Potassium voltage-gated channel subfamily KQT member 1

NamePotassium voltage-gated channel subfamily KQT member 1
Smed IDSMED30033794
Length (bp)3099
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Potassium voltage-gated channel subfamily KQT member 1 (SMED30033794) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily KQT member 1 (SMED30033794) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel subfamily KQT member 1 (SMED30033794) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily KQT member 1 (SMED30033794) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 9

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033794h1SMcG0022237 SmedASXL_015182SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033794h1SMcG0022237 Contig49975uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033794h1SMcG0022237 Contig49975newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30033794h1SMcG0022237 dd_Smed_v4_15923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033794h1SMcG0022237 dd_Smed_v4_15923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033794h1SMcG0022237 dd_Smed_v4_15923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033794h1SMcG0022237 dd_Smed_v4_15923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033794h1SMcG0022237 dd_Smed_v4_15923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033794h1SMcG0022237 dd_Smed_v6_15923_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 467.618 bits (1202), Expect = 1.554e-151
Identity = 241/323 (74.61%), Postives = 269/323 (83.28%), Query Frame = 2

HSP 2 Score: 142.895 bits (359), Expect = 1.949e-34
Identity = 73/138 (52.90%), Postives = 100/138 (72.46%), Query Frame = 2
            RT S  ED + E ++  T +    +L E H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 428.328 bits (1100), Expect = 2.905e-138
Identity = 206/264 (78.03%), Postives = 227/264 (85.98%), Query Frame = 2

HSP 2 Score: 142.51 bits (358), Expect = 7.108e-35
Identity = 73/138 (52.90%), Postives = 100/138 (72.46%), Query Frame = 2
            RT S  ED + E ++  T +    +L E H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ4 (potassium voltage-gated channel subfamily Q member 4 [Source:HGNC Symbol;Acc:HGNC:6298])

HSP 1 Score: 400.208 bits (1027), Expect = 1.211e-125
Identity = 254/610 (41.64%), Postives = 348/610 (57.05%), Query Frame = 2
            QRS   H    +  Q  +YN LE P GW  F+YH  +FLLV  CL+LSVLSTI  ++E+A   L  +E V+++ FG EY +R+WSAGC  +Y G++GR RFARKP  +ID +V +AS  V+  G++G +FATSA+R +RFLQILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LIF+S+ VYLAE  +N D              F SYAD+LWWG IT+TTIGYGD  P TW+G+++A+ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQ  WR Y+     + L +TW  Y  +           ++    R       E+R A     A  R        RP ST F P           G+ +     D+   G+S +     +Q  APP    +P  P+   +   ATS            R  F A   ++PR        +E  EE   +C       ELT D      K  IR IR ++F +A+R+F++  +PYDV+DVIEQYS GHL+M+ RIK LQ R+DQ +G+ P  R  ++K D+          ++++ R+ ++E Q   ++ KLD +L   SR
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ5 (potassium voltage-gated channel subfamily Q member 5 [Source:HGNC Symbol;Acc:HGNC:6299])

HSP 1 Score: 405.601 bits (1041), Expect = 5.566e-125
Identity = 252/610 (41.31%), Postives = 353/610 (57.87%), Query Frame = 2
            R+SR      R+ L    L++ ++   R        Q  +YN LE P GW  F+YH  VFL V  CLILSV STI  + ++A + L  +E V+++ FG E+ IR+WSAGC  +Y G++GR+RFARKP  +ID +VL+AS  V+   ++G +FATSA+R +RFLQILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LIFSS+ VYL E  +N++              F +YADALWWG IT+TTIGYGD  P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQC+WR YA    S   +TWK + +    C   +      +S ++ S  F E       RMA     SI+ ++ S                G   S + D      +++G  +K Q+S   N      R  FR            +R   S  +P     T    +D  +E   +C    +  +LT   K  IR IR M+F +A+R+F++  +PYDV+DVIEQYS GHL+M+ RIK LQ R+DQ +GK  + S  DK+ R ++T          +L R+ ++E Q   ++SKLD +L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ5 (potassium voltage-gated channel subfamily Q member 5 [Source:HGNC Symbol;Acc:HGNC:6299])

HSP 1 Score: 405.216 bits (1040), Expect = 7.444e-125
Identity = 253/610 (41.48%), Postives = 354/610 (58.03%), Query Frame = 2
            R+SR      R+ L    L++ ++   R        Q  +YN LE P GW  F+YH  VFLLV  CLILSV STI  + ++A + L  +E V+++ FG E+ IR+WSAGC  +Y G++GR+RFARKP  +ID +VL+AS  V+   ++G +FATSA+R +RFLQILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LIFSS+ VYL E  +N++              F +YADALWWG IT+TTIGYGD  P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQC+WR YA    S   +TWK + +    C   +      +S ++ S  F E       RMA     SI+ ++ S                G   S + D      +++G  +K Q+S   N      R  FR            +R   S  +P     T    +D  +E   +C    +  +LT   K  IR IR M+F +A+R+F++  +PYDV+DVIEQYS GHL+M+ RIK LQ R+DQ +GK  + S  DK+ R ++T          +L R+ ++E Q   ++SKLD +L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 430.254 bits (1105), Expect = 4.801e-139
Identity = 213/300 (71.00%), Postives = 253/300 (84.33%), Query Frame = 2

