Cell division cycle and apoptosis regulator protein 1

Overview
NameCell division cycle and apoptosis regulator protein 1
Smed IDSMED30033785
Length (bp)1412
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell division cycle and apoptosis regulator protein 1 (SMED30033785) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell division cycle and apoptosis regulator protein 1 (SMED30033785) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell division cycle and apoptosis regulator protein 1 (SMED30033785) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell division cycle and apoptosis regulator protein 1 (SMED30033785) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033785

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033785 SmedASXL_006503SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033785 SmedASXL_006503SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033785 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033785 Contig37289newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033785 Contig37289uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30033785 dd_Smed_v6_1181_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 93.9745 bits (232), Expect = 9.838e-20
Identity = 42/78 (53.85%), Postives = 57/78 (73.08%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSD 604
            Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP   D
Sbjct:  695 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLPEKED 772          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 94.3597 bits (233), Expect = 1.067e-19
Identity = 41/74 (55.41%), Postives = 56/74 (75.68%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  706 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 779          

HSP 2 Score: 55.4546 bits (132), Expect = 1.738e-7
Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  701 EKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            + + ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  902 QMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 970          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 93.9745 bits (232), Expect = 1.092e-19
Identity = 41/74 (55.41%), Postives = 56/74 (75.68%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  721 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 794          

HSP 2 Score: 55.4546 bits (132), Expect = 1.713e-7
Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  701 EKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            + + ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  917 QMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 985          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 93.9745 bits (232), Expect = 1.177e-19
Identity = 41/74 (55.41%), Postives = 56/74 (75.68%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  706 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 779          

HSP 2 Score: 55.4546 bits (132), Expect = 1.923e-7
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  713 LDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  906 INRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 970          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 93.2041 bits (230), Expect = 1.448e-19
Identity = 41/74 (55.41%), Postives = 56/74 (75.68%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  526 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 599          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 101.293 bits (251), Expect = 1.267e-22
Identity = 83/225 (36.89%), Postives = 111/225 (49.33%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDGEPDAKRKREDLIGD--VKPT-------TIESTAAK--------------------------EKVPLDS-----DTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVENDTICN 925
            Y++     I V  +K+ K+GKFDC+++SLSSLL+YR DD KEN FEVS+FAE F EMI R+AAF IY+T   L N        G+ DA++KR D   +  V+P        T E  A                            E++ L S          F +FD +   Y+ E D+EEIL+     +SR Q +KL  K S  R  ++YR L TDV  D   N
Sbjct:  148 YQLPKDKKILVFPSKSFKSGKFDCKVLSLSSLLDYRHDDNKENQFEVSLFAEAFKEMIERNAAFTIYET---LANC-------GDRDAEKKRRDEAREKPVEPKEPKEPAETTEKAAEGEEKKDEKEEKRDEKKDEKREEKREKVERIDLKSVVANRTVYEAFSLFDSNLCGYLTEKDIEEILYNGEFGISRGQIQKLAKKLS-VRDKINYRHL-TDVLTDMDGN 360          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Match: ccar-1 (CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3])

HSP 1 Score: 99.3673 bits (246), Expect = 8.626e-22
Identity = 83/225 (36.89%), Postives = 111/225 (49.33%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDGEPDAKRKREDLIGD--VKPT-------TIESTAAK--------------------------EKVPLDSDTLLK-----FCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVENDTICN 925
            Y++     I V  +K+ K+GKFDC+++SLSSLL+YR DD KEN FEVS+FAE F EMI R+AAF IY+T   L N  D        DA++KR D   +  V+P        T E  A                            E++ L S    +     F +FD +   Y+ E D+EEIL+     +SR Q +KL  K S  R  ++YR L TDV  D   N
Sbjct:  772 YQLPKDKKILVFPSKSFKSGKFDCKVLSLSSLLDYRHDDNKENQFEVSLFAEAFKEMIERNAAFTIYET---LANCGDR-------DAEKKRRDEAREKPVEPKEPKEPAETTEKAAEGEEKKDEKEEKRDEKKDEKREEKREKVERIDLKSVVANRTVYEAFSLFDSNLCGYLTEKDIEEILYNGEFGISRGQIQKLAKKLS-VRDKINYRHL-TDVLTDMDGN 984          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 98.2117 bits (243), Expect = 3.672e-21
Identity = 52/114 (45.61%), Postives = 69/114 (60.53%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTS----------------DLEKL----DGEPDAKRKRED 652
            Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD  ++IYK   +LP                   D++K     +GEP AKR RE+
Sbjct:  762 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGYRIYKALASLPTKDEKKDKKERAKKEAERRDIKKERDEDNGEPVAKRIREE 875          

