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A    N LS  L EL+    P  ++    +    AS                   + A     E   K+        + D  D K+   F  +K+ GNQ   +  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ LD  +  + +RR  A+K +  Y KS++DL   L
Sbjct:  371 KSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELD---GPNWREKLSPIPAVPASVP-----------------LQAWHPATEMISKQAGDSSSHHQQDITDEKT---FKALKEEGNQCVNDKNYKDALRKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLDDGNVKACYRRALAHKGLKNYQKSLNDLNKVL 640          
BLAST of Sperm associated antigen 1 vs. TrEMBL
Match: A0A2R8ZPR9 (Sperm associated antigen 1 OS=Pan paniscus OX=9597 GN=SPAG1 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.828e-62
Identity = 176/513 (34.31%), Postives = 253/513 (49.32%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQEL---EKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG----------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK LQ L+P+SR LRK     +     +   E+I  D +SWV+EI   ++ +                FP  K  +  V+  NS     K    K   K   P+DY EW K   ++EK+ +  +++   K+V          + +   +  ++DTA +T  E++  A  EKEKGNEAF +GD +EAV+YYTRS+S  P    YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + L +AI D  K++ + P+N  A+  LS   ++L   E  SK + K GKRMVI E                       + NSE++E  D     E      D    KS      +K  GN+LF+  ++ +A G Y+  +      P G          Y NRAAC L        I+DC  A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKMH---------FHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPTKKKTPRDYAEWDKF--DVEKECLKIDEDYKEKTVI--------DKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLLEAIEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASKTQTK-GKRMVIQE-----------------------IENSEDEEGKDSGRKHE------DGGGDKS------LKSQGNELFRSGQFAEAAGKYSAAIALL--EPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQI 470          

HSP 2 Score: 80.4925 bits (197), Expect = 9.798e-12
Identity = 78/298 (26.17%), Postives = 131/298 (43.96%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-EP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GNE F++G   EA   Y+ ++++ EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A    N LS  L EL+    P  ++    +    AS                   + A    KE   K+        +    D K+   F  +K+ GNQ   +  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ L   +  +F+RR  A+K +  Y KS+ DL   + + P+
Sbjct:  369 KSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELD---GPNWREKLSPIPAVPASVP-----------------LQAWHPAKEMISKQAGDSSSHRQQGITDEKT---FKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPS 643          
BLAST of Sperm associated antigen 1 vs. TrEMBL
Match: I3M7D2 (Sperm associated antigen 1 OS=Ictidomys tridecemlineatus OX=43179 GN=SPAG1 PE=4 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 8.480e-62
Identity = 178/518 (34.36%), Postives = 260/518 (50.19%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRK--MQSVKLGNSNDQ-DLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKD---GKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSD----AIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG----------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            +KTFKIPI +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEKRL+ L+P SR LRK     + +       E+I  D +SWV+EI   +  +                FP  K  +  V+  NS  Q   + HS     K   P+DY EW K   E E   I E+ +E  K+V   +      +R       KVDTA +T  +R   A+ EKEKGNEAF +GD +EAV+YYTRS+S  P  A YNNR    +K +NW  A +D    L+ +P NIKAL RRA+ Y   + LQ+AI D RK++ + P+N  A+  LS   +++ K S+P  K    GKRMVI E+ + ++   +   ++    ++ ++  S  +              +       + +++      +K  GN+LFK  ++ +A   Y+  +      P G          Y NRAAC L        I+DC  A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   15 TKTFKIPIEHLDFKYIEKCSDVKYLEKILCVLRSGEEGYYPELTEFCEKRLKGLAPKSRALRKDKPAATASSFTEEEWEKIDGDIKSWVSEIKREESRMH---------FHETETFPGMKDHLPPVRGSNSCLQVGQEKHSKNRPAKKKIPRDYAEWDKFDVEKECSKIDEDYKE--KTVINNKSHLSKIER-------KVDTAGLTEKDRGLLAIREKEKGNEAFNSGDYEEAVMYYTRSISALPTVAAYNNRAQAEIKLQNWNSAFQDCEKVLQLEPGNIKALLRRATTYKHQNKLQEAIEDLRKVLNVEPDNDLAKKTLSEVERDV-KNSEPASKTQTKGKRMVIEEVENSEDEDEKGSGRKPEDGRSAILRASPGRGLGRAGRSGNRGSARGGGALLGLPARARLGPDGLKSQGNELFKNGQFAEAARRYSAAIAQL--EPAGSESADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQI 511          

HSP 2 Score: 102.449 bits (254), Expect = 1.879e-18
Identity = 121/509 (23.77%), Postives = 206/509 (40.47%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLS-IEP--------ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKS-----ESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDXXXXXXXXXXXXXXXCDIXXXXXXXXXXXXXXXDIIDTFNSHDDSIFEEISLVKL--EDGDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRSR---TKPMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISDHAVSELEQ 2191
            K +GNE FK G   EA   Y+ +++ +EP        +S +Y+NR   Y+K+ N    I+D +  L+  P ++K L RRA  Y  +     A  D + ++++    + A + ++   + L +   P  ++                                  + E  R          D   D     S     E  F  +K+ GN+  K+  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ +D ++  ++FRR  A+K +  Y KS+SDL   L + PN  ++                            ++    +D   +FN   +    EI  V    E+ +    D+S+  E+LA        EK   ++  L    R   +KP    EF + +N I  + D ++   LL  + PK+L  L+  KL+G     ++ SL  +         S +   LL LSK ERF  +  +IS     +++Q
Sbjct:  410 KSQGNELFKNGQFAEAARRYSAAIAQLEPAGSESADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGIQLANDSINRITRILMELDGPNWRE-------------------------KLSPIPAVPTSEPLRAWHPATPMTPDQGGDPSGHHSPSITEEKMFEVLKEEGNEYVKDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQIDGDNVKAYFRRALAHKGLKNYQKSLSDLNQVLLLDPNIVEV----------------------------TRLLNIKDNTASFNKGKERRKIEIQEVNEGNEEPERTSGDIST--EYLA-------PEKGGGSSGTLEHSERLEISKPTNAYEFGQVINAINTRKDEEACAHLLAITAPKDLPVLLSNKLEGDTFLLLVQSLKNHLIDKD---PSLVYQHLLYLSKAERFKMMLTLISKGQKEQIQQ 853          
BLAST of Sperm associated antigen 1 vs. TrEMBL
Match: A0A4W2FLT1 (Sperm associated antigen 1 OS=Bos indicus x Bos taurus OX=30522 GN=SPAG1 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.423e-61
Identity = 174/521 (33.40%), Postives = 261/521 (50.10%), Query Frame = 2
Query:   77 SKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKD---GKRMVIXXXXXX------------XXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG--------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            +KTFKIP+ +LD+ +IEKC++V  LEKI   L+SGEEG YP L +FCEK L  L+P SR LRK     + +   +   E+I  D +SWV+EI   D+ +            V +N P  +  +  L  + +++ K+   K         DY EW K   E E   + E+KE          R    ++ +   +  ++DTA +T  E+   A  EKEKGNEAFK+GD +EAV YYTRSLS+ P  A YNNR    +K +NW  A +D    L+ +P N+KAL RRA+ Y   + LQ+AI D  K++ + P+N+ A+  LS   ++L K S+P  K    GKRMVI E+ +             ++  S  E +   + +  +   SE  +R ++   +  + P + A   K +         GN+LF+  ++ +A   Y+  +    S   G        Y NRAAC L        I+DC  A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   35 TKTFKIPVEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLSGLAPGSRALRKDKPAATASSFTAEEWEKIDGDIKSWVSEIKKEDDKIH--FHETETFPAVEDNLPPVRGSNSHLHVAKEKNSKSRPAKKKIPR----DYAEWDKFDVEKECAKLDEDKE----------RTVINNKSHLSKIETRLDTAGLTEKEKVFMATREKEKGNEAFKSGDYEEAVKYYTRSLSVLPTVAAYNNRAQAELKLQNWNSAFQDCEKVLELEPGNLKALLRRATTYKHQNKLQEAIEDLNKVLAVEPDNELAKKTLSEVERDL-KNSEPASKTQTKGKRMVIQEVENSEDEDEKDSGIKHEDAGSAAEPRAMGNIQKKLTRRSEGGKRPERGAPRRGRTPGAGA--DKRDRPRAPAPSQGNELFQNGQFSEAALKYSAAIAQLESAGSGSAADLSILYSNRAACYLKDGNCSGCIQDCNRALELHPFSIKPLLRRAMAYETVEQYQKAYVDYKTVLQI 536          

HSP 2 Score: 82.0333 bits (201), Expect = 3.507e-12
Identity = 116/481 (24.12%), Postives = 197/481 (40.96%), Query Frame = 2
Query:  215 CEKRLQKLSPDS--RVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSV--DESLKKPMLSGNGDNEVNNNFPIRKMQS-------VKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSL---------SIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            CEK L+ L P +   +LR+AT     N+L  +I++         +N++ +V  D  L K  LS   + ++ N+ P  K Q+        ++ NS D+D K  SG   + +    +      I  +L ++         S+      R  P   R     +DK D        R +A      +GNE F+ G   EA + Y+ ++         S   +S +Y+NR   Y+K  N    I+D +  L+  P +IK L RRA  Y  +   Q A  D + ++++    + A + ++   + L     P  ++    +     S                   V A     E    +    + DP  D      E+ F  +K+ GNQ  K+  Y+DAL  Y++ +         Y NRA C L L +  +  +DC  A+ +D  +  + +RR  A+K + V   S+ + +M L+       IKD
Sbjct:  286 CEKVLE-LEPGNLKALLRRATTYKHQNKLQEAIED---------LNKVLAVEPDNELAKKTLS-EVERDLKNSEPASKTQTKGKRMVIQEVENSEDEDEKD-SGIKHEDAGSAAEPRAMGNIQKKLTRR---------SEGGKRPERGAPRRGRTPGAGADKRD--------RPRAPA--PSQGNELFQNGQFSEAALKYSAAIAQLESAGSGSAADLSILYSNRAACYLKDGNCSGCIQDCNRALELHPFSIKPLLRRAMAYETVEQYQKAYVDYKTVLQIDCGIQLANDSINRITKILIALDGPNWREKLPPIPAVPTSTQ-----------------VRAWRPAAETPPDQSCPTLCDPIDD------ENVFKTLKEEGNQCVKDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLGQFEEAKQDCEQALQMDHGNVKACYRRALAHKGLKVRKPSIVEAKMELEEVTRILNIKD 712          
BLAST of Sperm associated antigen 1 vs. Ensembl Cavefish
Match: ENSAMXT00000012211.2 (sperm associated antigen 1 [Source:NCBI gene;Acc:103039649])