HSP 2 Score: 132.109 bits (331), Expect = 9.514e-32
Identity = 64/101 (63.37%), Postives = 80/101 (79.21%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 430.254 bits (1105), Expect = 4.801e-139
Identity = 213/300 (71.00%), Postives = 253/300 (84.33%), Query Frame = 2

HSP 2 Score: 132.109 bits (331), Expect = 9.514e-32
Identity = 64/101 (63.37%), Postives = 80/101 (79.21%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 430.639 bits (1106), Expect = 1.454e-138
Identity = 213/300 (71.00%), Postives = 253/300 (84.33%), Query Frame = 2

HSP 2 Score: 132.494 bits (332), Expect = 1.258e-31
Identity = 64/101 (63.37%), Postives = 80/101 (79.21%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 430.639 bits (1106), Expect = 1.454e-138
Identity = 213/300 (71.00%), Postives = 253/300 (84.33%), Query Frame = 2

HSP 2 Score: 132.494 bits (332), Expect = 1.258e-31
Identity = 64/101 (63.37%), Postives = 80/101 (79.21%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 430.254 bits (1105), Expect = 1.556e-138
Identity = 213/300 (71.00%), Postives = 253/300 (84.33%), Query Frame = 2

HSP 2 Score: 131.724 bits (330), Expect = 1.745e-31
Identity = 64/101 (63.37%), Postives = 80/101 (79.21%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0299832)

HSP 1 Score: 361.303 bits (926), Expect = 1.924e-111
Identity = 180/300 (60.00%), Postives = 220/300 (73.33%), Query Frame = 2

HSP 2 Score: 93.2041 bits (230), Expect = 5.052e-19
Identity = 62/192 (32.29%), Postives = 107/192 (55.73%), Query Frame = 2
            EE +  CT      +LT  HK AIR IR++++F+A R+F++A KPYDV+DV+EQY+ GH++++ R+K L  R+DQ +GK         +D   +++++ SR+ ++E Q   ++ KLD ++          L L   A   I++   SH      P H  +N +    V+++++  S +  Q  T  LL+P+ 
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0299833)

HSP 1 Score: 362.844 bits (930), Expect = 4.619e-111
Identity = 180/300 (60.00%), Postives = 220/300 (73.33%), Query Frame = 2

HSP 2 Score: 93.2041 bits (230), Expect = 6.508e-19
Identity = 62/192 (32.29%), Postives = 107/192 (55.73%), Query Frame = 2
            EE +  CT      +LT  HK AIR IR++++F+A R+F++A KPYDV+DV+EQY+ GH++++ R+K L  R+DQ +GK         +D   +++++ SR+ ++E Q   ++ KLD ++          L L   A   I++   SH      P H  +N +    V+++++  S +  Q  T  LL+P+ 
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310097)

HSP 1 Score: 362.073 bits (928), Expect = 1.074e-110
Identity = 180/300 (60.00%), Postives = 220/300 (73.33%), Query Frame = 2

HSP 2 Score: 92.8189 bits (229), Expect = 7.157e-19
Identity = 62/192 (32.29%), Postives = 107/192 (55.73%), Query Frame = 2
            EE +  CT      +LT  HK AIR IR++++F+A R+F++A KPYDV+DV+EQY+ GH++++ R+K L  R+DQ +GK         +D   +++++ SR+ ++E Q   ++ KLD ++          L L   A   I++   SH      P H  +N +    V+++++  S +  Q  T  LL+P+ 
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310093)

HSP 1 Score: 362.459 bits (929), Expect = 1.394e-110
Identity = 180/300 (60.00%), Postives = 220/300 (73.33%), Query Frame = 2

HSP 2 Score: 92.8189 bits (229), Expect = 8.606e-19
Identity = 62/192 (32.29%), Postives = 107/192 (55.73%), Query Frame = 2
            EE +  CT      +LT  HK AIR IR++++F+A R+F++A KPYDV+DV+EQY+ GH++++ R+K L  R+DQ +GK         +D   +++++ SR+ ++E Q   ++ KLD ++          L L   A   I++   SH      P H  +N +    V+++++  S +  Q  T  LL+P+ 
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310094)

HSP 1 Score: 363.229 bits (931), Expect = 1.400e-110
Identity = 180/300 (60.00%), Postives = 220/300 (73.33%), Query Frame = 2