HSP 2 Score: 60.4622 bits (145), Expect = 3.141e-9
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVENDTIC 922
            ++ V  + D L+ F  FD  H  Y+ E D+EEI++ +GL LSR+Q +KL++K   K    HYR+L TD   D  C
Sbjct:  960 RQMVTFNKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNKPLVKE-SCHYRKL-TDRPKDEPC 1032          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 96.2857 bits (238), Expect = 1.250e-20
Identity = 42/74 (56.76%), Postives = 55/74 (74.32%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD  ++IYK   +LP
Sbjct:  726 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGYRIYKALASLP 799          

HSP 2 Score: 60.4622 bits (145), Expect = 3.314e-9
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVENDTIC 922
            ++ V  + D L+ F  FD  H  Y+ E D+EEI++ +GL LSR+Q +KL++K   K    HYR+L TD   D  C
Sbjct:  924 RQMVTFNKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNKPLVKE-SCHYRKL-TDRPKDEPC 996          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 96.2857 bits (238), Expect = 1.318e-20
Identity = 42/74 (56.76%), Postives = 55/74 (74.32%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD  ++IYK   +LP
Sbjct:  723 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGYRIYKALASLP 796          

HSP 2 Score: 60.4622 bits (145), Expect = 3.312e-9
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVENDTIC 922
            ++ V  + D L+ F  FD  H  Y+ E D+EEI++ +GL LSR+Q +KL++K   K    HYR+L TD   D  C
Sbjct:  921 RQMVTFNKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNKPLVKE-SCHYRKL-TDRPKDEPC 993          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030629.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 97.0561 bits (240), Expect = 1.070e-20
Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R E+ Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IY+  ++LP
Sbjct:  674 QRREKRYVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 753          

HSP 2 Score: 55.0694 bits (131), Expect = 2.332e-7
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS 895
            K+ V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL +K   K   + YR+L+
Sbjct:  878 KQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLT 942          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030635.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 97.0561 bits (240), Expect = 1.085e-20
Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R E+ Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IY+  ++LP
Sbjct:  694 QRREKRYVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 773          

HSP 2 Score: 55.0694 bits (131), Expect = 2.359e-7
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS 895
            K+ V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL +K   K   + YR+L+
Sbjct:  892 KQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLT 956          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000015244.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 97.0561 bits (240), Expect = 1.136e-20
Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R E+ Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IY+  ++LP
Sbjct:  689 QRREKRYVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 768          

HSP 2 Score: 55.0694 bits (131), Expect = 2.422e-7
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS 895
            K+ V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL +K   K   + YR+L+
Sbjct:  893 KQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLT 957          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030665.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 97.0561 bits (240), Expect = 1.154e-20
Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R E+ Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IY+  ++LP
Sbjct:  720 QRREKRYVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 799          

HSP 2 Score: 55.0694 bits (131), Expect = 2.268e-7
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS 895
            K+ V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL +K   K   + YR+L+
Sbjct:  918 KQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLT 982          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000030679.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 97.0561 bits (240), Expect = 1.241e-20
Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R E+ Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IY+  ++LP
Sbjct:  720 QRREKRYVLPDEPAIIVHPNWAAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLSLP 799          