HSP 1 Score: 177.948 bits (450), Expect = 7.432e-46
Identity = 117/343 (34.11%), Postives = 184/343 (53.64%), Query Frame = 2
Query:   83 TFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXX--XDYNEWSKIADELEKQMI-LEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVI 1102
            T  +P+ +LDY +IEKC+++  LEKI   L+SG+EG YPHL +FCEK ++KL P SR LRK     +         ++I ++ Q+W NEI   D  L K +   N     + N P      V+  N + Q + T+SG  +    +   + Y +W K   ++EK+   ++E   +++S A           +   +  K+DT  +T  E+   A  EK+KGNEAF+AGD +EAV YYTRS+ I P++  YNNR    +K + W + + D    L+ +P N KAL RRA+ Y ++ NLQ A  D   +++  PNN  A+  L    +++      +   GK+++I
Sbjct:   20 THSVPVEHLDYKYIEKCSDLKYLEKILGVLRSGKEGIYPHLTEFCEKHVEKLDPRSRALRKENFPATSASFSKDEWDQITNELQTWENEIKINDVELNKQLFFCN-----DVNIP-----PVRGSNCSIQKV-TYSGDKAYSKTRHLPRSYQDWDKF--DVEKECAKIDETLTTNESAAI-------IDDSLLKIQSKIDTTGLTEQEKVVLANREKDKGNEAFRAGDYEEAVTYYTRSVYIMPMTTAYNNRAQAEIKLQRWYDVLSDCERVLQLEPHNTKALLRRATAYKQLENLQMAHDDINAVLRSEPNNMSAQRLLEEISKKINAHIHHKPNKGKKLLI 342          

HSP 2 Score: 86.6557 bits (213), Expect = 5.624e-17
Identity = 90/392 (22.96%), Postives = 167/392 (42.60%), Query Frame = 2
Query:  434 KMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKE----ESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSL---------SIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            +  +V+ G  N Q  K HSG     +      N++ K+  E E   +   K      S+   A  R D P  +R     +       +  ++ E         GN+ FK G   +A+  YT+++         S E +  +Y+NR   Y+K  N  + I D S  L+  P ++K L RRA  Y  +   + A  D +  +++  + + A + ++   + L +      +DG               S  +     +  T +      KE D +E  +            ++E+ F  +K  GN+L K+ +Y++A+G Y++ +         + NRA C + L+R  +  +DC  A++L+ ++  +F+RR  A K +  Y+   SDL+  L++
Sbjct:  373 RQAAVRGGMGNAQK-KAHSGGARGPTA-----NKY-KVKAEGEPAAVANRKNLANGNSTAQPANGRPDSPGEERTESTCASGALPPPLARLKNE---------GNQLFKNGQFGDALEKYTQAITGFTEAAIDSPEDLCILYSNRAACYLKDGNSSDCIADCSRALELQPFSLKPLLRRAMAYESLERYRKAYVDYKTALQIDSSIQAAHDSVNRITRLLIE------QDGAEWRQKLPEIPAVPVSLRQHHTAATSSTHL-----HKENDTQEAAR------------RAEARFTSLKTEGNELVKKGQYQEAVGKYSECLKLKSDECAIFTNRALCFIKLKRFAEAKQDCNSALNLESSNKKAFYRRALANKGLKDYEACSSDLQEVLRL 725          

HSP 3 Score: 53.5286 bits (127), Expect = 7.958e-7
Identity = 30/98 (30.61%), Postives = 48/98 (48.98%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            KD GN+ F+   YE+A+  Y + V   P     Y NRA   + L+R   V+ DC   + L+ ++  +  RR  AYK +     +  D+   L+  PN+
Sbjct:  216 KDKGNEAFRAGDYEEAVTYYTRSVYIMPMT-TAYNNRAQAEIKLQRWYDVLSDCERVLQLEPHNTKALLRRATAYKQLENLQMAHDDINAVLRSEPNN 312          

HSP 4 Score: 51.2174 bits (121), Expect = 4.055e-6
Identity = 41/137 (29.93%), Postives = 61/137 (44.53%), Query Frame = 2
Query: 1832 DSEEKSSDNTSCLIGRSRTKPMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQSSSNLAEIDC 2242
            D E+KS+  T  L      +P    EF + LN  R  +D  +  QLL    P +L   + T+LDG  L  I+ +L    TH  A     +  +L  L   ERF  V MM++     ++ QL +       +L  +DC
Sbjct:  779 DGEQKSTSQTINL------QPSNAYEFGQALNAARSLNDTAACAQLLRTVPPDSLPQYVSTQLDGHTLSFIMKTLD---THLLASEPGVVYQLLDHLHTTERFSMVLMMLNPDERMQMTQLFE-------HLCSVDC 899          
BLAST of Sperm associated antigen 1 vs. Ensembl Cavefish
Match: rpap3 (RNA polymerase II associated protein 3 [Source:ZFIN;Acc:ZDB-GENE-040426-928])

HSP 1 Score: 112.849 bits (281), Expect = 1.509e-25
Identity = 89/301 (29.57%), Postives = 132/301 (43.85%), Query Frame = 2
Query:  710 AVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDK------EIVK-EIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
            A+ EKEKGN+ FK G  DEA+  YTR +S +P + V   NR   + + K +  A  D ++ +  D   IKA  RR +     +N Q A+ D   ++KL P N  A+N +    Q L                                            + +K+R+DK      E++  E   PK    + +   E +  KD GN  FKE +YE A+  Y K ++   +N +   NRA   L LER  +  EDC+ AI LD     +F RRG A   +G   ++  D E  L++ P + Q
Sbjct:  130 AMKEKEKGNQFFKDGKYDEAIECYTRGMSADPYNPVLPTNRAASFFRLKKYAVAESDCNLAIALDSKYIKAYARRGAARFAHNNHQGALEDYEMVLKLDPENLDAQNEIKKLSQAL--------------------------------------------ASQKQREDKVEKTLVEVLPAEEAKPKHIEEEQQRRQEAVVQKDRGNAYFKEGKYEAAVESYTKGMEADATNALLAANRAMAYLKLERYAEAEEDCSKAIALDSTYLKAFARRGTARAALGHLTEAKEDFEQVLRLEPGNKQ 386          

HSP 2 Score: 69.707 bits (169), Expect = 6.168e-12
Identity = 37/114 (32.46%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  695 EREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            +R + AV++K++GN  FK G  + AV  YT+ +  +  +A+   NR + Y+K + + EA  D S  +  D + +KA  RR +  + + +L +A  D  ++++L P NK A N L
Sbjct:  278 QRRQEAVVQKDRGNAYFKEGKYEAAVESYTKGMEADATNALLAANRAMAYLKLERYAEAEEDCSKAIALDSTYLKAFARRGTARAALGHLTEAKEDFEQVLRLEPGNKQAMNEL 391          
BLAST of Sperm associated antigen 1 vs. Ensembl Cavefish
Match: tomm34 (translocase of outer mitochondrial membrane 34 [Source:NCBI gene;Acc:103026659])

HSP 1 Score: 98.2117 bits (243), Expect = 5.827e-22
Identity = 80/300 (26.67%), Postives = 138/300 (46.00%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI---------EPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE---NHLSICLQELEKRS-KPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K+ GNE FKAG   EAV  Y++++S          E +  +Y+NR   Y+K  N  E I+D +++L   P  IK+L RRA+ Y  +   + A  D + ++++  N   A    N +S  L +++  S + +L     + +       + +S        +++  VV NS++  + D ++ K                    +K+ GN L K+  ++ A+  Y + +   P+    Y NRA C L L+     + DC  A+ LD  +  + +RR +AYK +      V DL   LKI P +
Sbjct:   14 KQAGNECFKAGQYGEAVSLYSQAISALEKSGQKKPEDLGILYSNRAASYLKDGNCNECIKDCTVSLDLVPFGIKSLLRRAAAYEAVERYRQAYVDYKTVLQIDCNLPAAHDGTNRMSKALTDMDGPSWREKLPPIPTVPLAVKEKLLQATSPTTPTTPTAQQNGVVENSKQSSKKDGDVKKA-----------------RILKEEGNSLVKKGEHKKAIEKYTQSLSQDPTEVTTYTNRALCYLSLKLYRDAVRDCEEALRLDSVNIKALYRRAQAYKELKDKKACVQDLNSLLKIEPKN 296          

HSP 2 Score: 74.7146 bits (182), Expect = 4.307e-14
Identity = 45/120 (37.50%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  704 KAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPIS-AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEK 1060
            K A + KE+GN   K G+  +A+  YT+SLS +P     Y NR L Y+  K + +A+RD    L+ D  NIKAL RRA  Y E+ + +  + D   ++K+ P N  A+      LQE++K
Sbjct:  193 KKARILKEEGNSLVKKGEHKKAIEKYTQSLSQDPTEVTTYTNRALCYLSLKLYRDAVRDCEEALRLDSVNIKALYRRAQAYKELKDKKACVQDLNSLLKIEPKNTAAQK----LLQEVQK 308          
BLAST of Sperm associated antigen 1 vs. Ensembl Cavefish
Match: spag1a (sperm associated antigen 1a [Source:NCBI gene;Acc:564953])