HSP 2 Score: 92.8189 bits (229), Expect = 8.134e-19
Identity = 62/192 (32.29%), Postives = 107/192 (55.73%), Query Frame = 2
            EE +  CT      +LT  HK AIR IR++++F+A R+F++A KPYDV+DV+EQY+ GH++++ R+K L  R+DQ +GK         +D   +++++ SR+ ++E Q   ++ KLD ++          L L   A   I++   SH      P H  +N +    V+++++  S +  Q  T  LL+P+ 
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 471.855 bits (1213), Expect = 7.895e-154
Identity = 237/325 (72.92%), Postives = 270/325 (83.08%), Query Frame = 2

HSP 2 Score: 129.028 bits (323), Expect = 2.812e-30
Identity = 77/166 (46.39%), Postives = 106/166 (63.86%), Query Frame = 2
            D  E++ E   +  P+    +L + H+ AIRVI+RM +F+A ++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+D S+GK   F  S +  +D+   T+ SRLNR++ +   MD  L+ I     L+L+R     +     QRS+  R  A  + SV +SS
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 471.855 bits (1213), Expect = 8.886e-154
Identity = 237/325 (72.92%), Postives = 270/325 (83.08%), Query Frame = 2

HSP 2 Score: 129.028 bits (323), Expect = 2.846e-30
Identity = 77/166 (46.39%), Postives = 106/166 (63.86%), Query Frame = 2
            D  E++ E   +  P+    +L + H+ AIRVI+RM +F+A ++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+D S+GK   F  S +  +D+   T+ SRLNR++ +   MD  L+ I     L+L+R     +     QRS+  R  A  + SV +SS
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 461.07 bits (1185), Expect = 5.140e-152
Identity = 237/324 (73.15%), Postives = 270/324 (83.33%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.2 (potassium voltage-gated channel, KQT-like subfamily, member 1.2 [Source:ZFIN;Acc:ZDB-GENE-130530-935])

HSP 1 Score: 432.18 bits (1110), Expect = 3.784e-140
Identity = 227/303 (74.92%), Postives = 255/303 (84.16%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq2b (potassium voltage-gated channel, KQT-like subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-120130-1])

HSP 1 Score: 339.347 bits (869), Expect = 1.563e-101
Identity = 170/301 (56.48%), Postives = 221/301 (73.42%), Query Frame = 2

HSP 2 Score: 92.4337 bits (228), Expect = 1.340e-18
Identity = 47/125 (37.60%), Postives = 76/125 (60.80%), Query Frame = 2
            ED  + +  C     P +LT   K+ IR +  M+F +++R+F+++ +PYDV DVIEQYS GHL+M+ RIK LQ R+DQ +G+    + +D+   T         +++ RL ++E Q + M+ KLD
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046823.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 470.7 bits (1210), Expect = 8.323e-156
Identity = 238/308 (77.27%), Postives = 261/308 (84.74%), Query Frame = 2

HSP 2 Score: 110.153 bits (274), Expect = 1.329e-24
Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046791.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 476.478 bits (1225), Expect = 2.021e-155
Identity = 238/308 (77.27%), Postives = 261/308 (84.74%), Query Frame = 2

HSP 2 Score: 147.132 bits (370), Expect = 6.280e-36
Identity = 75/132 (56.82%), Postives = 95/132 (71.97%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046831.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 464.537 bits (1194), Expect = 8.280e-155
Identity = 236/308 (76.62%), Postives = 261/308 (84.74%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046772.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 475.707 bits (1223), Expect = 1.126e-154
Identity = 238/308 (77.27%), Postives = 261/308 (84.74%), Query Frame = 2

HSP 2 Score: 144.05 bits (362), Expect = 8.946e-35
Identity = 69/106 (65.09%), Postives = 83/106 (78.30%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: kri1 (KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517])

HSP 1 Score: 460.299 bits (1183), Expect = 1.602e-151
Identity = 246/362 (67.96%), Postives = 280/362 (77.35%), Query Frame = 2

HSP 2 Score: 103.219 bits (256), Expect = 2.542e-22
Identity = 46/58 (79.31%), Postives = 54/58 (93.10%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq1 (potassium voltage-gated channel, subfamily Q, member 1 [Source:MGI Symbol;Acc:MGI:108083])

HSP 1 Score: 468.003 bits (1203), Expect = 5.120e-152
Identity = 239/324 (73.77%), Postives = 268/324 (82.72%), Query Frame = 2

HSP 2 Score: 141.354 bits (355), Expect = 4.525e-34
Identity = 72/138 (52.17%), Postives = 100/138 (72.46%), Query Frame = 2
            RT S  ED + E ++  T +    +L + H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq1 (potassium voltage-gated channel, subfamily Q, member 1 [Source:MGI Symbol;Acc:MGI:108083])