HSP 2 Score: 55.4546 bits (132), Expect = 1.950e-7
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS 895
            K+ V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL +K   K   + YR+L+
Sbjct:  889 KQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLT 953          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Match: Ccar1 (cell division cycle and apoptosis regulator 1 [Source:MGI Symbol;Acc:MGI:1914750])

HSP 1 Score: 98.2117 bits (243), Expect = 3.409e-21
Identity = 44/80 (55.00%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R ER Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  712 QRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 791          

HSP 2 Score: 55.4546 bits (132), Expect = 1.155e-7
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  701 EKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            + V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  913 QMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 981          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Match: Ccar1 (cell division cycle and apoptosis regulator 1 [Source:MGI Symbol;Acc:MGI:1914750])

HSP 1 Score: 98.2117 bits (243), Expect = 3.409e-21
Identity = 44/80 (55.00%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R ER Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  712 QRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 791          

HSP 2 Score: 55.4546 bits (132), Expect = 1.155e-7
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  701 EKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            + V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  913 QMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 981          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q641G3|CCAR1_XENLA (Cell division cycle and apoptosis regulator protein 1 OS=Xenopus laevis OX=8355 GN=ccar1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 8.372e-21
Identity = 44/80 (55.00%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R E+ Y + D P+I VH N + KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IY+  +ALP
Sbjct:  722 QRREKRYMLPDEPAIIVHPNWSAKNGKFDCSIMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGVRIYRELLALP 801          

HSP 2 Score: 55.4546 bits (132), Expect = 8.674e-7
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  698 KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDV-------ENDTICNDM 931
            K+ V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL +K   K   + YR+L+          E D + ND+
Sbjct:  926 KQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLFTKILLKE-SLLYRKLTDTATEDGSHEETDPLHNDI 1009          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q8CH18|CCAR1_MOUSE (Cell division cycle and apoptosis regulator protein 1 OS=Mus musculus OX=10090 GN=Ccar1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.385e-20
Identity = 44/80 (55.00%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  353 KRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            +R ER Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  712 QRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 791          

HSP 2 Score: 55.4546 bits (132), Expect = 8.078e-7
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  701 EKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            + V ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  913 QMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 981          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Match: sp|Q8IX12|CCAR1_HUMAN (Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 5.243e-19
Identity = 41/74 (55.41%), Postives = 56/74 (75.68%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            Y + D P+I VH N   K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD   +IYK+ ++LP
Sbjct:  721 YILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLP 794          