HSP 1 Score: 87.4261 bits (215), Expect = 9.195e-18
Identity = 71/298 (23.83%), Postives = 138/298 (46.31%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSL---------SIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKS---ESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GN  FK G   +A+  YT+++         S E +  +Y+NR   Y+K  N  + I+D +  L+  P ++K L RRA  Y  +   + A  D + ++++  + + A + +    + L ++  P  ++                           +  VV  S ++ R D+   + +Q   + A   K+   E+ F  +K  GN + K+ ++E A+  Y++ +    S    Y NRA C L L++  +  +DC  A+ ++  +  +F+RR  A+K +  Y  + +DL+  L++ PN
Sbjct:   95 KNEGNLLFKNGQFGDALGKYTQAIEGCETAGIDSPEDVCILYSNRAACYLKDGNCTDCIQDCTRALELCPFSLKPLLRRAMAYESLERYRKAYVDYKTVLQIDVSVQAAHDSIHRITKMLIEQDGPDWRE------------------------QLPEIPVVPLSAQQHRRDEPSAEVLQARAARAEQEKARQAEARFTLLKQEGNDMVKKGQFESAIEKYSECLKIKSSECSIYTNRAICYLRLDQYAEAKQDCDTALQMEPTNKKAFYRRALAHKGLKDYLSASTDLQEVLQLDPN 368          

HSP 2 Score: 69.707 bits (169), Expect = 4.266e-12
Identity = 45/151 (29.80%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  602 SVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLE------KEKGNEAFKAGDLDEAVIYYTRSLSIEPI-SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            S    RRD+P+++         V  A+    E+EKA   E      K++GN+  K G  + A+  Y+  L I+    ++Y NR + Y++   + EA +D    L+ +P+N KA  RRA  +  + +   A TD +++++L PN + AE  L
Sbjct:  235 SAQQHRRDEPSAE---------VLQARAARAEQEKARQAEARFTLLKQEGNDMVKKGQFESAIEKYSECLKIKSSECSIYTNRAICYLRLDQYAEAKQDCDTALQMEPTNKKAFYRRALAHKGLKDYLSASTDLQEVLQLDPNVREAEQEL 376          

HSP 3 Score: 59.6918 bits (143), Expect = 6.564e-9
Identity = 38/116 (32.76%), Postives = 55/116 (47.41%), Query Frame = 2
Query: 1247 DAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIG--------YRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            DA          ++K+ GN LFK  ++ DALG Y + ++G  +  I         Y NRAAC L        I+DCT A++L   S     RR  AY+ +  Y K+  D +  L+I
Sbjct:   81 DAPAGALPPPLARLKNEGNLLFKNGQFGDALGKYTQAIEGCETAGIDSPEDVCILYSNRAACYLKDGNCTDCIQDCTRALELCPFSLKPLLRRAMAYESLERYRKAYVDYKTVLQI 196          
BLAST of Sperm associated antigen 1 vs. Ensembl Cavefish
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:103043863])

HSP 1 Score: 69.707 bits (169), Expect = 6.134e-12
Identity = 40/103 (38.83%), Postives = 59/103 (57.28%), Query Frame = 2
Query:  704 KAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPI-----SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIK 997
            KA   +KE+GN AFK G+ +EA   Y+ +L+I+P      + +Y NR  V  K K  E+AI D +  +K D S IKA  RRA CY +    ++A+ D  K+ +
Sbjct:  267 KALKAKKEEGNRAFKEGNFEEAYDLYSEALTIDPNNIKTNAKLYCNRATVGSKLKKLEQAIEDCTKAIKLDESYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQ 369          

HSP 2 Score: 53.5286 bits (127), Expect = 6.796e-7
Identity = 33/119 (27.73%), Postives = 55/119 (46.22%), Query Frame = 2
Query: 1238 PKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            P+ +  D + E E    K+ GN  + +  Y +A   Y K +D  P N   Y NRAA  ++L R  + +ED   A+ LD        R GK +  +G    +    +  L++ P++ Q +
Sbjct:   28 PEMELSDEEMEREAEGYKEQGNAFYIKKEYSEAFNYYTKAIDVCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDTFVRGHLREGKCHLSLGNAMAASRCFQKVLELEPDNSQAQ 146          

HSP 3 Score: 53.1434 bits (126), Expect = 9.036e-7
Identity = 32/118 (27.12%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  683 MTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISA-VYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            +++ E E+ A   KE+GN  +   +  EA  YYT+++ + P +A  Y NR    M    + EA+ D    ++ D + ++   R   C+  + N   A    +K+++L P+N  A+  L
Sbjct:   32 LSDEEMEREAEGYKEQGNAFYIKKEYSEAFNYYTKAIDVCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDTFVRGHLREGKCHLSLGNAMAASRCFQKVLELEPDNSQAQQEL 149          

HSP 4 Score: 52.373 bits (124), Expect = 1.333e-6
Identity = 32/93 (34.41%), Postives = 52/93 (55.91%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWP----SNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLE 1555
            K+ GN+ FKE  +E+A  +Y++ +   P    +N   Y NRA     L++  + IEDCT AI LD++   ++ RR + Y     Y+++V D E
Sbjct:  273 KEEGNRAFKEGNFEEAYDLYSEALTIDPNNIKTNAKLYCNRATVGSKLKKLEQAIEDCTKAIKLDESYIKAYLRRAQCYMDTEQYEEAVRDYE 365          
BLAST of Sperm associated antigen 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010032.1 (pep scaffold:Pmarinus_7.0:GL480182:186:9247:1 gene:ENSPMAG00000009078.1 transcript:ENSPMAT00000010032.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 2.156e-39
Identity = 86/278 (30.94%), Postives = 145/278 (52.16%), Query Frame = 2
Query:   92 IPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQ-DLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVD-TAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKA 919
            +P+ +LDY +I++C +  E+E+I   L+SGEEG +PHL +FCE+RL  L+P SR L      L+   L    + +++   Q W +E+   +E++K        D  + +  P        + N +D+  ++ +    +++  +  DY  W +   E+E   +     E            PA    ++   ++V  T  M+  E    A  EKEKGN+AF+AGD  EA+ YY RS+++ P +A YNNR L ++K+  W++A+RD    L  +P+NIK 
Sbjct:   19 VPVEHLDYAYIDQCNDAKEVERILRVLRSGEEGCFPHLTEFCEQRLAALAPQSRALWVDRPALTAASLPPEERAQLLDALQDWRDEMQKREEAIKA-TRPPEADALMGDLLP-------PVRNVHDKISVEKNIHGAAERRIRSVDYKAWDRFDVEVECARLDAADGEGDPR-------PPAGDEPTRNRVERVRRTXWMSAAELAVRAEKEKEKGNDAFRAGDFAEALAYYNRSIALLPSAACYNNRALAHIKRATWDDALRDCDTVLGLEPNNIKG 281          
BLAST of Sperm associated antigen 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010034.1 (pep scaffold:Pmarinus_7.0:GL480182:186:9247:1 gene:ENSPMAG00000009078.1 transcript:ENSPMAT00000010034.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 2.230e-39
Identity = 86/277 (31.05%), Postives = 146/277 (52.71%), Query Frame = 2
Query:   92 IPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQ-DLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKA 919
            +P+ +LDY +I++C +  E+E+I   L+SGEEG +PHL +FCE+RL  L+P SR L      L+   L    + +++   Q W +E+   +E++K        D  + +  P        + N +D+  ++ +    +++  +  DY  W +   E+E           ++  A + +       ++  L  K DT  M+  E    A  EKEKGN+AF+AGD  EA+ YY RS+++ P +A YNNR L ++K+  W++A+RD    L  +P+NIK 
Sbjct:   19 VPVEHLDYAYIDQCNDAKEVERILRVLRSGEEGCFPHLTEFCEQRLAALAPQSRALWVDRPALTAASLPPEERAQLLDALQDWRDEMQKREEAIKA-TRPPEADALMGDLLP-------PVRNVHDKISVEKNIHGAAERRIRSVDYKAWDRFDVEVE----------CARLDAADGKCTLIFTFHTVMLDAKRDTVWMSAAELAVRAEKEKEKGNDAFRAGDFAEALAYYNRSIALLPSAACYNNRALAHIKRATWDDALRDCDTVLGLEPNNIKG 277          
BLAST of Sperm associated antigen 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010036.1 (pep scaffold:Pmarinus_7.0:GL480182:213:9247:1 gene:ENSPMAG00000009078.1 transcript:ENSPMAT00000010036.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 6.379e-39
Identity = 85/276 (30.80%), Postives = 145/276 (52.54%), Query Frame = 2
Query:   92 IPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKA 919
            +P+ +LDY +I++C +  E+E+I   L+SGEEG +PHL +FCE+RL  L+P SR L      L+   L    + +++   Q W +E+   +E++K        D  + +  P   +++V    S ++ +K +    +++  +  DY  W +   E+E   +       +     E  + P    +    S      +M+  E    A  EKEKGN+AF+AGD  EA+ YY RS+++ P +A YNNR L ++K+  W++A+RD    L  +P+NIK 
Sbjct:   10 VPVEHLDYAYIDQCNDAKEVERILRVLRSGEEGCFPHLTEFCEQRLAALAPQSRALWVDRPALTAASLPPEERAQLLDALQDWRDEMQKREEAIKA-TRPPEADALMGDLLP--PVRNVHDKISVEKSVKKNIHGAAERRIRSVDYKAWDRFDVEVECARL------DAADGKNELYNSPMKNISVTSCS------RMSAAELAVRAEKEKEKGNDAFRAGDFAEALAYYNRSIALLPSAACYNNRALAHIKRATWDDALRDCDTVLGLEPNNIKG 270          
BLAST of Sperm associated antigen 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005772.1 (pep scaffold:Pmarinus_7.0:GL478792:23408:39519:-1 gene:ENSPMAG00000005227.1 transcript:ENSPMAT00000005772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.656e-13
Identity = 39/105 (37.14%), Postives = 61/105 (58.10%), Query Frame = 2
Query:  710 AVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFA 1021
            A++EK+KGNE FK GD D A   YTR +  +P +A+   NR + ++K K +E A  D ++ ++ DPS  KA  RR +    ++ L++A  D   ++   P NK A
Sbjct:   14 ALIEKDKGNEYFKTGDYDAANDCYTRGMEADPHNALLPANRAMAFLKLKKYELAESDCNLAIQLDPSYPKAFARRGAARLALNKLKEAREDFEAVLTFDPVNKQA 118          

