Catalase

Overview
NameCatalase
Smed IDSMED30033774
Length (bp)1761
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Catalase (SMED30033774) t-SNE clustered cells

Violin plots show distribution of expression levels for Catalase (SMED30033774) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Catalase (SMED30033774) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Catalase (SMED30033774) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033774

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30033774SMESG000055572.1 SmedASXL_009650SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30033774SMESG000055572.1 dd_Smed_v4_859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033774SMESG000055572.1 dd_Smed_v4_859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30033774SMESG000055572.1 dd_Smed_v4_859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033774SMESG000055572.1 dd_Smed_v4_859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30033774SMESG000055572.1 SMED30033774smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30033774SMESG000055572.1 OX_Smed_1.0.07208ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30033774SMESG000055572.1 dd_Smed_v6_859_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Catalase vs. Ensembl Human
Match: CAT (catalase [Source:HGNC Symbol;Acc:HGNC:1516])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 314/496 (63.31%), Postives = 377/496 (76.01%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++E+   +K  VL    G P+G+K + +T+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGKKT + VRFSTV  ESGSADTVRDPRGFAVKFYTE+GNWDLVGNNTPIFFIRDPI FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNL V+ A  L+  +PDY I+DL+ AI    YPSWT  IQVMT+ QA   PFNPFD+TKVWPHKDYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIEASPD+MLQGR+F+Y DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM + DN G  PNYYPNS+  P+  P  LEH    +G+V RF+  ++DN +Q   FY  VL+   +KRL ENIA +L+ A   I+ + V NF++VH + G  I   +++
Sbjct:    7 PASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDK 499          
BLAST of Catalase vs. Ensembl Human
Match: CAT (catalase [Source:HGNC Symbol;Acc:HGNC:1516])

HSP 1 Score: 59.3066 bits (142), Expect = 4.589e-11
Identity = 26/29 (89.66%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  238 QDSVFIDEMAHFDRERIPERVVHAKGGGA 324
            QD VF DEMAHFDRERIPERVVHAKG GA
Sbjct:    2 QDVVFTDEMAHFDRERIPERVVHAKGAGA 30          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-2 (Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q27487])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 301/495 (60.81%), Postives = 378/495 (76.36%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P  + L  Y+E +   + V+    GAPI +K + LT G RGPML+QD V++DEMAHFDRERIPERVVHAKG GA GYFE THDI+KYCKA IFNK+GK+T L++RFSTVG ESGSADT RDPRGFA+KFYTEEGNWDLVGNNTPIFFIRDPI FP+FIHTQKRNP+THL+DPNM +DF   RPE +HQ  FLFSDRG+PDG+RHM+G+GSHTFK+VN   +A Y KF F   QG+KNL V+KA +LA ++PDY+I+DL+ AI   ++P W M IQVMT+EQA K  FNPFD+TKVWPH DYPLI+VG+MVLN+NPRNYF EVEQ+AFCPA++VPGIE SPD+MLQGRIFSY+DTH HRLGPN+  +PVN   CP+R    N + DG M   DN    PN++PNS+N  +  P   +     TGDVDR+++GD++N+ QP  F+ KVLD  A++R+ +N A  L   ++ I    +++FSKVH + G  +   +++
Sbjct:    5 PSDNQLKTYKETYPKPQ-VITTSNGAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDISKYCKADIFNKVGKQTPLLIRFSTVGGESGSADTARDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPIHFPNFIHTQKRNPQTHLKDPNMIFDFWLHRPEALHQVMFLFSDRGLPDGYRHMNGYGSHTFKMVNKDGKAIYVKFHFKPTQGVKNLTVEKAGQLASSDPDYSIRDLFNAIEKGDFPVWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNPRNYFAEVEQSAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHFHRLGPNYIQLPVN---CPYRSRAHNTQRDGAMAY-DNQQHAPNFFPNSFNYGKTRPDVKDTTFPATGDVDRYESGDDNNYDQPRQFWEKVLDTGARERMCQNFAGPLGECHDFIIKGMIDHFSKVHPDFGARVKALIQK 494          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-2 (Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q27487])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 301/495 (60.81%), Postives = 378/495 (76.36%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P  + L  Y+E +   + V+    GAPI +K + LT G RGPML+QD V++DEMAHFDRERIPERVVHAKG GA GYFE THDI+KYCKA IFNK+GK+T L++RFSTVG ESGSADT RDPRGFA+KFYTEEGNWDLVGNNTPIFFIRDPI FP+FIHTQKRNP+THL+DPNM +DF   RPE +HQ  FLFSDRG+PDG+RHM+G+GSHTFK+VN   +A Y KF F   QG+KNL V+KA +LA ++PDY+I+DL+ AI   ++P W M IQVMT+EQA K  FNPFD+TKVWPH DYPLI+VG+MVLN+NPRNYF EVEQ+AFCPA++VPGIE SPD+MLQGRIFSY+DTH HRLGPN+  +PVN   CP+R    N + DG M   DN    PN++PNS+N  +  P   +     TGDVDR+++GD++N+ QP  F+ KVLD  A++R+ +N A  L   ++ I    +++FSKVH + G  +   +++