HSP 1 Score: 457.988 bits (1177), Expect = 1.918e-151
Identity = 239/324 (73.77%), Postives = 268/324 (82.72%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 402.905 bits (1034), Expect = 3.721e-124
Identity = 246/574 (42.86%), Postives = 342/574 (59.58%), Query Frame = 2
            Q  +YN LE P GW  F+YH  VFLLV  CLILSV STI  + ++A + L  +E V+++ FG E+ IR+WSAGC  +Y G++GR+RFARKP  +ID +VL+AS  V+   ++G +FATSA+R +RFLQILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LIFSS+ VYL E  +N++              F +YADALWWG IT+TTIGYGD  P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQC+WR YA    S   +TWK + +    C   +      +S ++ S  F E       RMA     SI+ ++ S                G   S + D      +++G  +K Q+S   N      R  FR            +R   S  +P     T    +D  +E   +C    +  +LT   K  IR IR M+F +A+R+F++  +PYDV+DVIEQYS GHL+M+ RIK LQ R+DQ +GK  + S  DK+ R ++T          +L+R+ ++E Q   ++SKLD +L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 402.519 bits (1033), Expect = 6.452e-124
Identity = 249/586 (42.49%), Postives = 347/586 (59.22%), Query Frame = 2
            Q  +YN LE P GW  F+YH  VFLLV  CLILSV STI  + ++A + L  +E V+++ FG E+ IR+WSAGC  +Y G++GR+RFARKP  +ID +VL+AS  V+   ++G +FATSA+R +RFLQILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LIFSS+ VYL E  +N++              F +YADALWWG IT+TTIGYGD  P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQC+WR YA    S   +TWK + +    C   +      +S +  S+   FF       + +  SFK   RMA     SI+ ++ S                G   S + D      +++G  +K Q+S   N      R  FR            +R   S  +P     T    +D  +E   +C    +  +LT   K  IR IR M+F +A+R+F++  +PYDV+DVIEQYS GHL+M+ RIK LQ R+DQ +GK  + S  DK+ R ++T          +L+R+ ++E Q   ++SKLD +L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq2 (potassium voltage-gated channel, subfamily Q, member 2 [Source:MGI Symbol;Acc:MGI:1309503])

HSP 1 Score: 397.512 bits (1020), Expect = 4.883e-123
Identity = 241/578 (41.70%), Postives = 341/578 (59.00%), Query Frame = 2
            Q  +YN LE P GW  F+YH  VFLLV  CL+LSV STI  Y + +   L+ +EIV ++ FG EY +R+W+AGC  +Y G+RGR++FARKP  +ID++VL+AS  VL  GS+G VFATSA+R +RFLQILRM+ +DR+GGTW+LLGSVVY H +EL+T  YIGFL LI +S+ VYLAE   N+              +F +YADALWWG+IT+TTIGYGD  P+TW G+++A+ F++  +SFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQ  WR YA +   ++LHSTW+ Y +  +           G      S     +      R  +  S    R+ P     P  + S       +  SS      +G  S Q +T +   SA       P+ +P       RS +  A       R   +A R    + ++  ++  E++ S C       +LT   K++IR +  M+F +++R+F+++ +PYDV DVIEQYS GHL+M+ RIK LQ R+DQ +G+    +  DK DRT+           +++ RL ++E Q + M+ KLD
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|O70344|KCNQ1_CAVPO (Potassium voltage-gated channel subfamily KQT member 1 OS=Cavia porcellus OX=10141 GN=KCNQ1 PE=2 SV=3)

HSP 1 Score: 469.929 bits (1208), Expect = 7.470e-152
Identity = 241/324 (74.38%), Postives = 268/324 (82.72%), Query Frame = 2

HSP 2 Score: 143.665 bits (361), Expect = 5.284e-34
Identity = 75/145 (51.72%), Postives = 102/145 (70.34%), Query Frame = 2
            V P    RT S  ED + E ++  T +    +L E H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P70057|KCNQ1_XENLA (Potassium voltage-gated channel subfamily KQT member 1 OS=Xenopus laevis OX=8355 GN=kcnq1 PE=1 SV=2)

HSP 1 Score: 468.003 bits (1203), Expect = 2.431e-151
Identity = 248/354 (70.06%), Postives = 279/354 (78.81%), Query Frame = 2

HSP 2 Score: 148.288 bits (373), Expect = 1.281e-35
Identity = 84/167 (50.30%), Postives = 110/167 (65.87%), Query Frame = 2
            VR  F  + P      RT S  +D + E D+  T +    EL E H+ AI+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQS+GKP  FL      +D+   T+ SRLNR+E +  +MD KL+ I  +L  + +   N Q S   R+
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P97414|KCNQ1_MOUSE (Potassium voltage-gated channel subfamily KQT member 1 OS=Mus musculus OX=10090 GN=Kcnq1 PE=1 SV=3)

HSP 1 Score: 468.003 bits (1203), Expect = 3.581e-151
Identity = 239/324 (73.77%), Postives = 268/324 (82.72%), Query Frame = 2

HSP 2 Score: 141.354 bits (355), Expect = 3.165e-33
Identity = 72/138 (52.17%), Postives = 100/138 (72.46%), Query Frame = 2
            RT S  ED + E ++  T +    +L + H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|O97531|KCNQ1_FELCA (Potassium voltage-gated channel subfamily KQT member 1 (Fragment) OS=Felis catus OX=9685 GN=KCNQ1 PE=2 SV=2)