HSP 2 Score: 48.9062 bits (115), Expect = 2.747e-6
Identity = 31/96 (32.29%), Postives = 45/96 (46.88%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISP 1576
            KD GN+ FK   Y+ A   Y + ++  P N +   NRA   L L++      DC +AI LD +   +F RRG A   +    ++  D E  L   P
Sbjct:   18 KDKGNEYFKTGDYDAANDCYTRGMEADPHNALLPANRAMAFLKLKKYELAESDCNLAIQLDPSYPKAFARRGAARLALNKLKEAREDFEAVLTFDP 113          
BLAST of Sperm associated antigen 1 vs. Ensembl Sea Lamprey
Match: ttc1 (tetratricopeptide repeat domain 1 [Source:ZFIN;Acc:ZDB-GENE-041114-80])

HSP 1 Score: 63.5438 bits (153), Expect = 1.949e-11
Identity = 36/114 (31.58%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  698 REKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSI------EPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFA 1021
            R   A++ KE GN+ FK  +  +A   YTR+L +         + +Y+NR + + K  N E+AI+D +  +  DP   +A  RRA  Y     L +A+ D R ++ L P +  A
Sbjct:   55 RRDEAMMLKESGNQLFKQAEYQQAADTYTRALKVCLRAYSSHRAVLYSNRAVAHQKMGNTEKAIQDCTKAVGLDPGYARARGRRAELYEASDKLDEALEDYRALLVLEPTHSAA 168          

HSP 2 Score: 56.6102 bits (135), Expect = 4.358e-9
Identity = 38/133 (28.57%), Postives = 62/133 (46.62%), Query Frame = 2
Query: 1199 ERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVD----GWPSN-PIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            E  D E + E +   SD    +   E + +K+ GNQLFK+  Y+ A   Y + +      + S+  + Y NRA  +  +    K I+DCT A+ LD     +  RR + Y+     D+++ D    L + P H
Sbjct:   33 EESDAESILEEELRLSDEEKERRRDEAMMLKESGNQLFKQAEYQQAADTYTRALKVCLRAYSSHRAVLYSNRAVAHQKMGNTEKAIQDCTKAVGLDPGYARARGRRAELYEASDKLDEALEDYRALLVLEPTH 165          
BLAST of Sperm associated antigen 1 vs. Ensembl Yeast
Match: TAH1 (Component of conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1); R2TP complex interacts with Hsp90 (Hsp82p and Hsc82p) to mediate assembly of large protein complexes such as box C/D snoRNPs and RNA polymerase II; contains a single TPR domain with at least two TPR motifs; plays a role in determining prion variants [Source:SGD;Acc:S000000656])

HSP 1 Score: 50.8322 bits (120), Expect = 2.277e-8
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query: 1271 SEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDC 1450
            S+F K K+ GN LFK+  Y +A+  Y++L+   P NP+GY N+A   + L    + I+ C
Sbjct:    2 SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMC 61          
BLAST of Sperm associated antigen 1 vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 55.0694 bits (131), Expect = 3.233e-8
Identity = 36/121 (29.75%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  686 TNVEREKAAVLE-KEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSIC 1042
            T    ++A  LE K +GN   K     +A+  YT ++ ++   ++Y +NR   + K  N++ A+ D    +K DP NIKA  RRA     +   + A  D   ++K  PN+  A   L  C
Sbjct:    3 TPTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPAATKALLTC 123          
BLAST of Sperm associated antigen 1 vs. Ensembl Yeast
Match: TOM71 (Mitochondrial outer membrane protein; probable minor component of the TOM (translocase of outer membrane) complex responsible for recognition and import of mitochondrially directed proteins; TOM71 has a paralog, TOM70, that arose from the whole genome duplication [Source:SGD;Acc:S000001159])

HSP 1 Score: 54.6842 bits (130), Expect = 4.050e-8
Identity = 34/110 (30.91%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  653 GLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAV-YNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITD 979
            G  D      ++  +R+  AV  K +GN  F A + +EA+ YY  ++ ++P   V Y+N    Y+   + E+ I   +  L+  P + KAL RRAS    + N  DA+ D
Sbjct:  108 GEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFD 217          

HSP 2 Score: 48.1358 bits (113), Expect = 4.966e-6
Identity = 25/100 (25.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query: 1259 SKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEM 1558
            S+ ++  +++K+ GN  F    + +A+  Y   ++  P+ P+ Y N +AC +      KVIE  T A+++  +   +  RR  A + +G +  ++ DL +
Sbjct:  121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 220          
BLAST of Sperm associated antigen 1 vs. Ensembl Yeast
Match: STI1 (Hsp90 cochaperone; regulates spatial organization of amyloid-like proteins in the cytosol, thereby buffering the proteotoxicity caused by amyloid-like proteins; interacts with the Ssa group of the cytosolic Hsp70 chaperones and activates Ssa1p ATPase activity; interacts with Hsp90 chaperones and inhibits their ATPase activity; homolog of mammalian Hop [Source:SGD;Acc:S000005553])

HSP 1 Score: 53.9138 bits (128), Expect = 7.020e-8
Identity = 33/122 (27.05%), Postives = 68/122 (55.74%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSIE--PISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL-SICLQELEKRSKPRL 1078
            K++GN AF A D D+A+  +T+++ +   P   +Y+NR   Y   K + +A+ D +  +K +PS  K   R  + +  + +L +A ++ +K ++L  +NK A+  L  +   +  ++++P L
Sbjct:    9 KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRTQQARQAQPDL 130          
BLAST of Sperm associated antigen 1 vs. Ensembl Yeast
Match: TOM70 (Component of the TOM (translocase of outer membrane) complex; involved in the recognition and initial import steps for all mitochondrially directed proteins; acts as a receptor for incoming precursor proteins; TOM70 has a paralog, TOM71, that arose from the whole genome duplication [Source:SGD;Acc:S000005065])

HSP 1 Score: 52.373 bits (124), Expect = 2.140e-7
Identity = 45/169 (26.63%), Postives = 79/169 (46.75%), Query Frame = 2
Query:  581 EKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQE-LEKRSKPRLKD 1084
            +KE      +T   + P    +S G  D  + A  T  E++K A+  K+KGN+ F+    D+A+ YY  +L ++     Y+N    Y+   + ++ +   +  L+  P   K L RRAS    +    DA+ D   +  LS N  F +  +   L+  L K++  +LK+
Sbjct:   56 QKETEGAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFD---LSVLSLNGDFNDASIEPMLERNLNKQAMSKLKE 221          

HSP 2 Score: 51.6026 bits (122), Expect = 3.770e-7
Identity = 28/93 (30.11%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 1280 IKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEM 1558
            + +KD GNQ F+  +Y+DA+  YN  ++    +P+ Y N +AC + +    KV+E  T A++L  +      RR  A + +G +  ++ DL +
Sbjct:  100 LALKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSV 191          
BLAST of Sperm associated antigen 1 vs. Ensembl Nematostella
Match: EDO31207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYL2])

HSP 1 Score: 166.007 bits (419), Expect = 2.804e-42
Identity = 110/318 (34.59%), Postives = 176/318 (55.35%), Query Frame = 2
Query:   92 IPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNF--PIRKMQSVKLGNSNDQDLKT--HSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            IP+ +LDY ++  C++  ELEKI   L+SGEEG YP L +F EKRL+++ P SR LRK     S   L    +EE+++D + W+ +I+ +D  LK      N D E  ++F  P+R  +++   +S  Q   T        K    P+ Y EW K   + E +++ E++++  K    + R    + R +K L   V T   T+ E    A  EK+KGN+AF++GD  E+++YYTRS+ ++P +A YNNR +  +K   + +AI D +  +  +P N+KA  RRA    +   +Q A  D  K++++ PNNK A+  L
Sbjct:   14 IPLHHLDYKYVGSCSDGKELEKILKVLRSGEEGTYPELIEFTEKRLEEVMPKSRALRKDLPAKSYRDLGKPEQEELVNDIEEWMTDISQLDSKLKT-----NSDAEAISDFLPPVRSSKTIGSTSSPSQATNTFDRPQGKQKGPVAPRSYTEWDKFDPDEEVKLLEEKEKQQVKEKKEKAR---INTREAK-LPTNVKTPAKTDQELTFLANREKDKGNDAFRSGDYKESLVYYTRSIELKPTAASYNNRAMAEIKLSEYAKAIEDCNTVIFLEPDNLKAFLRRAIAQKQTGKVQAAKKDLNKVLEIEPNNKRAKELL 322          

HSP 2 Score: 58.151 bits (139), Expect = 1.408e-8
Identity = 34/103 (33.01%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            KD GN  F+   Y+++L  Y + ++  P+    Y NRA   + L    K IEDC   I L+ ++  +F RR  A K  G    +  DL   L+I PN+ + K+
Sbjct:  219 KDKGNDAFRSGDYKESLVYYTRSIELKPT-AASYNNRAMAEIKLSEYAKAIEDCNTVIFLEPDNLKAFLRRAIAQKQTGKVQAAKKDLNKVLEIEPNNKRAKE 320          