Sbjct:    5 PSDNQLKTYKETYPKPQ-VITTSNGAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDISKYCKADIFNKVGKQTPLLIRFSTVGGESGSADTARDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPIHFPNFIHTQKRNPQTHLKDPNMIFDFWLHRPEALHQVMFLFSDRGLPDGYRHMNGYGSHTFKMVNKDGKAIYVKFHFKPTQGVKNLTVEKAGQLASSDPDYSIRDLFNAIEKGDFPVWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNPRNYFAEVEQSAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHFHRLGPNYIQLPVN---CPYRSRAHNTQRDGAMAY-DNQQHAPNFFPNSFNYGKTRPDVKDTTFPATGDVDRYESGDDNNYDQPRQFWEKVLDTGARERMCQNFAGPLGECHDFIIKGMIDHFSKVHPDFGARVKALIQK 494          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-3 (Catalase [Source:UniProtKB/TrEMBL;Acc:Q8MYL7])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 297/485 (61.24%), Postives = 363/485 (74.85%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRN----YEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLG 1548
              D L  YR+ +++  L L    GAPI +K + LT G RGPML+QD V++DEMAHFDRERIPERVVHAKGGGA GYFE THDITKYCKA +FNK+GK+T L+VRFSTV  ESGSADTVRDPRGF++KFYTEEGNWDLVGNNTPIFFIRD I FP+FIH  KRNP+TH+RDPN  +DF   RPE++HQ  FL+SDRGIPDGFR M+G+G+HTFK+VN +    YCKF F   QG KNL    A +LA ++PDYAI+DL+ AI ++N+P W M IQVMT+EQA K  FNPFD+TKVWPH DYPLI+VG+MVLN+N +NYF EVEQAAFCPA++VPGIE SPD+MLQGRIFSY+DTH HRLGPN+  +PVN   CP+R+     + DG M   ++ GD PNY+PNS+ G +      E     TGDVDR++ GD+ N+ QP  F+ KVL    + RL  N+A +L    E I+   V  F+KVH + G
Sbjct:    2 AEDQLKAYRDRNQEPHL-LTTSNGAPIYSKTAVLTAGRRGPMLMQDIVYMDEMAHFDRERIPERVVHAKGGGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYHRLGPNYIQLPVN---CPYRSRAHTTQRDGAMAY-ESQGDAPNYFPNSFRGYRTRDDVKESTFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMVKEFTKVHPDFG 481          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-3 (Catalase [Source:UniProtKB/TrEMBL;Acc:Q8MYL7])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 297/485 (61.24%), Postives = 363/485 (74.85%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRN----YEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLG 1548
              D L  YR+ +++  L L    GAPI +K + LT G RGPML+QD V++DEMAHFDRERIPERVVHAKGGGA GYFE THDITKYCKA +FNK+GK+T L+VRFSTV  ESGSADTVRDPRGF++KFYTEEGNWDLVGNNTPIFFIRD I FP+FIH  KRNP+TH+RDPN  +DF   RPE++HQ  FL+SDRGIPDGFR M+G+G+HTFK+VN +    YCKF F   QG KNL    A +LA ++PDYAI+DL+ AI ++N+P W M IQVMT+EQA K  FNPFD+TKVWPH DYPLI+VG+MVLN+N +NYF EVEQAAFCPA++VPGIE SPD+MLQGRIFSY+DTH HRLGPN+  +PVN   CP+R+     + DG M   ++ GD PNY+PNS+ G +      E     TGDVDR++ GD+ N+ QP  F+ KVL    + RL  N+A +L    E I+   V  F+KVH + G
Sbjct:   21 AEDQLKAYRDRNQEPHL-LTTSNGAPIYSKTAVLTAGRRGPMLMQDIVYMDEMAHFDRERIPERVVHAKGGGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYHRLGPNYIQLPVN---CPYRSRAHTTQRDGAMAY-ESQGDAPNYFPNSFRGYRTRDDVKESTFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMVKEFTKVHPDFG 500          
BLAST of Catalase vs. Ensembl Celegans
Match: ctl-1 (Catalase-2 [Source:UniProtKB/Swiss-Prot;Acc:O61235])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 295/486 (60.70%), Postives = 362/486 (74.49%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRN----YEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLG 1548
            P  + L  Y+E +   + V+    GAPI +K + LT G RGPML+QD V++DEMAHFDRERIPERVVHAKG GA GYFE THDITKYCKA +FNK+GK+T L+VRFSTV  ESGSADTVRDPRGF++KFYTEEGNWDLVGNNTPIFFIRD I FP+FIH  KRNP+TH+RDPN  +DF   RPE++HQ  FL+SDRGIPDGFR M+G+G+HTFK+VN +    YCKF F   QG KNL    A +LA ++PDYAI+DL+ AI ++N+P W M IQVMT+EQA K  FNPFD+TKVWPH DYPLI+VG+MVLN+N +NYF EVEQAAFCPA++VPGIE SPD+MLQGRIFSY+DTH HRLGPN+  +PVN   CP+R+     + DG M   ++ GD PNY+PNS+ G +      E     TGDVDR++ GD+ N+ QP  F+ KVL    + RL  N+A +L    E I+   V  F+KVH + G
Sbjct:    5 PSDNQLKTYKETYPKPQ-VITTSNGAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYHRLGPNYIQLPVN---CPYRSRAHTTQRDGAMAY-ESQGDAPNYFPNSFRGYRTRDDVKESTFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMVKEFTKVHPDFG 485          
BLAST of Catalase vs. Ensembl Fly
Match: Cat (gene:FBgn0000261 transcript:FBtr0075058)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 308/486 (63.37%), Postives = 370/486 (76.13%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKP-RCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNP--RYLEHRDTLTGDVDRFDNGD-EDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGK 1551
             S+ L  Y+         +    GAPIG K +S T+GPRGP+LLQD  F+DEM+HFDRERIPERVVHAKG GA GYFE THDIT+YC A IF+K+ K+T L VRFSTVG ESGSADT RDPRGFAVKFYTE+G WDLVGNNTP+FFIRDPI FPSFIHTQKRNP+THL+DP+M WDF +LRPE+ HQ C LFSDRG PDG+ HM+G+GSHTFKL+N K E  Y KF F T+QGIKNL V  A +LA T+PDY+I+DLY  I    +PSWTM IQVMTYEQA K  +NPFD+TKVW  K+YPLI VG+MVL++NP+NYF EVEQ AF PA++VPG+E SPD+ML GR+FSYSDTHRHRLGPN+  IPVN P +    N++ DG M V DN    PNY+PNS+NGPQ  P  R L     +TGDV R+ +GD EDNF Q   F+  VLD CAKKRL +NIA +L +A++ ++ R V NF++VH + G+
Sbjct:    7 ASNQLIDYKNSQTVSPGAITTGNGAPIGIKDASQTVGPRGPILLQDVNFLDEMSHFDRERIPERVVHAKGAGAFGYFEVTHDITQYCAAKIFDKVKKRTPLAVRFSTVGGESGSADTARDPRGFAVKFYTEDGVWDLVGNNTPVFFIRDPILFPSFIHTQKRNPQTHLKDPDMFWDFLTLRPESAHQVCILFSDRGTPDGYCHMNGYGSHTFKLINAKGEPIYAKFHFKTDQGIKNLDVKTADQLASTDPDYSIRDLYNRIKTCKFPSWTMYIQVMTYEQAKKFKYNPFDVTKVWSQKEYPLIPVGKMVLDRNPKNYFAEVEQIAFSPAHLVPGVEPSPDKMLHGRLFSYSDTHRHRLGPNYLQIPVNCPYKVKIENFQRDGAMNVTDNQDGAPNYFPNSFNGPQECPRARALSSCCPVTGDVYRYSSGDTEDNFGQVTDFWVHVLDKCAKKRLVQNIAGHLSNASQFLQERAVKNFTQVHADFGR 492          
BLAST of Catalase vs. Ensembl Fly
Match: CG9314 (gene:FBgn0032061 transcript:FBtr0339543)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 270/491 (54.99%), Postives = 356/491 (72.51%), Query Frame = 1