HSP 1 Score: 464.537 bits (1194), Expect = 4.789e-151
Identity = 233/299 (77.93%), Postives = 258/299 (86.29%), Query Frame = 2

HSP 2 Score: 141.739 bits (356), Expect = 1.157e-33
Identity = 72/138 (52.17%), Postives = 99/138 (71.74%), Query Frame = 2
            RT S  ED + E ++    +    +L E H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P51787|KCNQ1_HUMAN (Potassium voltage-gated channel subfamily KQT member 1 OS=Homo sapiens OX=9606 GN=KCNQ1 PE=1 SV=3)

HSP 1 Score: 467.618 bits (1202), Expect = 7.465e-151
Identity = 241/323 (74.61%), Postives = 269/323 (83.28%), Query Frame = 2

HSP 2 Score: 142.895 bits (359), Expect = 9.359e-34
Identity = 73/138 (52.90%), Postives = 100/138 (72.46%), Query Frame = 2
            RT S  ED + E ++  T +    +L E H+  I+VIRRMQ+F+A+++FQQARKPYDVRDVIEQYSQGHLN+MVRIKELQRR+DQSIGKP  F+   +  +DR   T+ +RLNR+E +  ++D +L  I  +L ++ S
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: X1YV70 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 344/570 (60.35%), Postives = 404/570 (70.88%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A2S1WM53 (Putative potassium voltage-gated channel subfamily KQT 2 OS=Hirudo verbana OX=311461 PE=2 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 331/575 (57.57%), Postives = 398/575 (69.22%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A433SVX0 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_018780 PE=3 SV=1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 337/573 (58.81%), Postives = 388/573 (67.71%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A210QEF2 (Potassium voltage-gated channel subfamily KQT member 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07127 PE=3 SV=1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 318/567 (56.08%), Postives = 389/567 (68.61%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A2T7P771 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11871 PE=3 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 317/557 (56.91%), Postives = 376/557 (67.50%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 321/617 (52.03%), Postives = 413/617 (66.94%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 321/617 (52.03%), Postives = 413/617 (66.94%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 322/616 (52.27%), Postives = 413/616 (67.05%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 319/587 (54.34%), Postives = 384/587 (65.42%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 442.195 bits (1136), Expect = 1.275e-141
Identity = 228/303 (75.25%), Postives = 253/303 (83.50%), Query Frame = 2

HSP 2 Score: 136.732 bits (343), Expect = 1.231e-32
Identity = 66/106 (62.26%), Postives = 84/106 (79.25%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 502.671 bits (1293), Expect = 2.271e-169
Identity = 282/501 (56.29%), Postives = 328/501 (65.47%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001128.1 (pep scaffold:Pmarinus_7.0:GL481044:147302:155278:-1 gene:ENSPMAG00000001003.1 transcript:ENSPMAT00000001128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.886 bits (738), Expect = 1.773e-90
Identity = 138/248 (55.65%), Postives = 182/248 (73.39%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009923.1 (pep scaffold:Pmarinus_7.0:GL476399:1077789:1091635:1 gene:ENSPMAG00000008976.1 transcript:ENSPMAT00000009923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.965 bits (611), Expect = 1.672e-73
Identity = 112/209 (53.59%), Postives = 154/209 (73.68%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009926.1 (pep scaffold:Pmarinus_7.0:GL476399:1078231:1091635:1 gene:ENSPMAG00000008976.1 transcript:ENSPMAT00000009926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.794 bits (582), Expect = 2.111e-69
Identity = 110/203 (54.19%), Postives = 147/203 (72.41%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: kcnq4 (potassium voltage-gated channel, KQT-like subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-120215-132])

HSP 1 Score: 125.946 bits (315), Expect = 3.772e-34
Identity = 62/113 (54.87%), Postives = 85/113 (75.22%), Query Frame = 2
            TI  Y++ A   +    ++++  FG EY  R+W+AGC  +Y G+RGR RFARKP  +ID++VL+AS  V+  G++G VFATSA+R +RFLQILRM+ +DR+GGTWRLLGSVVY
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: EDO42799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A4])

HSP 1 Score: 262.307 bits (669), Expect = 3.684e-80
Identity = 141/279 (50.54%), Postives = 192/279 (68.82%), Query Frame = 2
            Q   YNFLE P G    +YH A+ +LV++ LIL+ LST++ Y  +    +F +EIVLV  F  EYG+RLWSAGCRS Y+G RGR+ FA+K  +++D++V+ +S   L   + G   ++  +R VRFL +LR+L  DRQG TW+LL SV+YIHR+EL+TTLY+GF+ LIF+S+ +Y+ E   N                F S+ ++ WWG++T+TTIGYGD  P TW G++ AS F+V  ISFFALPAGILGSGFALKV Q+QRQKHF+R+   AA L+Q
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAKR7 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU2])