HSP 3 Score: 49.2914 bits (116), Expect = 6.290e-6
Identity = 42/163 (25.77%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1832 DSEEKSSDNTSCLIGRSRTK----PMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQSSSNLAEIDCLQHLYQ*GCQ*KCFE*INNKYD 2308
            D   K + NT+   G  + K      T  +F +  N +R ++D  S  ++L   EPK L  ++  KLD  +  N+I ++      NG    SF   +L  + + +RF    M +    + +L+ L   L  S   L+ ID            K F  + NKY+
Sbjct:  941 DQPSKQAGNTTPTRGTKQKKIHLNKPTPYDFFQAWNTVR-RNDLTSYAEILRQVEPKMLPKILSNKLDADMFRNMIGAISTQLIPNGEEKLSFQ--ILQNVCQAQRFDMAIMFLGRQDIQDLQDLFAWLGSSQKLLSSIDS-----------KTFTIVKNKYN 1089          
BLAST of Sperm associated antigen 1 vs. Ensembl Nematostella
Match: EDO30468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0P9])

HSP 1 Score: 73.559 bits (179), Expect = 2.563e-14
Identity = 72/261 (27.59%), Postives = 114/261 (43.68%), Query Frame = 2
Query:  314 EIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSN------DQDLKTHSGXXXXXXXXXXDYNEWSKI-ADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKP 1072
            + + D   W ++I S DE LK    SG+         P  + Q+ K           DQ +K+             DY  W K+  DEL     LEEKEE     +        S           D  +     R + A+LEK+KGN+ FK G   EA+  YT ++ ++P +A++  NR +  +K +    A  D  + L  D S  KA  RR    S ++ L ++++D ++ ++L P NK A+      +  L++ SKP
Sbjct:   22 DFLKDLDRWEDDIKSKDEDLKISKTSGSTVGRACFRLPPVRNQAKKKKVKKNKDVSKDQKMKSR--------ISSYDYRSWDKLNVDELIND--LEEKEEMETLTS--------SDDGDGDEMLDDDDEQAEEERRLQRALLEKDKGNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSLDYSYTKAYLRRGKARSHLNKLHESLSDFKEALRLEPGNKQAQQE----ILNLKQVSKP 260          

HSP 2 Score: 63.5438 bits (153), Expect = 4.554e-11
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            KD GN  FK  RY++A+  Y   +   P+N I   NRA   L +ER      DC +A+ LD +   ++ RRGKA   +    +S+SD + AL++ P + Q +
Sbjct:  147 KDKGNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSLDYSYTKAYLRRGKARSHLNKLHESLSDFKEALRLEPGNKQAQ 248          
BLAST of Sperm associated antigen 1 vs. Ensembl Nematostella
Match: EDO38045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE44])

HSP 1 Score: 62.3882 bits (150), Expect = 1.284e-10
Identity = 31/96 (32.29%), Postives = 55/96 (57.29%), Query Frame = 2
Query: 1286 IKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKIS 1573
            +K+ GN+LF   +++DA+  Y K +   P+ P  + NRA C+L L++  +V+ DC  A++LD N     F  G+A      YD++++ L  A  ++
Sbjct:    6 LKEQGNRLFGAKQFDDAIQCYTKAILKNPTVPTYFTNRALCHLKLKKWGQVVSDCRQALELDANLVKGHFFNGQALIEQECYDEAITSLLKAFDLA 101          

HSP 2 Score: 49.2914 bits (116), Expect = 2.845e-6
Identity = 33/126 (26.19%), Postives = 55/126 (43.65%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSIEP-ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRM 1096
            KE+GN  F A   D+A+  YT+++   P +   + NR L ++K K W + + D    L+ D + +K          E     +AIT   K   L+   K        C   L ++ +  L + KR+
Sbjct:    7 KEQGNRLFGAKQFDDAIQCYTKAILKNPTVPTYFTNRALCHLKLKKWGQVVSDCRQALELDANLVKGHFFNGQALIEQECYDEAITSLLKAFDLAKEQKLNFGDDIACALRLARKKRFSLAEEKRI 132          
BLAST of Sperm associated antigen 1 vs. Ensembl Nematostella
Match: EDO34900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN44])

HSP 1 Score: 60.4622 bits (145), Expect = 3.519e-10
Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 2
Query: 1298 GNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIK 1594
            GN  FK  RY++A+  Y   +   P+N I   NRA   L +ER      DC +A+ LD +   ++ RRGKA   +    +S+SD + AL++ P + Q +
Sbjct:  127 GNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSLDYSYTKAYLRRGKARSHLNKLHESLSDFKEALRLEPGNKQAQ 225          

HSP 2 Score: 56.9954 bits (136), Expect = 4.211e-9
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 2
Query:  731 GNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAE 1024
            GN+ FK G   EA+  YT ++ ++P +A++  NR +  +K +    A  D  + L  D S  KA  RR    S ++ L ++++D ++ ++L P NK A+
Sbjct:  127 GNDFFKIGRYKEAINCYTTAMQLDPNNAIFPANRAMALLKVERHGAAELDCDLALSLDYSYTKAYLRRGKARSHLNKLHESLSDFKEALRLEPGNKQAQ 225          
BLAST of Sperm associated antigen 1 vs. Ensembl Nematostella
Match: EDO43207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZA5])

HSP 1 Score: 59.6918 bits (143), Expect = 2.513e-9
Identity = 37/119 (31.09%), Postives = 63/119 (52.94%), Query Frame = 2
Query: 1280 IKIKDHGNQLFKELRYEDALGIYN---KLVDGW----------PSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            +K+KD G + FK+ +Y+ A   Y    ++++G+          P    G+ N AAC+L L    K I+ C  A+D+DK +  + FRRGKA   +  Y+KS  D    L++ P + + ++
Sbjct:  273 LKVKDKGTKFFKDGKYKIACRQYAVVIRVLEGYFDEEEEKAVDPIKCAGHLNIAACHLKLGNNFKCIKACNKALDIDKENIKALFRRGKALLNLKDYEKSKEDFTQVLELDPKNREARE 391          
BLAST of Sperm associated antigen 1 vs. Ensembl Medaka
Match: tomm34 (translocase of outer mitochondrial membrane 34 [Source:NCBI gene;Acc:101167447])

HSP 1 Score: 97.8265 bits (242), Expect = 8.055e-22
Identity = 75/296 (25.34%), Postives = 133/296 (44.93%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-----EPISA----VYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            K+ GNE FK G   EAV  Y++++ +     E  SA    VY+NR   Y+K  N    ++D  ++L+  P N+K+L RRA+ Y  +   ++A  D R ++++  N   A++      + L +   P  ++  ++                      ++    AN        +  +K+   P   + D K    F   K+ GN L K+  Y  A+  Y + +   P+    Y NRA C L +++  + I DC  A+ +D  +  + +RR +A+K +      V DL+  LK+  N+
Sbjct:   14 KQAGNECFKTGQYGEAVNLYSQAIKVLEKSREEYSADLAIVYSNRAASYLKDGNCTACVKDCDMSLELSPFNVKSLLRRAAAYEAVEQYRNAYVDYRTVLQIDCNVTAAQDGTHRMTKALTEADGPSWRE--KLPPIPSVPVSVREKFARQSAANVKQHISAAN--------QNGIKQTNKPALSSEDIKKGQNF---KEEGNALVKKGDYRKAIDKYTQSLQHNPTEVTTYTNRALCYLSVKQFQEAISDCDKALMIDSGNIKALYRRAQAHKELKNIKACVEDLQCLLKVESNN 296          

HSP 2 Score: 72.7886 bits (177), Expect = 2.094e-13
Identity = 45/115 (39.13%), Postives = 65/115 (56.52%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSIEPIS-AVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKR 1063
            KE+GN   K GD  +A+  YT+SL   P     Y NR L Y+  K ++EAI D    L  D  NIKAL RRA  + E+ N++  + D + ++K+  NN  A   L + LQE++K+
Sbjct:  199 KEEGNALVKKGDYRKAIDKYTQSLQHNPTEVTTYTNRALCYLSVKQFQEAISDCDKALMIDSGNIKALYRRAQAHKELKNIKACVEDLQCLLKVESNNTAA---LKL-LQEVQKK 309          
BLAST of Sperm associated antigen 1 vs. Ensembl Medaka
Match: tomm34 (translocase of outer mitochondrial membrane 34 [Source:NCBI gene;Acc:101167447])

HSP 1 Score: 90.8929 bits (224), Expect = 9.427e-20
Identity = 70/278 (25.18%), Postives = 125/278 (44.96%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSLSI-----EPISA----VYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGV 1528
            K+ GNE FK G   EAV  Y++++ +     E  SA    VY+NR   Y+K  N    ++D  ++L+  P N+K+L RRA+ Y  +   ++A  D R ++++  N   A++      + L +   P  ++  ++                      ++    AN        +  +K+   P   + D K    F   K+ GN L K+  Y  A+  Y + +   P+    Y NRA C L +++  + I DC  A+ +D  +  + +RR +A+K + V
Sbjct:   14 KQAGNECFKTGQYGEAVNLYSQAIKVLEKSREEYSADLAIVYSNRAASYLKDGNCTACVKDCDMSLELSPFNVKSLLRRAAAYEAVEQYRNAYVDYRTVLQIDCNVTAAQDGTHRMTKALTEADGPSWRE--KLPPIPSVPVSVREKFARQSAANVKQHISAAN--------QNGIKQTNKPALSSEDIKKGQNF---KEEGNALVKKGDYRKAIDKYTQSLQHNPTEVTTYTNRALCYLSVKQFQEAISDCDKALMIDSGNIKALYRRAQAHKELKV 278          
BLAST of Sperm associated antigen 1 vs. Ensembl Medaka
Match: rpap3 (RNA polymerase II associated protein 3 [Source:NCBI gene;Acc:101155241])