Query:  109 SDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKP-RCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDT--LTGDVDRFDNGD-EDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCM 1569
            S+ L  Y+    + +  +   +G P+G K +  T+GPRGP LLQD  F+DE+ HFD ERIPERV +AKG GA GYFECTHDI+K+C A+IF+K+ K+T + +RFS    E GSADTVR+ RGFAVKFYT++G WD+VG N P+ ++RDP+ FPS +H QKRNP+THL+DP+M WDF +LRPET+H     FSDRG PDG+RH+HG+G HT++++N   E  Y +F F T+QGIKNL   +  EL   +PDYAI+DLY +I   NYPSW+M IQVM  E+A KC FNPFD+TKVWP KD+PL+ VG++VL++NP NYF EVEQ AF PA+MVPGIE SPD+MLQGR+F+Y D+ RHRLG N+  IPVN P R   RN++ DG M V DN    PNY+PNS+ GP+ +PR L  +    L+GDV RF +GD EDNFSQ   F+T  LDNC +KRL  N++E+L  A++ ++ R V  F+ VH + G+ + + +
Sbjct:    8 SNQLIDYKNNDSEVQREITTSSGTPVGVKDAIQTVGPRGPALLQDFQFLDEVMHFDSERIPERVAYAKGAGAFGYFECTHDISKFCAASIFDKVRKRTAVAMRFSVACGEQGSADTVREQRGFAVKFYTDDGIWDIVGCNMPVHYVRDPMLFPSLVHAQKRNPQTHLKDPDMFWDFMTLRPETLHALLMYFSDRGTPDGYRHLHGYGVHTYRMINASGETQYVRFHFKTDQGIKNLDARRCEELMSHDPDYAIRDLYNSIKKGNYPSWSMYIQVMLNEEAKKCRFNPFDVTKVWPQKDFPLLPVGKIVLDRNPTNYFTEVEQLAFSPAHMVPGIEPSPDKMLQGRLFAYGDSQRHRLGVNYMQIPVNCPYRVNVRNFQRDGAMTVTDNQNGAPNYFPNSFCGPRESPRALGLQTCCPLSGDVYRFMSGDTEDNFSQVTDFWTYTLDNCGRKRLVRNLSEHLTEASQFLQERAVKLFTMVHSDFGRLMTEAL 498          
BLAST of Catalase vs. Ensembl Fly
Match: CG9314 (gene:FBgn0032061 transcript:FBtr0079731)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 270/491 (54.99%), Postives = 356/491 (72.51%), Query Frame = 1
Query:  109 SDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKP-RCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDT--LTGDVDRFDNGD-EDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCM 1569
            S+ L  Y+    + +  +   +G P+G K +  T+GPRGP LLQD  F+DE+ HFD ERIPERV +AKG GA GYFECTHDI+K+C A+IF+K+ K+T + +RFS    E GSADTVR+ RGFAVKFYT++G WD+VG N P+ ++RDP+ FPS +H QKRNP+THL+DP+M WDF +LRPET+H     FSDRG PDG+RH+HG+G HT++++N   E  Y +F F T+QGIKNL   +  EL   +PDYAI+DLY +I   NYPSW+M IQVM  E+A KC FNPFD+TKVWP KD+PL+ VG++VL++NP NYF EVEQ AF PA+MVPGIE SPD+MLQGR+F+Y D+ RHRLG N+  IPVN P R   RN++ DG M V DN    PNY+PNS+ GP+ +PR L  +    L+GDV RF +GD EDNFSQ   F+T  LDNC +KRL  N++E+L  A++ ++ R V  F+ VH + G+ + + +
Sbjct:    8 SNQLIDYKNNDSEVQREITTSSGTPVGVKDAIQTVGPRGPALLQDFQFLDEVMHFDSERIPERVAYAKGAGAFGYFECTHDISKFCAASIFDKVRKRTAVAMRFSVACGEQGSADTVREQRGFAVKFYTDDGIWDIVGCNMPVHYVRDPMLFPSLVHAQKRNPQTHLKDPDMFWDFMTLRPETLHALLMYFSDRGTPDGYRHLHGYGVHTYRMINASGETQYVRFHFKTDQGIKNLDARRCEELMSHDPDYAIRDLYNSIKKGNYPSWSMYIQVMLNEEAKKCRFNPFDVTKVWPQKDFPLLPVGKIVLDRNPTNYFTEVEQLAFSPAHMVPGIEPSPDKMLQGRLFAYGDSQRHRLGVNYMQIPVNCPYRVNVRNFQRDGAMTVTDNQNGAPNYFPNSFCGPRESPRALGLQTCCPLSGDVYRFMSGDTEDNFSQVTDFWTYTLDNCGRKRLVRNLSEHLTEASQFLQERAVKLFTMVHSDFGRLMTEAL 498          
BLAST of Catalase vs. Ensembl Zebrafish
Match: cat (catalase [Source:NCBI gene;Acc:30068])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 298/495 (60.20%), Postives = 378/495 (76.36%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
             +D + +++E    ++  VL    G PIG+K +++T GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDIT+Y KA +F  IGK T + VRFSTV  E+GS+DTVRDPRGFAVKFYT+EGNWDL GNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG+RHM+G+GSHTFKLVN + +  YCKF + TNQGIKN+PV++A  LA T+PDY+I+DLY AI N N+PSWT  IQVMT+EQA    +NPFD+TKVW HK++PLI VG+ VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLG N+  +PVN   CP+R    NY+ DGPM + DN G  PNYYPNS++ P   PR+LE +  ++ DV R+++ D+DN +Q   F+T+VL+   ++RL +N+A +L+ A   I+ R V N   VH + G  +   +++
Sbjct:    8 STDQMKLWKEGRGSQRPDVLTTGAGVPIGDKLNAMTAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKTTPIAVRFSTVAGEAGSSDTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDTLLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGYRHMNGYGSHTFKLVNAQGQPVYCKFHYKTNQGIKNIPVEEADRLAATDPDYSIRDLYNAIANGNFPSWTFYIQVMTFEQAENWKWNPFDLTKVWSHKEFPLIPVGRFVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQLPVN---CPYRTRVANYQRDGPMCMHDNQGGAPNYYPNSFSAPDVQPRFLESKCKVSPDVARYNSADDDNVTQVRTFFTQVLNEAERERLCQNMAGHLKGAQLFIQKRMVQNLMAVHSDYGNRVQALLDK 499          
BLAST of Catalase vs. Ensembl Zebrafish
Match: cat (catalase [Source:NCBI gene;Acc:30068])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 296/477 (62.05%), Postives = 369/477 (77.36%), Query Frame = 1
Query:  157 VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            VL    G PIG+K +++T GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDIT+Y KA +F  IGK T + VRFSTV  E+GS+DTVRDPRGFAVKFYT+EGNWDL GNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG+RHM+G+GSHTFKLVN + +  YCKF + TNQGIKN+PV++A  LA T+PDY+I+DLY AI N N+PSWT  IQVMT+EQA    +NPFD+TKVW HK++PLI VG+ VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLG N+  +PVN   CP+R    NY+ DGPM + DN G  PNYYPNS++ P   PR+LE +  ++ DV R+++ D+DN +Q   F+T+VL+   ++RL +N+A +L+ A   I+ R V N   VH + G  +   +++