HSP 1 Score: 92.8189 bits (229), Expect = 9.175e-20
Identity = 62/217 (28.57%), Postives = 99/217 (45.62%), Query Frame = 2
            +I +   +A N    +E+   I+F  E   RL SA           +I+F ++P++++D++ +L   +VL    K +  + S +R  R L++LR+  + R     R+L     +   EL   +    + ++ SS   Y AE                    F+S   A WW + TVTT+GYGD  P T  GKI+ S  SVF +   ALP  +  S F
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAKR12 (Potassium channel; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI05])

HSP 1 Score: 89.7373 bits (221), Expect = 1.036e-18
Identity = 53/206 (25.73%), Postives = 97/206 (47.09%), Query Frame = 2
            F ++  ++ +F  EY  RL SA           +++F    +++IDL+ ++   + LG    +      + +R  R L+++R+L + R     R+LG  +   + +L   +++  + +I  S  +Y  EN+ N                F S   A WW +IT+TT+GYGD  P+T  G+++ +C +VF  I    LP  +    F
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 87.0409 bits (214), Expect = 4.500e-18
Identity = 59/226 (26.11%), Postives = 110/226 (48.67%), Query Frame = 2
            T DH   V  ++ +  +EI+ + +F  EY +RL S+           ++ F R  +++IDL+ +L   + L      ++ + + +R +R +++ R+  + R     ++LG  +    +EL   ++   + ++  S  VY AE             E+   S F S  DA WW V+T+TT+GYGD  P T  GK++ S  ++  +   ALP  ++ S F    +++Q
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAKR9 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI03])

HSP 1 Score: 86.6557 bits (213), Expect = 5.626e-18
Identity = 55/217 (25.35%), Postives = 99/217 (45.62%), Query Frame = 2
            +DHY     +  F +E   V +F  E+ +R+W++ C            F +    ++D+  ++   + L    S   V + + IR +R  +++R+  + R     +LL   +Y   ++L + L+   + +I  S  +Y  ++K N                  S   A WW VIT+T++GYGD VP T  GK++ S  ++  +  F LP  +L S F
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000035260.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 308/568 (54.23%), Postives = 379/568 (66.73%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000044551.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 463.766 bits (1192), Expect = 3.148e-150
Identity = 227/303 (74.92%), Postives = 254/303 (83.83%), Query Frame = 2

HSP 2 Score: 129.413 bits (324), Expect = 2.523e-30
Identity = 62/132 (46.97%), Postives = 90/132 (68.18%), Query Frame = 2
            R  +++ + D    D     +    +L+   + A++V+RRMQ+F+A R+FQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRR+D ++GKP +       D+   T+ +++ RLE +  +MD K+D +L +L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000003018.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 456.447 bits (1173), Expect = 1.407e-147
Identity = 227/302 (75.17%), Postives = 254/302 (84.11%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq1.1 (potassium voltage-gated channel subfamily KQT member 1 [Source:NCBI gene;Acc:101161541])

HSP 1 Score: 448.358 bits (1152), Expect = 1.774e-144
Identity = 221/287 (77.00%), Postives = 248/287 (86.41%), Query Frame = 2

HSP 2 Score: 136.346 bits (342), Expect = 1.418e-32
Identity = 81/184 (44.02%), Postives = 110/184 (59.78%), Query Frame = 2
            K+   A P    +   P F   R LS    S +G V+         ++ P RR  + +   + E E D+E +       LTE H+ AIRV++RM++F+A+R+FQQARKPYDVRDVIEQYSQGH+N+MVRIKELQRR+DQS+GK   F       RD+   ++ SRLNR+E +   MD  L  I+
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq1.1 (potassium voltage-gated channel subfamily KQT member 1 [Source:NCBI gene;Acc:101161541])

HSP 1 Score: 447.588 bits (1150), Expect = 5.784e-144
Identity = 221/287 (77.00%), Postives = 248/287 (86.41%), Query Frame = 2

HSP 2 Score: 133.265 bits (334), Expect = 1.434e-31
Identity = 70/133 (52.63%), Postives = 92/133 (69.17%), Query Frame = 2
            +R  S  +D E   E D+E +       LTE H+ AIRV++RM++F+A+R+FQQARKPYDVRDVIEQYSQGH+N+MVRIKELQRR+DQS+GK   F       RD+   ++ SRLNR+E +   MD  L  I+
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000022978.1 (SMESG000022978.1)

HSP 1 Score: 1746.1 bits (4521), Expect = 0.000e+0
Identity = 916/918 (99.78%), Postives = 916/918 (99.78%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000040474.1 (SMESG000040474.1)

HSP 1 Score: 466.077 bits (1198), Expect = 1.510e-153
Identity = 231/301 (76.74%), Postives = 259/301 (86.05%), Query Frame = 2