HSP 2 Score: 55.4546 bits (132), Expect = 8.225e-7
Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  701 EKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVEND 913
            + + ++ D L+ F  FD  H  Y+ E D+EEIL+ +GL LSR+Q +KL++K    R    YR+L TD   D
Sbjct:  917 QMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVV-LRESCFYRKL-TDTSKD 985          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A0F7GWU0 (Cell division cycle and apoptosis regulator protein 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 5.236e-53
Identity = 124/331 (37.46%), Postives = 191/331 (57.70%), Query Frame = 2
Query:  350 KKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPN-TSDLEKLDGEPDAKRKREDLIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS-----TDVEND---------TICNDMDLSKGNKSKLVVSNTESTVYLDNKTNTXXXXXXXXXXXXXXXASFNESKLELENIRSHYHTAKDMENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKIDRQFEKD 1297
            +KR E+LYK+ND+PSI V  NKT K GKF+C +++L +L+EYR DDQKE+ FEVS+F EQFNEM+ RDAAF I+K+   +P+ T+D      EP +K+ +            E    K K+  D   L  FC+FD D+  Y+++HD+E+I+H IGL+ SRSQ RKLISK  NKRG + YRE++        E+D          I   ++LSKGNK+     +T+  +  +     M K+   E+K  +  +     K EL  I+S  + A  +E  L+  +  ++ KL  E+++  + + +  +YN +L+ + D +  +   I+ QFEK+
Sbjct:  162 RKRIEKLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTAD----SVEPSSKKPK---------LETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKE 479          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: Q5DC42 (SJCHGC09302 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.426e-51
Identity = 130/360 (36.11%), Postives = 200/360 (55.56%), Query Frame = 2
Query:  329 KELSDKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDG---------EPDAKRKREDLIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS----------------TDVENDTICNDMDLSKGNKS--KLVVSNTESTVYLD--NKTNTXXXXXXXXXXXXXXXASFNESKLELENIRSHYHTAKDMENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKIDRQFEKDSEKDKQSK 1321
            K+LS+KD++R ERLY++ D P+I +H NK+ K G+FDC  VSL SLL+YR++DQKE+ FEVS+FAEQF+EM+ RDAAF I+K     P      + DG         EP++KR+R D          +    + +  ++   L  F  FD+  A YI+EHD+ EILH +GL  SR+Q RKL+++ + +R  V Y  L+                  VE D     M L+ GN++   + V  T + + +   N    + ++++ E+    +   F + K ELE  R   ++ KD E+ LRAE +DL S+L  E+K + E     + YN LLR++RD +++    I++QF+K   K +  K
Sbjct:   35 KDLSEKDRRRLERLYRLGDKPAIVIHPNKSAKGGRFDCHRVSLFSLLDYRTEDQKEHNFEVSLFAEQFHEMLQRDAAFTIFKAIHDAPEKEIKPEQDGKLENGFDSDEPESKRRRNDSQNGYNDEQDDVKIRRLRRTVNPALLFAFTYFDISRAGYIREHDLCEILHLLGLRYSRTQMRKLVARVATRRDHVSYHNLTDSDIVEGDDKDVVSMNVAVEEDVEVTRM-LALGNRALFDMTVPQTPARIVIGGGNTEQMLKRVELAEAVKHKMEFQFFQIKDELEKTRVKVNSFKDTEDELRAENRDLASRLKSEQKQLHEYKSQANTYNHLLRLARDQMDKVLFDINKQFDKGKGKARSRK 393          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A4S2LF92 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009289 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.937e-49
Identity = 132/359 (36.77%), Postives = 201/359 (55.99%), Query Frame = 2