Sbjct:    4 VLTTGAGVPIGDKLNAMTAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKTTPIAVRFSTVAGEAGSSDTVRDPRGFAVKFYTDEGNWDLTGNNTPIFFIRDTLLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGYRHMNGYGSHTFKLVNAQGQPVYCKFHYKTNQGIKNIPVEEADRLAATDPDYSIRDLYNAIANGNFPSWTFYIQVMTFEQAENWKWNPFDLTKVWSHKEFPLIPVGRFVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQLPVN---CPYRTRVANYQRDGPMCMHDNQGGAPNYYPNSFSAPDVQPRFLESKCKVSPDVARYNSADDDNVTQVRTFFTQVLNEAERERLCQNMAGHLKGAQLFIQKRMVQNLMAVHSDYGNRVQALLDK 477          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 305/495 (61.62%), Postives = 374/495 (75.56%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
             +D + +++E    +K  VL    G PI +K + LT+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGK+T + +RFSTV  ESGSADTVRDPRGFAVK YTE+GNWDL GNNTP+FFIRD + FPSFIH+QKRNP+THL+DP+M WDF +LRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN K+EA YCKF + T+QGI+NL V++A  L+ ++PDY I DLY +I   NYPSW+  IQVMT++QA K  FNPFD+TK+WPH DYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLGPN+  +PVN   CP+R    NY+ DGPM   DN G  PNYYPNS+  P++ P+  EHR  ++ DV R+++ DEDN SQ   FY KVL    + RL ENIA +L+ A   I+ R V NF+ VH   G  I   +++
Sbjct:    8 AADQMKLWKESRGSQKPDVLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 499          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 306/503 (60.83%), Postives = 375/503 (74.55%), Query Frame = 1
Query:  118 LAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 1611
            + +++E    +K  VL    G PI +K + LT+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGK+T + +RFSTV  ESGSADTVRDPRGFAVK YTE+GNWDL GNNTP+FFIRD + FPSFIH+QKRNP+THL+DP+M WDF +LRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN K+EA YCKF + T+QGI+NL V++A  L+ ++PDY I DLY +I   NYPSW+  IQVMT++QA K  FNPFD+TK+WPH DYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLGPN+  +PVN   CP+R    NY+ DGPM   DN G  PNYYPNS+  P++ P+  EHR  ++ DV R+++ DEDN SQ   FY KVL    + RL ENIA +L+ A   I+ R V NF+ VH   G  I   +++       +T H 
Sbjct:    1 MKLWKESRGSQKPDVLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDKYNAEGYGMTIHF 500          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 304/491 (61.91%), Postives = 372/491 (75.76%), Query Frame = 1
Query:  118 LAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            + +++E    +K  VL    G PI +K + LT+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGK+T + +RFSTV  ESGSADTVRDPRGFAVK YTE+GNWDL GNNTP+FFIRD + FPSFIH+QKRNP+THL+DP+M WDF +LRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN K+EA YCKF + T+QGI+NL V++A  L+ ++PDY I DLY +I   NYPSW+  IQVMT++QA K  FNPFD+TK+WPH DYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLGPN+  +PVN   CP+R    NY+ DGPM   DN G  PNYYPNS+  P++ P+  EHR  ++ DV R+++ DEDN SQ   FY KVL    + RL ENIA +L+ A   I+ R V NF+ VH   G  I   +++
Sbjct:    1 MKLWKESRGSQKPDVLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 488          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 302/477 (63.31%), Postives = 365/477 (76.52%), Query Frame = 1
Query:  157 VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            VL    G PI +K + LT+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGK+T + +RFSTV  ESGSADTVRDPRGFAVK YTE+GNWDL GNNTP+FFIRD + FPSFIH+QKRNP+THL+DP+M WDF +LRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN K+EA YCKF + T+QGI+NL V++A  L+ ++PDY I DLY +I   NYPSW+  IQVMT++QA K  FNPFD+TK+WPH DYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLGPN+  +PVN   CP+R    NY+ DGPM   DN G  PNYYPNS+  P++ P+  EHR  ++ DV R+++ DEDN SQ   FY KVL    + RL ENIA +L+ A   I+ R V NF+ VH   G  I   +++
Sbjct:   16 VLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 489          
BLAST of Catalase vs. Ensembl Xenopus
Match: ncmap (non-compact myelin associated protein [Source:Xenbase;Acc:XB-GENE-5800493])

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 302/477 (63.31%), Postives = 365/477 (76.52%), Query Frame = 1
Query:  157 VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            VL    G PI +K + LT+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGK+T + +RFSTV  ESGSADTVRDPRGFAVK YTE+GNWDL GNNTP+FFIRD + FPSFIH+QKRNP+THL+DP+M WDF +LRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN K+EA YCKF + T+QGI+NL V++A  L+ ++PDY I DLY +I   NYPSW+  IQVMT++QA K  FNPFD+TK+WPH DYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLGPN+  +PVN   CP+R    NY+ DGPM   DN G  PNYYPNS+  P++ P+  EHR  ++ DV R+++ DEDN SQ   FY KVL    + RL ENIA +L+ A   I+ R V NF+ VH   G  I   +++
Sbjct:   26 VLTTGGGNPISDKLNLLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEITHDITKYSKAKVFEHIGKRTPIAIRFSTVAGESGSADTVRDPRGFAVKMYTEDGNWDLTGNNTPVFFIRDAMLFPSFIHSQKRNPQTHLKDPDMVWDFWALRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKDEAVYCKFHYKTDQGIRNLTVEEANRLSASDPDYGIHDLYESIAAGNYPSWSFYIQVMTFQQAEKFKFNPFDLTKIWPHGDYPLIPVGKLVLNRNPTNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVN---CPYRTRVANYQRDGPMCFTDNQGGAPNYYPNSFCAPENQPQVREHRFHVSADVARYNSADEDNVSQVRDFYVKVLSEEQRLRLCENIAGHLKDAQLFIQKRAVKNFTDVHPEYGARIQALLDK 499          
BLAST of Catalase vs. Ensembl Mouse