HSP 1 Score: 92.8189 bits (229), Expect = 3.931e-19
Identity = 109/425 (25.65%), Postives = 168/425 (39.53%), Query Frame = 2
Query:  317 IMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQ 1588
             M + +SW  +I   D  L+     G     V N     KM+  +  NS+    K  +        K  DY  W K               +  K++A   +D    + +    SD  D A    V+ E  A+ EKEKGN  FK G  DEA+  YTR +  +P + V   NR   + + K +  A  D ++ +  D   +KA  RR +    +   Q A+ D +  +KL P N  A+N +   +QE                                              +E+    +E   E ++ ++   + + + E +  KD GN  FKE RYE A+  Y K ++    N +   NRA   L LER  +  EDC+ AI LD     +F RRG A   +    ++  D E  L++ P + Q
Sbjct:   24 FMRELESWEADIKKKDNELR---TGGKKLPPVRNKDHRAKMKKKQKSNSHS---KAETSAEEASRIKAYDYRSWDKF--------------DVDKALAEVDKDGGPEESHE---SDSEDAA----VDPE-TALTEKEKGNAFFKEGKYDEAIDCYTRGMDADPSNPVLPTNRASAFFRLKKFAVAESDCNLAIALDGRYVKAYCRRGAARFALKKYQPALEDYQAALKLDPGNVEAQNEVKK-IQE-------------------------------------------QTGDERSERQQEAPVENREHQTLLEEQRRQQEAVVHKDRGNAYFKEGRYEAAVECYTKGMEADCMNVLLPANRAMAFLKLERCAE--EDCSRAISLDNTYSKAFARRGTARAALRKPLEAKQDFERLLELEPGNKQ 374          

HSP 2 Score: 67.781 bits (164), Expect = 2.621e-11
Identity = 34/103 (33.01%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 1289 KDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKD 1597
            K+ GN  FKE +Y++A+  Y + +D  PSNP+   NRA+    L++      DC +AI LD     ++ RRG A   +  Y  ++ D + ALK+ P + + ++
Sbjct:  131 KEKGNAFFKEGKYDEAIDCYTRGMDADPSNPVLPTNRASAFFRLKKFAVAESDCNLAIALDGRYVKAYCRRGAARFALKKYQPALEDYQAALKLDPGNVEAQN 233          

HSP 3 Score: 51.6026 bits (122), Expect = 2.875e-6
Identity = 33/113 (29.20%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  698 REKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVY-NNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            R++ AV+ K++GN  FK G  + AV  YT+ +  + ++ +   NR + ++K +   E   D S  +  D +  KA  RR +  + +    +A  D  ++++L P NK A N L
Sbjct:  269 RQQEAVVHKDRGNAYFKEGRYEAAVECYTKGMEADCMNVLLPANRAMAFLKLERCAE--EDCSRAISLDNTYSKAFARRGTARAALRKPLEAKQDFERLLELEPGNKQALNEL 379          
BLAST of Sperm associated antigen 1 vs. Ensembl Medaka
Match: ENSORLT00000003423.2 (pep primary_assembly:ASM223467v1:16:5940334:5956235:-1 gene:ENSORLG00000002743.2 transcript:ENSORLT00000003423.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 5.431e-18
Identity = 84/344 (24.42%), Postives = 153/344 (44.48%), Query Frame = 2
Query:  593 SSKSVATERRDKPASQRNSKGL--SDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSL---------SIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKP----RLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            SSKS  ++R D P+S R +      D V+            A L+ E GN  FK G   +A+  Y++++         S + +  +Y+NR   ++K  N ++ I D +  L+  P ++K L RRA  Y  +   + A  D + ++++  + + A++ +S   + L ++  P    +L D   + ++         +  E          + A +E+  RD  E++                  F  +K  GN L K+ +Y  A+G Y + +   P     Y NRA C L  E   +  +DC  A+ L+  +  +F+RR  A++ +  Y  S SDL+  L++ P+
Sbjct:   76 SSKSSESQRED-PSSGRATAAQNGGDAVNLDAPCGALPPPLARLKNE-GNLLFKTGQFADALDKYSQAIQGYADSGIDSPQDLCILYSNRAACFLKDGNSQDCIEDCTRVLELQPFSLKPLLRRAMAYESLERYRRAYVDYKTVLQIDISVQAAQDGVSRITRMLMEQDGPEWREKLPDIPPVPLSAQQHRKVEPASAE---------VLQARAEKAARDAAEVL------------------FSALKQEGNDLVKKAQYHQAVGKYTECLKMKPDQCAVYTNRALCYLKQEMFTEAKQDCDAALKLEPTNMKAFYRRALAHRGLKDYLASRSDLQEVLRLDPS 390          

HSP 2 Score: 69.707 bits (169), Expect = 4.417e-12
Identity = 45/135 (33.33%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  641 RNSKGLSDKVDTAKMTNVEREKAAVL---EKEKGNEAFKAGDLDEAVIYYTRSLSIEP-ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            R  +  S +V  A+     R+ A VL    K++GN+  K     +AV  YT  L ++P   AVY NR L Y+KQ+ + EA +D    LK +P+N+KA  RRA  +  + +   + +D +++++L P+ + AE  L
Sbjct:  264 RKVEPASAEVLQARAEKAARDAAEVLFSALKQEGNDLVKKAQYHQAVGKYTECLKMKPDQCAVYTNRALCYLKQEMFTEAKQDCDAALKLEPTNMKAFYRRALAHRGLKDYLASRSDLQEVLRLDPSVQEAEKEL 398          
BLAST of Sperm associated antigen 1 vs. Ensembl Medaka
Match: spag1a (sperm-associated antigen 1A [Source:NCBI gene;Acc:101158289])

HSP 1 Score: 85.8853 bits (211), Expect = 1.670e-17
Identity = 72/295 (24.41%), Postives = 128/295 (43.39%), Query Frame = 2
Query:  722 KEKGNEAFKAGDLDEAVIYYTRSL---------SIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPN 1579
            K +GN  FK G   EA+  YT+++         S + +  +Y+NR   Y+K  N  + I+D +  L+  P ++K L RRA  Y  +   + A  D + ++++    + A + +    + L +   P  ++                       +I      V     ++    E  +      +     K E+ F  +K  GN L K+  +++AL  Y++ +   P +   Y NRA C L L    +  +DC  AI LD  +  +F+RR  A+K +  Y  + SDL+  L++ PN
Sbjct:   81 KNEGNHLFKHGQFGEALGKYTQAIEGCAEAGVDSPDDLCILYSNRAACYLKDGNSADCIQDCTKALELQPYSLKPLLRRAMAYESLERYRKAYVDYKTVLQMDTGIQAAHDSVHRITKMLIEEDGPEWRE--------------------KLPEIPAVPLSVQQQHREKPASIEQAQARAARAAQVDARKEEARFSLLKQEGNGLVKKGLFQEALQKYSECLALKPDDCALYTNRAICYLKLLNYEEAKQDCDSAIRLDPTNKKAFYRRALAFKGLQDYLSASSDLQEVLQLDPN 355          

HSP 2 Score: 70.0922 bits (170), Expect = 2.609e-12
Identity = 47/145 (32.41%), Postives = 79/145 (54.48%), Query Frame = 2
Query:  602 SVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPI-SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHL 1033
            SV  + R+KPAS   ++  +     A++   + E    L K++GN   K G   EA+  Y+  L+++P   A+Y NR + Y+K  N+EEA +D    ++ DP+N KA  RRA  +  + +   A +D +++++L PN   AE  L
Sbjct:  221 SVQQQHREKPASIEQAQ--ARAARAAQVDARKEEARFSLLKQEGNGLVKKGLFQEALQKYSECLALKPDDCALYTNRAICYLKLLNYEEAKQDCDSAIRLDPTNKKAFYRRALAFKGLQDYLSASSDLQEVLQLDPNVGEAEQEL 363          

HSP 3 Score: 59.3066 bits (142), Expect = 7.417e-9
Identity = 37/116 (31.90%), Postives = 56/116 (48.28%), Query Frame = 2
Query: 1247 DAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPS----NP----IGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKI 1570
            DA          ++K+ GN LFK  ++ +ALG Y + ++G       +P    I Y NRAAC L        I+DCT A++L   S     RR  AY+ +  Y K+  D +  L++
Sbjct:   67 DAPAGALPPHLARLKNEGNHLFKHGQFGEALGKYTQAIEGCAEAGVDSPDDLCILYSNRAACYLKDGNSADCIQDCTKALELQPYSLKPLLRRAMAYESLERYRKAYVDYKTVLQM 182          
BLAST of Sperm associated antigen 1 vs. Planmine SMEST
Match: SMESG000040140.1 (SMESG000040140.1)