Query:  317 KIEIKELSDKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDG------------EPDAKRKREDLIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS-TDV----ENDTI------CNDMDLSK----GNKSKLVVSNTESTVYL-----DNKTNTXXXXXXXXXXXXXXXASFNESKLELENIRSHYHTAKDMENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKIDRQFEKD 1297
            K E K+LS+K+++R ERLY++ND P+I +H NK+ + G+FDC  VSL SLL+YR+++QKE  FEVS+FAEQF+EM+ RD AF I+K     P      + DG            EPD KR+R +  G ++    E    + +     D L  F  +D+ H+ YI+EHD+ EILH +GL  S++Q R+L++K   +R  V Y +L+ +D+    +ND +        D+++ K    GN++   V   +    +     D++  T    K  E +       F   K ELE  R+  ++ KD E+ LRAE +DL S+L  E+K + E   L   Y+ LLR +RD L+R    I++QFEK+
Sbjct:  474 KDESKDLSEKERRRLERLYRLNDKPAIIIHPNKSARGGRFDCHRVSLFSLLDYRTEEQKEQNFEVSLFAEQFHEMLQRDCAFTIFKAINDAPEKEHKSEQDGKLENGIEDEEEKEPDVKRRRNEGPGSIEHEGDEPKVRRLRRTTQPDLLFAFSYYDLGHSGYIREHDLAEILHLLGLRYSKAQMRRLVTKVVTRRDHVQYHQLTDSDITEGDDNDVVTIKAVEAEDIEVVKMLALGNRALFDVEQPQVPAKIILGGGDSRAITQRLEKAEELRRAMEY-QFFRIKDELEKTRTQLNSFKDTEDELRAENRDLNSRLKTEQKQLHEHRSLSGTYHHLLRNARDQLDRVLFDINKQFEKE 831          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A4S2LEH2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009289 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 5.669e-49
Identity = 132/359 (36.77%), Postives = 201/359 (55.99%), Query Frame = 2
Query:  317 KIEIKELSDKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDG------------EPDAKRKREDLIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS-TDV----ENDTI------CNDMDLSK----GNKSKLVVSNTESTVYL-----DNKTNTXXXXXXXXXXXXXXXASFNESKLELENIRSHYHTAKDMENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKIDRQFEKD 1297
            K E K+LS+K+++R ERLY++ND P+I +H NK+ + G+FDC  VSL SLL+YR+++QKE  FEVS+FAEQF+EM+ RD AF I+K     P      + DG            EPD KR+R +  G ++    E    + +     D L  F  +D+ H+ YI+EHD+ EILH +GL  S++Q R+L++K   +R  V Y +L+ +D+    +ND +        D+++ K    GN++   V   +    +     D++  T    K  E +       F   K ELE  R+  ++ KD E+ LRAE +DL S+L  E+K + E   L   Y+ LLR +RD L+R    I++QFEK+
Sbjct:  474 KDESKDLSEKERRRLERLYRLNDKPAIIIHPNKSARGGRFDCHRVSLFSLLDYRTEEQKEQNFEVSLFAEQFHEMLQRDCAFTIFKAINDAPEKEHKSEQDGKLENGIEDEEEKEPDVKRRRNEGPGSIEHEGDEPKVRRLRRTTQPDLLFAFSYYDLGHSGYIREHDLAEILHLLGLRYSKAQMRRLVTKVVTRRDHVQYHQLTDSDITEGDDNDVVTIKAVEAEDIEVVKMLALGNRALFDVEQPQVPAKIILGGGDSRAITQRLEKAEELRRAMEY-QFFRIKDELEKTRTQLNSFKDTEDELRAENRDLNSRLKTEQKQLHEHRSLSGTYHHLLRNARDQLDRVLFDINKQFEKE 831          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Match: A0A5J4NFP5 (SAP domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0003015 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 6.312e-49
Identity = 136/364 (37.36%), Postives = 204/364 (56.04%), Query Frame = 2
Query:  317 KIEIKELSDKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDG------------EPDAKRKRED--LIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS-TDV---------------ENDTICNDMDLSKGNKSKLVVSNTESTVYL----DNKTNTXXXXXXXXXXXXXXXASFNESKLELENIRSHYHTAKDMENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKIDRQFEKDSEK 1306