Match: Cat (catalase [Source:MGI Symbol;Acc:MGI:88271])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 314/496 (63.31%), Postives = 377/496 (76.01%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++E+   ++  VL    G PIG+K + +T G RGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDIT+Y KA +F  IGK+T + VRFSTV  ESGSADTVRDPRGFAVKFYTE+GNWDLVGNNTPIFFIRD I FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNLPV +A  LA  +PDY ++DL+ AI N NYPSWT  IQVMT+++A   PFNPFD+TKVWPHKDYPLI VG++VLNKNP NYF EVEQ AF P+NM PGIE SPD+MLQGR+F+Y DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM + DN G  PNYYPNS++ P+     LEH      DV RF++ +EDN +Q   FYTKVL+   +KRL ENIA +L+ A   I+ + V NF+ VH + G  I   +++
Sbjct:    7 PASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVTGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNADGEAVYCKFHYKTDQGIKNLPVGEAGRLAQEDPDYGLRDLFNAIANGNYPSWTFYIQVMTFKEAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVN---CPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQRSALEHSVQCAVDVKRFNSANEDNVTQVRTFYTKVLNEEERKRLCENIAGHLKDAQLFIQKKAVKNFTDVHPDYGARIQALLDK 499          
BLAST of Catalase vs. Ensembl Mouse
Match: Cat (catalase [Source:MGI Symbol;Acc:MGI:88271])

HSP 1 Score: 122.479 bits (306), Expect = 7.911e-32
Identity = 57/100 (57.00%), Postives = 72/100 (72.00%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKK 399
            P SD +  ++E+   ++  VL    G PIG+K + +T G RGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDIT+Y KA + N+  +K
Sbjct:    7 PASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVLNEEERK 106          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|P00432|CATA_BOVIN (Catalase OS=Bos taurus OX=9913 GN=CAT PE=1 SV=3)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 315/496 (63.51%), Postives = 380/496 (76.61%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++E+   +K  VL    G P+G+K +SLT+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDIT+Y KA +F  IGK+T + VRFSTV  ESGSADTVRDPRGFAVKFYTE+GNWDLVGNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNL V+ A  LA  +PDY ++DL+ AI   NYPSWT+ IQVMT+ +A   PFNPFD+TKVWPH DYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+F+Y DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM + DN G  PNYYPNS++ P+H P  LEHR   +GDV RF++ ++DN +Q   FY KVL+   +KRL ENIA +L+ A   I+ + V NFS VH   G  I   +++
Sbjct:    7 PASDQMKHWKEQRAAQKPDVLTTGGGNPVGDKLNSLTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLAHEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFSEAEIFPFNPFDLTKVWPHGDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVN---CPYRARVANYQRDGPMCMMDNQGGAPNYYPNSFSAPEHQPSALEHRTHFSGDVQRFNSANDDNVTQVRTFYLKVLNEEQRKRLCENIAGHLKDAQLFIQKKAVKNFSDVHPEYGSRIQALLDK 499          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|Q5RF10|CATA_PONAB (Catalase OS=Pongo abelii OX=9601 GN=CAT PE=2 SV=3)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 313/496 (63.10%), Postives = 377/496 (76.01%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++E+   +K  VL    G P+G+K + +T+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGKKT + VRFSTV  ESGSADTVRDPRGFAVKFYTE+GNWDLVGNNTPIFFIRDP+ FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNL V+ A  L+  +PDY I+DL+ AI  + YPSWT  IQVMT+ QA   PFNPFD+TKVWPHKDYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIEASPD+MLQGR+F+Y DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM + DN G  PNYYPNS+  P+  P  LEH    +G+V RF+   +DN +Q   FY  VL+   +KRL ENIA +L+ A   I+ + V NF++VH + G  I   +++
Sbjct:    7 PASDQMKHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPLLFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATEKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSTQCSGEVQRFNTASDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSRIQALLDK 499          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|P04040|CATA_HUMAN (Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 314/496 (63.31%), Postives = 377/496 (76.01%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++E+   +K  VL    G P+G+K + +T+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGKKT + VRFSTV  ESGSADTVRDPRGFAVKFYTE+GNWDLVGNNTPIFFIRDPI FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNL V+ A  L+  +PDY I+DL+ AI    YPSWT  IQVMT+ QA   PFNPFD+TKVWPHKDYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIEASPD+MLQGR+F+Y DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM + DN G  PNYYPNS+  P+  P  LEH    +G+V RF+  ++DN +Q   FY  VL+   +KRL ENIA +L+ A   I+ + V NF++VH + G  I   +++
Sbjct:    7 PASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDK 499          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|Q64405|CATA_CAVPO (Catalase OS=Cavia porcellus OX=10141 GN=CAT PE=2 SV=4)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 312/496 (62.90%), Postives = 378/496 (76.21%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++EE   +K  VL    G P+G+K + +T+GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA  YFE THDITKYCKA +F  IGKKT + VRFSTV  ESGSADTVRDPRGFAVKFYTEEG WDLVGNNTPIFFIRD + FPSFIH+QKRNP+THL+DP+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNL V+ A  L+  +PDY ++DL+ AI   NYPSWT+ IQVMT++QA   PFNPFD+TK+WPHKDYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+F+Y DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM V DN G  PNYYPNS++ P    + LEH    +GDV R+++ D+DN +Q   FYT+VL+   ++RL ENIA +L+ A   I+ + V NF  VH + G  I   +++