HSP 1 Score: 1354.35 bits (3504), Expect = 0.000e+0
Identity = 735/735 (100.00%), Postives = 735/735 (100.00%), Query Frame = 2
Query:   56 MESCESLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGXXXXXXXXXXDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIXXXXXXXXXXXXXXXXXXXXXXXFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDXXXXXXXXXXXXXXXCDIXXXXXXXXXXXXXXXDIIDTFNSHDDSIFEEISLVKLEDGDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRSRTKPMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQSSSNLAEIDCLQHLYQ 2260
            MESCESLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGKPSKKSCKPKDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVITEIASDDETSSEDETKEKISEKTFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDELNEVETLIEEEKNKCDIESPSNENNSQNEMNEDIIDTFNSHDDSIFEEISLVKLEDGDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRSRTKPMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQSSSNLAEIDCLQHLYQ
Sbjct:    1 MESCESLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHLEDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEINSVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGKPSKKSCKPKDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKGLSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVITEIASDDETSSEDETKEKISEKTFVVANSEEKERDDKEIVKEIQDPKSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNHYQIKDELNEVETLIEEEKNKCDIESPSNENNSQNEMNEDIIDTFNSHDDSIFEEISLVKLEDGDVVHQDLSSTWEFLAHSELFDSEEKSSDNTSCLIGRSRTKPMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSLIGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKMMISDHAVSELEQLLKILKQSSSNLAEIDCLQHLYQ 735          
BLAST of Sperm associated antigen 1 vs. Planmine SMEST
Match: SMESG000055125.1 (SMESG000055125.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.154e-12
Identity = 42/111 (37.84%), Postives = 64/111 (57.66%), Query Frame = 2
Query:  698 REKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPI------SAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNN 1012
            +EK+  L K++GN +FK    DEA+ +YT ++S  P+      +  ++NRG    K    EEAI DLSI +K  P  +KAL RRA    +   L +A+ D ++I+K+ P N
Sbjct:  165 KEKSLYL-KDQGNASFKLEQYDEAIEFYTNAISTCPLQFNEEHAIFHSNRGTTLAKLVKNEEAINDLSIAIKLKPQYLKALVRRAELREKTEKLSEALEDYQEILKIDPKN 274          
BLAST of Sperm associated antigen 1 vs. Planmine SMEST
Match: SMESG000019044.1 (SMESG000019044.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.724e-11
Identity = 39/136 (28.68%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  659 SDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRS 1066
            S+  D++K+   E  K       K NE FK GD + A++ Y +S+ I P +  Y+NR   Y+K + +  A+ D  + +  DP+ +K   RRAS    +   + A  D   ++++  N+K A+  L  C + + +R+
Sbjct:    3 SENGDSSKIQKAEEHKI------KANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRA 132          
BLAST of Sperm associated antigen 1 vs. Planmine SMEST
Match: SMESG000024445.1 (SMESG000024445.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.986e-10
Identity = 37/111 (33.33%), Postives = 61/111 (54.95%), Query Frame = 2
Query: 1241 KSDAIDSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKIS 1573
            KS  ID  + SE   +K++GN+ F+   ++ A+  Y+  +   P+  I Y NRA C+L L+   K I DC  A++ D  S  ++F  G+AY   G Y++++  L  A  +S
Sbjct:   10 KSTYIDGVTHSE---LKEYGNRYFESSHFQKAVTCYSNAIKKLPNVSIYYTNRALCHLKLQDYNKCISDCKQALEFDSMSTKAYFYMGQAYMEQGNYEEALLRLLRAHDLS 117          
BLAST of Sperm associated antigen 1 vs. Planmine SMEST
Match: SMESG000063553.1 (SMESG000063553.1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.209e-9
Identity = 41/123 (33.33%), Postives = 68/123 (55.28%), Query Frame = 2
Query:  659 SDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEPISAV-YNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQD-AITDCRKIIKLSPNNKFA 1021
            +D + T    N+E    ++  KE GN+ FK GD   AV  Y+ ++S +  + V + NR + ++K  N+     D S  +  +  ++KAL RRA C   + NL+D A+ D + ++KL P+NK A
Sbjct:   91 NDDIKTIHKLNLEN---SIKLKEIGNDYFKKGDYLTAVEKYSEAISFDRNNDVLFTNRAMAHIKLGNYNAGETDCSQAIDINNKSVKALYRRAKCRLFL-NLKDQALVDFKTVLKLEPDNKLA 209          

HSP 2 Score: 50.8322 bits (120), Expect = 2.821e-6
Identity = 29/101 (28.71%), Postives = 55/101 (54.46%), Query Frame = 2
Query: 1280 IKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAACNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLEMALKISPNH 1582
            IK+K+ GN  FK+  Y  A+  Y++ +    +N + + NRA  ++ L        DC+ AID++  S  + +RR K    + + D+++ D +  LK+ P++
Sbjct:  106 IKLKEIGNDYFKKGDYLTAVEKYSEAISFDRNNDVLFTNRAMAHIKLGNYNAGETDCSQAIDINNKSVKALYRRAKCRLFLNLKDQALVDFKTVLKLEPDN 206          
The following BLAST results are available for this feature:
BLAST of Sperm associated antigen 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG15.775e-5838.62sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
SPAG15.775e-5838.62sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
SPAG14.075e-5438.62sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
SPAG14.075e-5438.62sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
RPAP37.556e-2430.36RNA polymerase II associated protein 3 [Source:HGN... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpap-32.414e-1434.65Rna (RNA) Polymerase II Associated Protein homolog... [more]
pph-53.280e-1231.03Serine/threonine-protein phosphatase 5 [Source:Un... [more]
fkb-61.260e-728.85Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-61.260e-728.85Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
sti-12.907e-730.10Stress-induced-phosphoprotein 1 [Source:UniProtKB... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spag13.411e-3130.81gene:FBgn0039463 transcript:FBtr0085068[more]
Fkbp594.475e-1334.31gene:FBgn0029174 transcript:FBtr0079872[more]
Fkbp594.475e-1334.31gene:FBgn0029174 transcript:FBtr0342837[more]
unc-452.253e-1234.45gene:FBgn0010812 transcript:FBtr0081788[more]
unc-452.253e-1234.45gene:FBgn0010812 transcript:FBtr0347497[more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spag1b6.705e-3028.92sperm associated antigen 1b [Source:ZFIN;Acc:ZDB-G... [more]
tomm347.466e-2226.67translocase of outer mitochondrial membrane 34 [So... [more]
tomm347.466e-2226.67translocase of outer mitochondrial membrane 34 [So... [more]
rpap31.441e-1922.71RNA polymerase II associated protein 3 [Source:ZFI... [more]
spag1a8.380e-1823.39sperm associated antigen 1a [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG12.713e-4734.29sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
SPAG13.255e-4734.29sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
rpap33.057e-2632.33RNA polymerase II associated protein 3 [Source:NCB... [more]
SPAG13.530e-2143.69sperm associated antigen 1 [Source:HGNC Symbol;Acc... [more]
rpap36.953e-1828.84RNA polymerase II associated protein 3 [Source:NCB... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spag13.800e-5338.14sperm associated antigen 1 [Source:MGI Symbol;Acc:... [more]
Spag13.800e-5338.14sperm associated antigen 1 [Source:MGI Symbol;Acc:... [more]
Spag12.501e-1752.70sperm associated antigen 1 [Source:MGI Symbol;Acc:... [more]
Tomm342.312e-1527.42translocase of outer mitochondrial membrane 34 [So... [more]
Tomm345.213e-1527.42translocase of outer mitochondrial membrane 34 [So... [more]
back to top
BLAST of Sperm associated antigen 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U2X2|SPAG1_RAT5.703e-5439.19Sperm-associated antigen 1 OS=Rattus norvegicus OX... [more]
sp|Q07617|SPAG1_HUMAN1.957e-5338.62Sperm-associated antigen 1 OS=Homo sapiens OX=9606... [more]
sp|Q80ZX8|SPAG1_MOUSE2.658e-5238.14Sperm-associated antigen 1 OS=Mus musculus OX=1009... [more]
sp|Q28IV3|RPAP3_XENTR1.620e-2532.33RNA polymerase II-associated protein 3 OS=Xenopus ... [more]
sp|Q6NU95|RPAP3_XENLA5.672e-2533.77RNA polymerase II-associated protein 3 OS=Xenopus ... [more]
back to top
BLAST of Sperm associated antigen 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7MZV49.074e-6334.11Uncharacterized protein OS=Macaca mulatta OX=9544 ... [more]
A0A2K5IWV91.508e-6234.50Sperm associated antigen 1 OS=Colobus angolensis p... [more]
A0A2R8ZPR92.828e-6234.31Sperm associated antigen 1 OS=Pan paniscus OX=9597... [more]
I3M7D28.480e-6234.36Sperm associated antigen 1 OS=Ictidomys tridecemli... [more]
A0A4W2FLT11.423e-6133.40Sperm associated antigen 1 OS=Bos indicus x Bos ta... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000012211.27.432e-4634.11sperm associated antigen 1 [Source:NCBI gene;Acc:1... [more]
rpap31.509e-2529.57RNA polymerase II associated protein 3 [Source:ZFI... [more]
tomm345.827e-2226.67translocase of outer mitochondrial membrane 34 [So... [more]
spag1a9.195e-1823.83sperm associated antigen 1a [Source:NCBI gene;Acc:... [more]
dnajc76.134e-1238.83DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010032.12.156e-3930.94pep scaffold:Pmarinus_7.0:GL480182:186:9247:1 gene... [more]
ENSPMAT00000010034.12.230e-3931.05pep scaffold:Pmarinus_7.0:GL480182:186:9247:1 gene... [more]
ENSPMAT00000010036.16.379e-3930.80pep scaffold:Pmarinus_7.0:GL480182:213:9247:1 gene... [more]
ENSPMAT00000005772.12.656e-1337.14pep scaffold:Pmarinus_7.0:GL478792:23408:39519:-1 ... [more]
ttc11.949e-1131.58tetratricopeptide repeat domain 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TAH12.277e-838.33Component of conserved R2TP complex (Rvb1-Rvb2-Tah... [more]
PPT13.233e-829.75Protein serine/threonine phosphatase; regulates Hs... [more]
TOM714.050e-830.91Mitochondrial outer membrane protein; probable min... [more]
STI17.020e-827.05Hsp90 cochaperone; regulates spatial organization ... [more]
TOM702.140e-726.63Component of the TOM (translocase of outer membran... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO312072.804e-4234.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304682.563e-1427.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380451.284e-1032.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349003.519e-1034.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432072.513e-931.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tomm348.055e-2225.34translocase of outer mitochondrial membrane 34 [So... [more]
tomm349.427e-2025.18translocase of outer mitochondrial membrane 34 [So... [more]
rpap33.931e-1925.65RNA polymerase II associated protein 3 [Source:NCB... [more]
ENSORLT00000003423.25.431e-1824.42pep primary_assembly:ASM223467v1:16:5940334:595623... [more]
spag1a1.670e-1724.41sperm-associated antigen 1A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sperm associated antigen 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040140.10.000e+0100.00SMESG000040140.1[more]
SMESG000055125.11.154e-1237.84SMESG000055125.1[more]
SMESG000019044.12.724e-1128.68SMESG000019044.1[more]
SMESG000024445.11.986e-1033.33SMESG000024445.1[more]
SMESG000063553.19.209e-933.33SMESG000063553.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033795 ID=SMED30033795|Name=Sperm associated antigen 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2375bp
CATTATTATTATTTAAAGTCGCTTTTGTTTTAAAATTATTCATAGCAACG
AACAGATGGAATCTTGTGAAAGTCTTTCTAAAACGTTTAAGATTCCAATC
AGTTATTTGGATTATGATCATATTGAAAAGTGTACCAATGTTCTGGAACT
AGAAAAAATCTATTTAACTCTCAAATCTGGTGAAGAAGGAAAATATCCTC
ATTTAGAAGATTTTTGTGAAAAGCGATTGCAAAAGTTGTCGCCTGATAGT
CGAGTTTTAAGAAAAGCCACTGAAATGTTGTCCATTAATCAATTAGACTC
TTCAATTAAAGAAGAAATAATGAGTGATTTTCAATCATGGGTCAATGAAA
TAAATTCCGTCGATGAATCACTTAAGAAGCCCATGCTATCGGGAAATGGG
GATAATGAAGTGAATAATAATTTTCCCATAAGAAAAATGCAAAGCGTGAA
ACTTGGAAATAGTAATGATCAAGATTTAAAGACCCATAGTGGAAAACCAA
GCAAGAAATCATGCAAACCTAAAGATTACAATGAATGGTCCAAAATTGCC
GACGAACTTGAGAAGCAAATGATTTTGGAAGAGAAAGAAGAATCGTCGAA
GTCCGTTGCCACCGAGAGGAGAGATAAACCGGCGTCACAAAGAAATAGTA
AAGGCCTATCGGATAAAGTCGACACGGCAAAAATGACAAATGTAGAAAGA
GAAAAAGCTGCCGTGTTAGAAAAAGAAAAGGGAAATGAAGCTTTTAAAGC
AGGAGATTTGGATGAAGCGGTGATTTACTACACTCGCAGCCTGTCAATTG
AGCCCATTTCAGCAGTTTACAATAATAGGGGATTAGTTTATATGAAACAA
AAGAATTGGGAAGAAGCAATTCGTGACCTGTCTATAACTCTAAAAAAAGA
TCCATCAAACATTAAAGCCTTACAAAGACGAGCTAGCTGTTATTCAGAAA
TTCACAATTTACAAGATGCTATCACAGATTGCCGAAAAATTATTAAGCTG
AGTCCTAATAATAAGTTTGCAGAAAACCATTTGAGTATTTGTCTTCAAGA
ACTTGAAAAACGATCTAAGCCAAGGCTTAAGGACGGTAAACGCATGGTTA
TTACCGAGATTGCATCAGATGATGAAACTTCGAGTGAAGATGAAACGAAA
GAAAAAATTTCCGAAAAGACATTTGTTGTCGCAAATTCTGAAGAAAAAGA
ACGGGATGACAAAGAGATAGTAAAGGAAATTCAAGATCCAAAATCTGATG
CCATTGACAGTAAATCCGAATCAGAATTTATAAAGATCAAAGATCACGGC
AACCAATTATTTAAAGAGCTAAGATATGAAGATGCTTTGGGAATATATAA
TAAATTGGTAGACGGCTGGCCATCAAATCCTATTGGCTATAGAAATCGAG
CTGCTTGTAATTTGGTTTTGGAAAGACCAATGAAAGTTATTGAAGATTGT
ACTATTGCAATTGATTTAGATAAAAATTCTCATCTTTCATTTTTCCGTCG
GGGTAAAGCATATAAGATGATCGGGGTATATGATAAAAGTGTTTCTGATC
TCGAGATGGCGCTGAAAATTTCACCAAACCATTATCAAATTAAGGATGAA
CTTAACGAAGTGGAAACATTGATAGAAGAGGAGAAAAATAAATGTGATAT
TGAATCGCCATCGAATGAGAACAATTCTCAGAATGAAATGAATGAGGATA
TTATCGACACATTCAATTCACACGATGACAGCATTTTCGAAGAAATATCT
CTTGTTAAACTAGAAGACGGCGATGTTGTTCACCAAGATCTTTCAAGCAC
TTGGGAATTTCTTGCCCATTCAGAACTTTTTGACAGCGAAGAAAAATCTT
CTGATAATACCAGTTGTTTAATAGGACGTTCGAGAACCAAACCAATGACA
AAATGCGAATTCGATAAAGAGCTGAATAACATTCGTATAAAGTCTGACTG
GAAATCTACAGTTCAACTTCTGGTTGATTCTGAGCCGAAAAATTTACGTT
CGTTAATCGGTACGAAACTTGACGGATTCATCCTAGAAAATATAATATCG
AGCCTGCTGATTTATTGTACTCATAACGGTGCGCCAGTAGCATCATTTAT
GCAGTCAGTATTACTTGAACTGTCCAAAGTCGAGAGATTCTGCTTTGTCA
AAATGATGATATCAGATCACGCCGTCTCGGAGCTTGAGCAACTGCTCAAA
ATTTTAAAACAAAGCAGCAGCAATCTGGCAGAAATTGACTGTTTGCAACA
TCTTTATCAGTGAGGGTGCCAGTGAAAATGTTTTGAATAAATAAATAACA
AATACGACTTTATTCAATTGAAACTGTACATTACATTTTTATGAATATTT
CGACAATTATAATTAAATATTGACA
back to top