            K E KELS+K+++R ERLY++N+ PSI VH NK  + G+FDC  VSL SLL+YR++DQKE+ FEVS+FAEQF+EM+ RD AF I+K     P      + DG            EPD KR+R D  LI D    + E    + +  +  D L  F  +D+ HA YI+EHD+ EILH +GL  SR+Q R+L++K   +R  V Y++L+ +D+               E DT    M L+ GN++   +        +     N +    +I+  E + + +   F + K ELE  R+  ++ KD E+ LRA+  DL ++L  E+K + E   + + Y+ LLR +RD ++R    I++QFEK+  K
Sbjct:  493 KDESKELSEKERRRLERLYRLNEKPSIIVHPNKNARGGRFDCHRVSLFSLLDYRTEDQKEHNFEVSLFAEQFHEMLQRDCAFAIFKAINDAPEKEHKSEQDGKVENGLNEDDDQEPDIKRRRNDGQLIAD---ESDEPKVRRLRRTVRPDLLFAFTYYDLGHAGYIREHDLCEILHLLGLRYSRAQMRRLVAKVVTRRDHVQYQQLTDSDIAEGDVKDVVTIKKNDEEDTEVVKM-LALGNRALFDIEQPPIPAKIVIGGGNTSEMTHRIERAEDQKRKMEFQFFQIKDELEKTRTQLNSFKDTEDELRAQNHDLSTRLKTEQKQLHEYKSVSNTYHHLLRSARDQMDRVLFDINKQFEKEKAK 852          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Cavefish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 130.568 bits (327), Expect = 6.230e-32
Identity = 81/239 (33.89%), Postives = 115/239 (48.12%), Query Frame = 2
Query:  371 YKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPN-------------------------TSDLEKLDGEPDAKRKREDL----------------------------IGDVKPTTIESTAA-----------KEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS 895
            Y + D P+I VH N   KNGKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD  F+IYK   +LP+                           D E+ +GEP  K++RED                               +  P  +E               K+ V  D D L+ F  FD  H  Y+ E D+EEI++ +GL LSR+Q +KL+++    R   +YR+L+
Sbjct:  709 YVLPDEPTIIVHPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGFRIYKALASLPSKDERKEKKEKAKKEAERKEVERRDAKKDREEDNGEPSTKKQREDEDKRRKERVLKKEESKDEDDNEDESSNNNADEYDPMEVEDADDYDDDDGTDEKKKQMVTFDKDLLMAFVYFDQSHCGYLLEKDLEEIMYTLGLHLSRAQVKKLLNRPV-VRESCYYRKLT 946          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Sea Lamprey
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 102.449 bits (254), Expect = 2.073e-23
Identity = 46/84 (54.76%), Postives = 63/84 (75.00%), Query Frame = 2
Query:  341 DKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            + ++ R ER Y + + PSI VH N+T K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD  F+IY+  MA P
Sbjct:  709 ESERLRKERRYTLPEMPSIIVHPNRTAKSGKFDCSVMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGFRIYRALMAAP 792          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Sea Lamprey
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 102.449 bits (254), Expect = 2.184e-23
Identity = 46/84 (54.76%), Postives = 63/84 (75.00%), Query Frame = 2
Query:  341 DKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALP 592
            + ++ R ER Y + + PSI VH N+T K+GKFDC ++SLS LL+YR +D KE++FEVS+FAE FNEM+ RD  F+IY+  MA P
Sbjct:  721 ESERLRKERRYTLPEMPSIIVHPNRTAKSGKFDCSVMSLSVLLDYRIEDNKEHSFEVSLFAELFNEMLQRDFGFRIYRALMAAP 804          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Planmine SMEST
Match: SMESG000052430.1 (SMESG000052430.1)