Sbjct:    7 PASDQMKHWKEERAAQKPDVLTTAGGNPVGDKLNIMTVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFAYFEVTHDITKYCKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEEGIWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKDPDMMWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNGSGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFQQAQSFPFNPFDLTKIWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVN---CPYRTRVANYQRDGPMCVTDNQGGAPNYYPNSFSAPVEQRQALEHTSRCSGDVGRYNSTDDDNVTQVRAFYTQVLNEEQRRRLCENIAGHLKDAQLFIQKKAVKNFMDVHPDYGNRIQTLLDK 499          
BLAST of Catalase vs. UniProt/SwissProt
Match: sp|Q2I6W4|CATA_CALJA (Catalase OS=Callithrix jacchus OX=9483 GN=CAT PE=2 SV=3)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 311/496 (62.70%), Postives = 375/496 (75.60%), Query Frame = 1
Query:  103 PCSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            P SD +  ++E+   +K  VL    G P+G+K + +T GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDITKY KA +F  IGK+T + VRFSTV  ESGSADTVRDPRGFAVKFYTE+GNWDLVGNNTPIFFIRDP+ FPSFIH+QKRNP+THL+ P+M WDF SLRPE++HQ  FLFSDRGIPDG RHM+G+GSHTFKLVN   EA YCKF + T+QGIKNL V+ A  L+  +PDY ++DL+ AI   NYPSWT  IQVMT+ QA   PFNPFD+TK+WPHKDYPLI VG++VLN+NP NYF EVEQ AF P+NM PGIEASPD+MLQGR+FSY DTHRHRLGPN+  IPVN   CP+R    NY+ DGPM + DN G  PNYYPNS+  P+H P  LEH    + +V RF+  ++DN +Q   FY  VL+   +KRL ENIA +L+ A   I+ + V NF +VH + G  I   +++
Sbjct:    7 PASDQMKHWKEQRAAQKADVLTTGAGNPVGDKLNVITAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPLLFPSFIHSQKRNPQTHLKHPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGLRDLFNAIATGNYPSWTFYIQVMTFSQAETFPFNPFDVTKIWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFSYPDTHRHRLGPNYLQIPVN---CPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEHQPSALEHSTRCSAEVQRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQLFIQKKAVKNFREVHNDYGTRIQALLDK 499          
BLAST of Catalase vs. TrEMBL
Match: A0A385G1K5 (Catalase OS=Dugesia japonica OX=6161 GN=CAT PE=2 SV=1)

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 390/506 (77.08%), Postives = 434/506 (85.77%), Query Frame = 1
Query:   94 MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 1611
            MS   ++ L+  +  +K EK++L R TGAPIG+KF+S+T+GPRGP+LLQD+VFIDEMAHFDRERIPERVVHAKGGGA GYFECTHDITKY KA  F+KIGKKTD+IVRFSTV  E GSADTVR+PRGFAVKFYTE GNWDLVGNNTPIFFIRDPIFFPSFIH+QKRNP+T LRDPNM WDFQSLRPET HQ  FLF+DRGIPDGFRHMHGFGSHTFKLVN+ +E  YCKFIF TNQGIKNL V+ A  L+G  PDYAI DL+ AI  +N+PSWT CIQVMTYEQA  C FNPFD+TKVWPHKD+PLI+VGQMVLNKNP NYFME+EQ AFCP+N +PGIEASPDRMLQGR+FSY DT RHRLG NF+LIPVNKPRCPFRNYEVDGPMRVDDNN +MPNYYPNSY GP+HNP+YLE R+  TGD+ RFDN DEDN SQ  IFYTKVLDN AK RLA+NIAE+L    EVIRAR VNNFSKVH+ L +DIL  ME+  GVKTNLT HL
Sbjct:    1 MSHSINNSLSDCKCMNKGEKILLTRSTGAPIGDKFNSITVGPRGPILLQDTVFIDEMAHFDRERIPERVVHAKGGGASGYFECTHDITKYTKAIPFSKIGKKTDVIVRFSTVSPELGSADTVRNPRGFAVKFYTEHGNWDLVGNNTPIFFIRDPIFFPSFIHSQKRNPKTFLRDPNMMWDFQSLRPETSHQFAFLFADRGIPDGFRHMHGFGSHTFKLVNENDEPVYCKFIFQTNQGIKNLTVENALLLSGKNPDYAIMDLFNAIETRNFPSWTFCIQVMTYEQAKNCSFNPFDVTKVWPHKDFPLIEVGQMVLNKNPMNYFMEIEQLAFCPSNFIPGIEASPDRMLQGRLFSYRDTQRHRLGANFDLIPVNKPRCPFRNYEVDGPMRVDDNNANMPNYYPNSYGGPEHNPKYLERREPSTGDIYRFDNADEDNHSQVTIFYTKVLDNEAKLRLAKNIAESLGQCKEVIRARAVNNFSKVHQQLSRDILMYMEQDLGVKTNLTCHL 506          
BLAST of Catalase vs. TrEMBL
Match: A0A131XP47 (Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 334/501 (66.67%), Postives = 399/501 (79.64%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTN 1596
             +D L  ++E HK+  L L    G P+G+K +  T+GPRGP+LLQD VF+DEMAHFDRERIPERVVHAKG GA GY E THDITKYCKAAIFN++GKKT L +RFSTVG ESGSADTVRDPRGFA+KFYTEEGNWDLVGNNTPIFFIRDP  FPSFIHTQKRNP THL+DP+M WDF SLRPET HQ  FLFSDRGIPDG+RHM+G+GSHTFKLVNDKNEA YCKF F T+Q IKNLPVDKA +L+G +PDY+I+DLY +I NK YP+W+M IQVMT++QA+K  +NPFD+TKVWPHK++PLI VG++VL++NP+NYF+EVEQ AFCPAN+VPG+E SPD+MLQGR+FSYSDTHRHRLGPNF  IPVN   CP++     Y+ DG M V +N    PNY+PNS++GP  NP+Y EH    +GDV+R+++ DEDNFSQP  FY K+L    + RL  NIA +L+ A E IRAR V NFSK H   G  I K +++   V  N
Sbjct:    7 ATDQLKEFKEGHKNASL-LTTSIGCPVGDKTNVQTVGPRGPVLLQDVVFLDEMAHFDRERIPERVVHAKGAGAFGYLEITHDITKYCKAAIFNQVGKKTPLAIRFSTVGGESGSADTVRDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPFLFPSFIHTQKRNPATHLKDPDMFWDFISLRPETTHQVMFLFSDRGIPDGYRHMNGYGSHTFKLVNDKNEAVYCKFHFKTDQKIKNLPVDKAGDLSGADPDYSIRDLYNSIANKQYPTWSMYIQVMTFDQASKWKYNPFDLTKVWPHKEFPLIPVGRLVLDRNPKNYFLEVEQLAFCPANLVPGVEPSPDKMLQGRLFSYSDTHRHRLGPNFVQIPVN---CPYKARVATYQRDGFMTVTNNEEGAPNYFPNSFSGPVDNPKYKEHVTQASGDVERWNSADEDNFSQPGNFY-KMLKEDERDRLTSNIANHLKDAQEFIRARAVKNFSKAHPECGASIAKKLDKLVQVSPN 502          
BLAST of Catalase vs. TrEMBL
Match: A0A0K8RIX4 (Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 333/495 (67.27%), Postives = 397/495 (80.20%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRN----YEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEEC 1578