HSP 2 Score: 129.413 bits (324), Expect = 5.187e-31
Identity = 67/138 (48.55%), Postives = 94/138 (68.12%), Query Frame = 2
            S+   RP  RK    H   T+E +      R+P+ L    K+AIRV+RRM++++A R+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRR+DQ++GKP   + ++  DR R+T+  RL  +E +   ++SK+   L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000028167.1 (SMESG000028167.1)

HSP 1 Score: 457.988 bits (1177), Expect = 2.009e-151
Identity = 245/384 (63.80%), Postives = 287/384 (74.74%), Query Frame = 2
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000040474.1 (SMESG000040474.1)

HSP 1 Score: 416.772 bits (1070), Expect = 6.041e-135
Identity = 196/249 (78.71%), Postives = 217/249 (87.15%), Query Frame = 2

HSP 2 Score: 129.798 bits (325), Expect = 2.908e-31
Identity = 67/138 (48.55%), Postives = 94/138 (68.12%), Query Frame = 2
            S+   RP  RK    H   T+E +      R+P+ L    K+AIRV+RRM++++A R+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRR+DQ++GKP   + ++  DR R+T+  RL  +E +   ++SK+   L
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000046611.1 (SMESG000046611.1)

HSP 1 Score: 403.675 bits (1036), Expect = 4.391e-125
Identity = 257/607 (42.34%), Postives = 363/607 (59.80%), Query Frame = 2
            KS   K R SR      R  L    LN   + N+ + R  Q  IYNFLE P  +   +YH  +F  V +CL+LSVLSTI  Y  +A   L + E+V++ +F  EY +R+WSAGCRS+Y  +RGRI+FA++P  ++D+VV+LAS VVL  GS  Q  A SA RG+RF QILRM+ +DR+GG+W+LL SVV+ HRQEL TT+YIGFLGLIFSS+ +YL E   N+  N              +YADALWWGVIT+ T+GYGD VP+TW+GKIIA+  +V  ISFFALPAGILGSGFALKVQQ QRQKH  R+   AATLIQCLWRCYA  P+S   +TWKI+              ++  +  R + F    R +S KR  RR   SI    PS         SS       +TS  N        ++   S +   E    N I     ++  FR+L+ +  S +    +S  A R R     ++ ++++  +D     ++   +LTE  K  IR +R+++FF+A ++F++A +PYDV+DV+EQYS GH++M+ RIK LQ R+D  +G+   +  Q+    T++++ +R+ ++E Q   +++KLD ++
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNQ11.554e-15174.61potassium voltage-gated channel subfamily Q member... [more]
KCNQ12.905e-13878.03potassium voltage-gated channel subfamily Q member... [more]
KCNQ41.211e-12541.64potassium voltage-gated channel subfamily Q member... [more]
KCNQ55.566e-12541.31potassium voltage-gated channel subfamily Q member... [more]
KCNQ57.444e-12541.48potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kqt-34.801e-13971.00Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-34.801e-13971.00Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-31.454e-13871.00Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-31.454e-13871.00Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-31.556e-13871.00Potassium channel, KvQLT family [Source:UniProtKB... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNQ1.924e-11160.00gene:FBgn0033494 transcript:FBtr0299832[more]
KCNQ4.619e-11160.00gene:FBgn0033494 transcript:FBtr0299833[more]
KCNQ1.074e-11060.00gene:FBgn0033494 transcript:FBtr0310097[more]
KCNQ1.394e-11060.00gene:FBgn0033494 transcript:FBtr0310093[more]
KCNQ1.400e-11060.00gene:FBgn0033494 transcript:FBtr0310094[more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.17.895e-15472.92potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.18.886e-15472.92potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.15.140e-15273.15potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.23.784e-14074.92potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq2b1.563e-10156.48potassium voltage-gated channel, KQT-like subfamil... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046823.18.323e-15677.27potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046791.12.021e-15577.27potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046831.18.280e-15576.62potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046772.11.126e-15477.27potassium voltage-gated channel subfamily KQT memb... [more]
kri11.602e-15167.96KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517][more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnq15.120e-15273.77potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq11.918e-15173.77potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq53.721e-12442.86potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq56.452e-12442.49potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq24.883e-12341.70potassium voltage-gated channel, subfamily Q, memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70344|KCNQ1_CAVPO7.470e-15274.38Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P70057|KCNQ1_XENLA2.431e-15170.06Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P97414|KCNQ1_MOUSE3.581e-15173.77Potassium voltage-gated channel subfamily KQT memb... [more]
sp|O97531|KCNQ1_FELCA4.789e-15177.93Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P51787|KCNQ1_HUMAN7.465e-15174.61Potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X1YV700.000e+060.35Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2S1WM530.000e+057.57Putative potassium voltage-gated channel subfamily... [more]
A0A433SVX00.000e+058.81Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A210QEF20.000e+056.08Potassium voltage-gated channel subfamily KQT memb... [more]
A0A2T7P7710.000e+056.91Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.10.000e+052.03potassium voltage-gated channel subfamily Q member... [more]
kcnq1.10.000e+052.03potassium voltage-gated channel subfamily Q member... [more]
kcnq1.10.000e+052.27potassium voltage-gated channel subfamily Q member... [more]
kcnq1.20.000e+054.34potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.21.275e-14175.25potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.12.271e-16956.29potassium voltage-gated channel, KQT-like subfamil... [more]
ENSPMAT00000001128.11.773e-9055.65pep scaffold:Pmarinus_7.0:GL481044:147302:155278:-... [more]
ENSPMAT00000009923.11.672e-7353.59pep scaffold:Pmarinus_7.0:GL476399:1077789:1091635... [more]
ENSPMAT00000009926.12.111e-6954.19pep scaffold:Pmarinus_7.0:GL476399:1078231:1091635... [more]
kcnq43.772e-3454.87potassium voltage-gated channel, KQT-like subfamil... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427993.684e-8050.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR79.175e-2028.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR121.036e-1825.73Potassium channel; Predicted protein [Source:UniP... [more]
SHAK34.500e-1826.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR95.626e-1825.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035260.10.000e+054.23potassium voltage-gated channel subfamily KQT memb... [more]
ENSORLT00000044551.13.148e-15074.92potassium voltage-gated channel subfamily KQT memb... [more]
ENSORLT00000003018.21.407e-14775.17potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.11.774e-14477.00potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.15.784e-14477.00potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30033794 ID=SMED30033794|Name=Potassium voltage-gated channel subfamily KQT member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3099bp
back to top