HSP 1 Score: 193.741 bits (491), Expect = 8.376e-54
Identity = 124/331 (37.46%), Postives = 191/331 (57.70%), Query Frame = 2
Query:  350 KKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPN-TSDLEKLDGEPDAKRKREDLIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELS-----TDVEND---------TICNDMDLSKGNKSKLVVSNTESTVYLDNKTNTXXXXXXXXXXXXXXXASFNESKLELENIRSHYHTAKDMENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKIDRQFEKD 1297
            +KR E+LYK+ND+PSI V  NKT K GKF+C +++L +L+EYR DDQKE+ FEVS+F EQFNEM+ RDAAF I+K+   +P+ T+D      EP +K+ +            E    K K+  D   L  FC+FD D+  Y+++HD+E+I+H IGL+ SRSQ RKLISK  NKRG + YRE++        E+D          I   ++LSKGNK+     +T+  +  +     M K+   E+K  +  +     K EL  I+S  + A  +E  L+  +  ++ KL  E+++  + + +  +YN +L+ + D +  +   I+ QFEK+
Sbjct:  471 RKRLEKLYKLNDTPSILVLPNKTAKGGKFECNILTLENLMEYRLDDQKEHIFEVSLFVEQFNEMLQRDAAFYIFKSLSEMPDSTAD----SVEPSSKKPK---------LETEKVIRKSKMIADMHLLFSFCVFDFDNCGYLRDHDLEDIIHCIGLNFSRSQVRKLISKIPNKRGNLQYREITDKEVIEGSEDDVAVLKERKCVIDKLVELSKGNKAFFEECDTQEMILREGNLELMDKLCAAENKKVDYESQLVFIKDELTKIKSIQNDAGVVEANLKESIHKVQEKLEAEKESHLKLSDVIKVYNSILKSATDNMGLSIKTINDQFEKE 788          
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Planmine SMEST
Match: SMESG000034433.1 (SMESG000034433.1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.646e-18
Identity = 71/220 (32.27%), Postives = 110/220 (50.00%), Query Frame = 2
Query:  335 LSDKDKKRFERLYKMNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAEQFNEMILRDAAFKIYKTFMALPNTSDLEKLDGEPDAKRKREDLIGDVKPTTIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSRSQARKLISKASNKRGGVHYRELSTDVENDTICNDMDLSKGNKSKLVVSNTESTVYL 994
            LS+ DKK  ++LY + D P I VH N   ++GK   + +SL SLL Y      E TFEV++FA QF EM+ RDA F +YK+ +  P +  + K   E  AK          KP  + +T+ +    ++   L    I D +  + I   D++ ++  +G+ LS  Q   LI+K       ++YR L TD E D    D ++SK     L++  T+   Y+
Sbjct:  680 LSEADKKELKQLYSLPDDPHIIVHHNNKHQDGKIRIKTMSLHSLLSYYDMKFDEATFEVALFARQFLEMLRRDAVFNVYKSLVITPESDFVSK--EENSAK----------KPKLMVTTSKRT---INRPLLFSCTILDKERTNKISLDDLKGLIEGLGICLSSDQLSALINKVKESSKCLNYR-LLTDKEID----DNNMSK----MLIIDQTDDLDYI 875          
The following BLAST results are available for this feature:
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCAR19.838e-2053.85cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR11.067e-1955.41cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR11.092e-1955.41cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR11.177e-1955.41cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR11.448e-1955.41cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccar-11.267e-2236.89CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
ccar-18.626e-2236.89CCAR1 homolog [Source:UniProtKB/TrEMBL;Acc:H2KMJ3... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccar13.672e-2145.61cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar11.250e-2056.76cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar11.318e-2056.76cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000030629.11.070e-2053.75cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030635.11.085e-2053.75cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000015244.11.136e-2053.75cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030665.11.154e-2053.75cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030679.11.241e-2053.75cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccar13.409e-2155.00cell division cycle and apoptosis regulator 1 [Sou... [more]