             +D L  ++E HK+  L L    G P+G+K +  T+GPRGP+LLQD VF+DEMAHFDRERIPERVVHAKG GA GY E THDITKYCKAAIFN++GKKT L +RFSTVG ESGSADTVRDPRGFA+KFYTEEGNWDLVGNNTPIFFIRDP  FPSFIHTQKRNP THL+DP+M WDF SLRPET HQ  FLFSDRGIPDG+RHM+G+GSHTFKLVNDKNEA YCKF F T+Q IKNLPVDKA +L+G +PDY+I+DLY +I NK YP+W+M IQVMT++QA+K  +NPFD+TKVWPHK++PLI VG++VL++NP+NYF+EVEQ AFCPAN+VPG+E SPD+MLQGR+FSYSDTHRHRLGPNF  IPVN   CP++     Y+ DG M V +N    PNY+PNS++GP  NP+Y EH    +GDVDR+++ DEDNFSQP  FY K+L    + RL  NIA +L+ A E IRAR V NFSK H   G  I K +++ 
Sbjct:    7 ATDQLKEFKEGHKNASL-LTTSIGCPVGDKTNVQTVGPRGPVLLQDVVFLDEMAHFDRERIPERVVHAKGAGAFGYLEITHDITKYCKAAIFNQVGKKTPLAIRFSTVGGESGSADTVRDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPFLFPSFIHTQKRNPATHLKDPDMFWDFISLRPETTHQVMFLFSDRGIPDGYRHMNGYGSHTFKLVNDKNEAVYCKFHFKTDQKIKNLPVDKAGDLSGADPDYSIRDLYNSIANKQYPTWSMYIQVMTFDQASKWKYNPFDLTKVWPHKEFPLIPVGRLVLDRNPKNYFLEVEQLAFCPANLVPGVEPSPDKMLQGRLFSYSDTHRHRLGPNFVQIPVN---CPYKARVAPYQRDGFMTVTNNEEGAPNYFPNSFSGPVDNPKYKEHVTQASGDVDRWNSADEDNFSQPGNFY-KMLKEDERDRLTSNIANHLKDAQEFIRARAVKNFSKAHPECGASIAKKLDKL 496          
BLAST of Catalase vs. TrEMBL
Match: A0A131XUB4 (Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 332/498 (66.67%), Postives = 398/498 (79.92%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGV 1587
             +D L  ++E HK+  L L    G P+G+K +  T+GPRGP+LLQD VF+DEMAHFDRERIPERVVHAKG GA GY E THDITKYCKAAIFN++GKKT L +RFSTVG ESGSADTVRDPRGFA+KFYTEEGNWDLVGNNTPIFFIRDP  FPSFIHTQKRNP THL+DP+M WDF SLRPET HQ  FLFSDRGIPDG+RHM+G+GSHTFKLVNDKNEA YCKF F T+Q IKNLPVDKA +L+G +PDY+I+DLY +I NK YP+W+M IQVMT++QA+K  +NPFD+TKVWPHK++PLI VG++VL++NP+NYF+EVEQ AFCPAN+VPG+E SPD+MLQGR+FSYSDTHRHRLGPNF  IPVN   CP++     Y+ DG M V +N    PNY+PNS++GP  NP+Y EH    +GDV+R+++ DEDNFSQP  FY K+L    + RL  NIA +L+ A E IRAR V NFSK H   G  I K +++   +
Sbjct:    7 ATDQLKEFKEGHKNAGL-LTTSIGCPVGDKTNVQTVGPRGPVLLQDVVFLDEMAHFDRERIPERVVHAKGAGAFGYLEITHDITKYCKAAIFNQVGKKTPLAIRFSTVGGESGSADTVRDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPFLFPSFIHTQKRNPATHLKDPDMFWDFISLRPETTHQVMFLFSDRGIPDGYRHMNGYGSHTFKLVNDKNEAVYCKFHFKTDQKIKNLPVDKAGDLSGADPDYSIRDLYNSIANKQYPTWSMYIQVMTFDQASKWKYNPFDLTKVWPHKEFPLIPVGRLVLDRNPKNYFLEVEQLAFCPANLVPGVEPSPDKMLQGRLFSYSDTHRHRLGPNFVQIPVN---CPYKARVATYQRDGFMTVTNNEEGAPNYFPNSFSGPVDNPKYKEHVTQASGDVERWNSADEDNFSQPGNFY-KMLKEDERDRLTSNIANHLKDAQEFIRARAVKNFSKAHPECGASIAKKLDKLVQI 499          
BLAST of Catalase vs. TrEMBL
Match: A0A4D5RXB2 (Catalase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 327/477 (68.55%), Postives = 388/477 (81.34%), Query Frame = 1
Query:  160 LARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEEC 1578
            L   TG PIG+K +  T+GPRGP+L+QD VF+DEMAHFDRER PERVVHAKG GA GY E THDITKYCKAAIFNK+GKKT L +RFSTVG ESGSADTVRDPRGFA+KFYTEEGNWDLVGNNTPIFFIRDP FFPSFIHTQKRNP THL+DP+  WDF +LRPET HQ  FLFSDRGIPDG+RHM+G+GSHTFKLVNDKNEA YCKF F T+Q IKNLPVDKA EL+GT+PDY+I+DL  +I NK YP+W+M IQVMT++QA+K  +NPFD+TKVWPHK++PLI VG++VL++NP+NYF+EVEQ AFCPAN+VPG+E SPD+MLQGR+FSYSDTHRHRLGPNF  IPVN   CP++     Y+ DG M V +N    PNY+PNS++GP  +P+Y EH    +GDVDR+++ DEDNFSQP  FY K+L    + RL  NIA +L+ A E IRAR V NFSK H + G  I K +++ 
Sbjct:    5 LTTSTGCPIGDKTNVQTVGPRGPVLIQDVVFLDEMAHFDRERSPERVVHAKGAGAFGYLEITHDITKYCKAAIFNKVGKKTPLAIRFSTVGGESGSADTVRDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPFFFPSFIHTQKRNPATHLKDPDRFWDFITLRPETTHQVMFLFSDRGIPDGYRHMNGYGSHTFKLVNDKNEAVYCKFHFKTDQKIKNLPVDKAGELSGTDPDYSIRDLNNSIANKQYPTWSMYIQVMTFDQASKWKYNPFDLTKVWPHKEFPLIPVGRLVLDRNPKNYFLEVEQIAFCPANLVPGVEPSPDKMLQGRLFSYSDTHRHRLGPNFVQIPVN---CPYKARVATYQRDGFMTVTNNEEGAPNYFPNSFSGPVDHPKYKEHVTQASGDVDRWNSADEDNFSQPGNFY-KMLKEDERDRLTSNIANHLKDAQEFIRARAVKNFSKAHPDCGASIAKKLDKL 477          
BLAST of Catalase vs. Ensembl Cavefish
Match: cat (catalase [Source:NCBI gene;Acc:103032916])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 293/495 (59.19%), Postives = 378/495 (76.36%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
             +D + +++E    ++   L    G P+G+K +  T GP+GP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THD+T+YCKA +F  +GK T + VRFSTV  E+GSADTVRDPRGFAVKFYTE+GNWDL GNNTPIFFIRD + FPSFIH+QKRNP+THL+D +M WDF SLRPE +HQ  FLFSDRG+PDGFRHM+G+GSHTFKL+N +    YCKF + T+QGIKNLPV++A  LA T+PDYAI+DL++AI N N+PSWT  IQVMT+EQA   P+NPFD+TKVW HKD+PLI VG++VLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLG N+  +PVN   CP+R    NY+ DGPM + DN G  PNYYPNS++ P++ P+ +E +  ++ DV R+++ D+DN +Q   F+T+VL++  ++RL +N+A +L+ A   I+ R V     VH+N G  +   +++
Sbjct:    8 ATDQMKLWKENRGSQRPDALTTGAGVPVGDKLNVQTAGPQGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDVTRYCKAKVFEHVGKTTPIAVRFSTVAGEAGSADTVRDPRGFAVKFYTEDGNWDLTGNNTPIFFIRDAMLFPSFIHSQKRNPQTHLKDADMVWDFWSLRPECLHQVSFLFSDRGLPDGFRHMNGYGSHTFKLINAQGNPVYCKFHYKTDQGIKNLPVEEADRLASTDPDYAIRDLFSAIANGNFPSWTFYIQVMTFEQAENFPWNPFDLTKVWSHKDFPLIPVGRLVLNRNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQLPVN---CPYRARVANYQRDGPMCMTDNQGGAPNYYPNSFSAPKNQPQCMESKFRVSADVGRYNSADDDNVTQVRTFFTEVLNDAERERLCQNMAGHLKGAQLFIQKRMVQRLMAVHKNYGTRVQALLDK 499          