protein sequence of SMED30033794-orf-1

>SMED30033794-orf-1 ID=SMED30033794-orf-1|Name=SMED30033794-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=919bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
GO:0005244voltage-gated ion channel activity
GO:0005251delayed rectifier potassium channel activity
GO:0005516calmodulin binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0008157protein phosphatase 1 binding
GO:0015271outward rectifier potassium channel activity
GO:0034236protein kinase A catalytic subunit binding
GO:0034237protein kinase A regulatory subunit binding
GO:0044325ion channel binding
GO:0086008voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization
GO:0086089voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization
GO:0097110scaffold protein binding
GO:1902282voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
GO:0005769early endosome
GO:0005770late endosome
GO:0005783endoplasmic reticulum
GO:0005886plasma membrane
GO:0016323basolateral plasma membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0034702ion channel complex
GO:0045121membrane raft
GO:0008076voltage-gated potassium channel complex
GO:0016021integral component of membrane
Vocabulary: biological process
GO:0006349regulation of gene expression by genetic imprinting
GO:0010460positive regulation of heart rate
GO:0016458gene silencing
GO:0034765regulation of ion transmembrane transport
GO:0035690cellular response to drug
GO:0048839inner ear development
GO:0050892intestinal absorption
GO:0060048cardiac muscle contraction
GO:0060306regulation of membrane repolarization
GO:0060307regulation of ventricular cardiac muscle cell membrane repolarization
GO:0060372regulation of atrial cardiac muscle cell membrane repolarization
GO:0060452positive regulation of cardiac muscle contraction
GO:0060453regulation of gastric acid secretion
GO:0070293renal absorption
GO:0071320cellular response to cAMP
GO:0072358cardiovascular system development
GO:0086005ventricular cardiac muscle cell action potential
GO:0086009membrane repolarization
GO:0086011membrane repolarization during action potential
GO:0086013membrane repolarization during cardiac muscle cell action potential
GO:0086014atrial cardiac muscle cell action potential
GO:0086091regulation of heart rate by cardiac conduction
GO:0097623potassium ion export across plasma membrane
GO:0098914membrane repolarization during atrial cardiac muscle cell action potential
GO:0098915membrane repolarization during ventricular cardiac muscle cell action potential
GO:1901381positive regulation of potassium ion transmembrane transport
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
Vocabulary: INTERPRO
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003937Potassium channel, voltage dependent, KCNQPRINTSPR01459KCNQCHANNELcoord: 146..165
score: 57.26
coord: 228..247
score: 71.94
coord: 166..185
score: 62.1
IPR005827Potassium channel, voltage dependent, KCNQ1PRINTSPR01460KCNQ1CHANNELcoord: 635..655
score: 25.17
coord: 549..566
score: 58.73
coord: 615..634
score: 35.0
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 285..307
score: 53.34
coord: 138..161
score: 25.99
coord: 314..340
score: 30.7
NoneNo IPR availableGENE3DG3DSA: 103..343
e-value: 2.4E-53
score: 182.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 431..482
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 424..483
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 755..771
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 746..771
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 97..341
NoneNo IPR availableTMHMMTMhelixcoord: 178..197
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 103..125
NoneNo IPR availableTMHMMTMhelixcoord: 243..262
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 105..343
e-value: 9.7E-25
score: 87.2
IPR013821Potassium channel, voltage dependent, KCNQ, C-terminalPFAMPF03520KCNQ_channelcoord: 526..650
e-value: 2.2E-25
score: 89.6
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 82..707