protein sequence of SMED30033795-orf-1

>SMED30033795-orf-1 ID=SMED30033795-orf-1|Name=SMED30033795-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=736bp
MESCESLSKTFKIPISYLDYDHIEKCTNVLELEKIYLTLKSGEEGKYPHL
EDFCEKRLQKLSPDSRVLRKATEMLSINQLDSSIKEEIMSDFQSWVNEIN
SVDESLKKPMLSGNGDNEVNNNFPIRKMQSVKLGNSNDQDLKTHSGKPSK
KSCKPKDYNEWSKIADELEKQMILEEKEESSKSVATERRDKPASQRNSKG
LSDKVDTAKMTNVEREKAAVLEKEKGNEAFKAGDLDEAVIYYTRSLSIEP
ISAVYNNRGLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIH
NLQDAITDCRKIIKLSPNNKFAENHLSICLQELEKRSKPRLKDGKRMVIT
EIASDDETSSEDETKEKISEKTFVVANSEEKERDDKEIVKEIQDPKSDAI
DSKSESEFIKIKDHGNQLFKELRYEDALGIYNKLVDGWPSNPIGYRNRAA
CNLVLERPMKVIEDCTIAIDLDKNSHLSFFRRGKAYKMIGVYDKSVSDLE
MALKISPNHYQIKDELNEVETLIEEEKNKCDIESPSNENNSQNEMNEDII
DTFNSHDDSIFEEISLVKLEDGDVVHQDLSSTWEFLAHSELFDSEEKSSD
NTSCLIGRSRTKPMTKCEFDKELNNIRIKSDWKSTVQLLVDSEPKNLRSL
IGTKLDGFILENIISSLLIYCTHNGAPVASFMQSVLLELSKVERFCFVKM
MISDHAVSELEQLLKILKQSSSNLAEIDCLQHLYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR025986RPAP3-like_C
IPR013105TPR_2
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0005525GTP binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007338single fertilization
GO:0070286axonemal dynein complex assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 158..178
NoneNo IPR availableCOILSCoilCoilcoord: 509..529
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 143..158
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 133..158
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..206
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..197
NoneNo IPR availablePANTHERPTHR45984FAMILY NOT NAMEDcoord: 380..733
NoneNo IPR availablePANTHERPTHR45984:SF3SPERM-ASSOCIATED ANTIGEN 1coord: 380..733
coord: 8..386
NoneNo IPR availablePANTHERPTHR45984FAMILY NOT NAMEDcoord: 8..386
NoneNo IPR availableCDDcd09857PIN_EXO1coord: 209..250
e-value: 0.00731768
score: 36.2283
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 253..285
e-value: 0.0023
score: 27.2
coord: 286..319
e-value: 1.4E-4
score: 31.2
coord: 476..509
e-value: 0.023
score: 23.9
coord: 442..475
e-value: 8.0
score: 15.4
coord: 219..252
e-value: 0.045
score: 22.9
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 287..319
e-value: 0.18
score: 12.1
coord: 225..250
e-value: 0.095
score: 13.0
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 408..441
score: 5.251
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 252..285
score: 10.65
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 286..319
score: 8.496
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 219..251
score: 5.045
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 476..509
score: 9.263
IPR025986RNA-polymerase II-associated protein 3-like, C-terminal domainPFAMPF13877RPAP3_Ccoord: 613..705
e-value: 1.6E-10
score: 41.3
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 206..340
e-value: 4.2E-34
score: 119.4
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 397..559
e-value: 4.5E-31
score: 109.9
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 219..337
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 411..525
IPR013105Tetratricopeptide repeat 2PFAMPF07719TPR_2coord: 254..285
e-value: 4.1E-5
score: 23.4
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 252..319
score: 17.648
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 408..509
score: 13.168
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 219..252
score: 8.082