Ccar13.409e-2155.00cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q641G3|CCAR1_XENLA8.372e-2155.00Cell division cycle and apoptosis regulator protei... [more]
sp|Q8CH18|CCAR1_MOUSE2.385e-2055.00Cell division cycle and apoptosis regulator protei... [more]
sp|Q8IX12|CCAR1_HUMAN5.243e-1955.41Cell division cycle and apoptosis regulator protei... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWU05.236e-5337.46Cell division cycle and apoptosis regulator protei... [more]
Q5DC426.426e-5136.11SJCHGC09302 protein OS=Schistosoma japonicum OX=61... [more]
A0A4S2LF923.937e-4936.77Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LEH25.669e-4936.77Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NFP56.312e-4937.36SAP domain-containing protein OS=Paragonimus weste... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccar16.230e-3233.89cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccar12.073e-2354.76cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar12.184e-2354.76cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle and apoptosis regulator protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000052430.18.376e-5437.46SMESG000052430.1[more]
SMESG000034433.13.646e-1832.27SMESG000034433.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033785 ID=SMED30033785|Name=Cell division cycle and apoptosis regulator protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1412bp
ATTTTGGTTGCTTGTAAAATAAGTAATGTGTGTATTATGTTGACGTATGG
TTGCTTATTACACAATACGTGATTATAAATAGCAAAGTTTTGTTATTTAT
TTTAGGAAATGTGATTATTAAAACATCTATTTTCTAAAATTCGTCTGTTA
TATTATTTATGTATAGGAAGAAGAATCAGCAGCTATTGAAGAGGTGAAAG
AAGAAAAGTGTGAAAATCAAGAAGCAGATGAAACTAAAGAAGAATCAATT
GTAACTGTAACAGAAGAGAGTAAATCTGTAGAGAAACATGAAGTTGAGCA
TGCATGTGAGACAGAGAAAATTGAAATTAAAGAATTATCAGATAAAGATA
AAAAAAGATTCGAAAGATTGTATAAAATGAACGATTCTCCTTCGATTCCA
GTGCACATTAACAAAACAGTTAAAAATGGAAAATTTGATTGTCAATTAGT
ATCACTGAGCTCTTTGCTGGAATATCGAAGTGATGATCAAAAAGAAAATA
CTTTTGAAGTTTCTGTATTTGCTGAACAGTTCAATGAAATGATTCTACGG
GATGCGGCATTTAAAATTTATAAAACATTTATGGCATTACCAAATACTTC
AGATTTGGAAAAACTCGATGGCGAGCCTGATGCTAAACGCAAGAGAGAAG
ATTTGATTGGTGATGTGAAACCAACAACTATTGAATCAACAGCGGCTAAA
GAAAAAGTTCCCCTCGATTCGGACACATTGTTAAAGTTCTGTATATTCGA
TGTCGATCACGCCGATTATATCAAAGAGCATGATATGGAAGAGATTTTAC
ACGCAATTGGCTTAGATTTATCACGATCTCAAGCCAGAAAATTGATTTCC
AAGGCTTCAAATAAACGCGGCGGAGTTCATTATCGAGAATTGAGTACTGA
TGTTGAGAATGACACAATTTGCAATGACATGGACCTTAGCAAAGGAAACA
AATCGAAGTTGGTTGTAAGTAACACTGAATCTACTGTTTACCTAGACAAT
AAAACCAATACTATGTCGAAAATCAAAATGATCGAATCGAAAATAAAAAA
TATCATGGCAAGTTTTAATGAAAGCAAATTAGAATTAGAAAACATTCGTT
CCCATTATCACACTGCAAAGGATATGGAAAACATATTACGTGCCGAATTA
AAAGATTTGGAATCGAAATTGTATTTGGAGCGTAAAAATGTTCGCGAAGC
AAATCAGCTACAAGACATTTACAATGGATTATTAAGAATGTCTCGTGATG
TGTTGGAAAGAGCGAAATCAAAGATTGATCGACAATTTGAAAAGGATTCT
GAGAAAGATAAACAATCAAAAGTAGAAACTAAACATACTGAAAGTGTTGT
TGTTAATGGCAATGAATGAAATTTAGTTGTCGTTGTTTTAATAAATGTAT
TTAACATTTAAA
back to top

protein sequence of SMED30033785-orf-1

>SMED30033785-orf-1 ID=SMED30033785-orf-1|Name=SMED30033785-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MNDSPSIPVHINKTVKNGKFDCQLVSLSSLLEYRSDDQKENTFEVSVFAE
QFNEMILRDAAFKIYKTFMALPNTSDLEKLDGEPDAKRKREDLIGDVKPT
TIESTAAKEKVPLDSDTLLKFCIFDVDHADYIKEHDMEEILHAIGLDLSR
SQARKLISKASNKRGGVHYRELSTDVENDTICNDMDLSKGNKSKLVVSNT
ESTVYLDNKTNTMSKIKMIESKIKNIMASFNESKLELENIRSHYHTAKDM
ENILRAELKDLESKLYLERKNVREANQLQDIYNGLLRMSRDVLERAKSKI
DRQFEKDSEKDKQSKVETKHTESVVVNGNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0051301cell division