BLAST of Catalase vs. Ensembl Sea Lamprey
Match: cat (catalase [Source:NCBI gene;Acc:30068])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 290/474 (61.18%), Postives = 360/474 (75.95%), Query Frame = 1
Query:  157 VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKP-RCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            VL    G PI +K +  T GPRGP+L+QD+VF DEMAHFDRERIPERVVHAKG GA G+FE THDIT YCKA +F  +GK+T + VRFSTVG ESGSADTVRDPRGF VKFYTEEGNWDLVGNN PIFFIRDPI FPSFIHTQKRNP+THL+DP+M WDF SLRPE++H  C LFSDRGIPDG+RHM+G+GSHTFK+VN   EA YCKF + T+QGI+N+PV+ A  L+GT+PDY+I+DLY  I + N+P+WT+ +Q+MT+ QA    +NPFD+TKVWPH ++PLI VG++ LN+NP +YF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLG N+  +PVN P R   RNY+ DGPM + DN    PNYYPNS++ P+  P   EH+  ++ DV R+++ D+DN+SQ   FY  VL    + RL +NIA NL+ A + I+ R V   +  H  LG  +   + +
Sbjct:    4 VLTTGAGNPISDKLNVQTAGPRGPLLVQDTVFTDEMAHFDRERIPERVVHAKGAGAFGFFEVTHDITNYCKAKVFEHVGKRTPIAVRFSTVGGESGSADTVRDPRGFPVKFYTEEGNWDLVGNNVPIFFIRDPILFPSFIHTQKRNPQTHLKDPDMFWDFFSLRPESLHHMCILFSDRGIPDGYRHMNGYGSHTFKMVNAAGEAVYCKFHYKTDQGIRNIPVEVAERLSGTDPDYSIRDLYRTIADGNFPTWTLYVQIMTFAQAEVHRWNPFDLTKVWPHGEFPLIPVGRLELNRNPTDYFAEVEQIAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLHLPVNCPFRARVRNYQRDGPMCMFDNQAGAPNYYPNSFSAPEQQPHLREHKFAVSADVQRYNSADDDNYSQVNTFYGSVLSEAERTRLVQNIAGNLKEAQKFIQERMVKQLTLAHSELGARVKALLNQ 477          
BLAST of Catalase vs. Ensembl Yeast
Match: CTA1 (Catalase A; breaks down hydrogen peroxide in the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p) during fatty acid beta-oxidation [Source:SGD;Acc:S000002664])

HSP 1 Score: 423.705 bits (1088), Expect = 1.646e-143
Identity = 247/488 (50.61%), Postives = 312/488 (63.93%), Query Frame = 1
Query:  148 EKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPE---TVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCP-FRNYEV-DGPMRVDDNNGDMPNYYPN--SYNGPQHNPRYLEHRDTLTGDVDRF----DNGDEDNFSQPAIFYTKVLDN--CAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCME 1572
            E  V+   TG PI   F +  IG  GP+LLQD   ID +AHF+RE IP+R  HA G GA GYFE T DIT  C +A+F+KIGK+T  + RFSTVG + GSADTVRDPRGFA KFYTEEGN D V NNTP+FFIRDP  FP FIHTQKRNP+T+LRD +M WDF +  PE    +HQ   LFSDRG P  +R MHG+  HT+K  N   +  Y +    T+QGIKNL +++AT++AG+ PDY  +DL+ AI N NYPSWT+ IQ MT   A K PF+ FD+TKVWP   +PL +VG++VLN+NP N+F +VEQAAF P+  VP  EAS D +LQ R+FSY+D HR+RLGPNF+ IPVN P    F N  + DGPM V+ N G  P Y  N  SY   Q +    +H++   G    +      GD D F Q    Y +VL      +K LA NI  ++  A   I+ R  + F++V + L + I K  E
Sbjct:   18 EDRVVTNSTGNPINEPFVTQRIGEHGPLLLQDYNLIDSLAHFNRENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADTVRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRDADMFWDFLTT-PENQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLTIEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHRYRLGPNFHQIPVNCPYASKFFNPAIRDGPMNVNGNFGSEPTYLANDKSYTYIQQDRPIQQHQEVWNGPAIPYHWATSPGDVD-FVQARNLY-RVLGKQPGQQKNLAYNIGIHVEGACPQIQQRVYDMFARVDKGLSEAIKKVAE 502          
BLAST of Catalase vs. Ensembl Yeast
Match: CTT1 (Cytosolic catalase T; has a role in protection from oxidative damage by hydrogen peroxide [Source:SGD;Acc:S000003320])

HSP 1 Score: 330.872 bits (847), Expect = 7.069e-107
Identity = 213/540 (39.44%), Postives = 298/540 (55.19%), Query Frame = 1
Query:  130 REEHKDEKLVLARQTGAPIGNK-FSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHL---RDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANM-VPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPR-----------------CPFR--NYEVDGPMRVDDNNGDMPNYYPNSYNGPQ--HNPRYLEHRDTLTGDV--------------DRFDNG----------------DEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEV----IRARTVNNFSKVHENLGKDILKCM 1569
            ++E K EK V + Q G P  +  ++S    P GP+LLQD   ++ +A FDRER+PERVVHAKGGG    FE T  ++    AA +  +G K   +VRFSTVG ESG+ DT RDPRG + KFYTE GN D V NNTP+FF+RD I FP FIH+QKR+P++HL   +D  + WD+ +L PE++HQ  ++F DRG P  +  M+ +  H+F +VN + +  Y +F   ++ G + L  DKA EL+G+ PDY    L+  + N   P +   +Q MT EQA K  ++  D+TK+WPHK++PL + G + L +N  NYF E+EQ AF P N  +PGI+ S D +LQ R+FSY DT RHRLG N+  +PVN+PR                 CPF+  N++ DGPM    N G  PNY  +  N      N    E  D   G V              D+  N                    +F QP   Y KV ++  KK    N+   + HA ++    ++ R    F  ++E+LGK I +C+
Sbjct:    6 KKEEKQEK-VYSLQNGFPYSHHPYASQYSRPDGPILLQDFHLLENIASFDRERVPERVVHAKGGGCRLEFELTDSLSDITYAAPYQNVGYKCPGLVRFSTVGGESGTPDTARDPRGVSFKFYTEWGNHDWVFNNTPVFFLRDAIKFPVFIHSQKRDPQSHLNQFQDTTIYWDYLTLNPESIHQITYMFGDRGTPASWASMNAYSGHSFIMVNKEGKDTYVQFHVLSDTGFETLTGDKAAELSGSHPDYNQAKLFTQLQNGEKPKFNCYVQTMTPEQATKFRYSVNDLTKIWPHKEFPLRKFGTITLTENVDNYFQEIEQVAFSPTNTCIPGIKPSNDSVLQARLFSYPDTQRHRLGANYQQLPVNRPRNLGCPYSKGDSQYTAEQCPFKAVNFQRDGPMSY-YNFGPEPNYISSLPNQTLKFKNEDNDEVSDKFKGIVLDEVTEVSVRKQEQDQIRNEHIVDAKINQYYYVYGISPLDFEQPRALYEKVYNDEQKKLFVHNV---VCHACKIKDPKVKKRVTQYFGLLNEDLGKVIAECL 540          
BLAST of Catalase vs. Ensembl Nematostella
Match: EDO41684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3R1])

HSP 1 Score: 151.369 bits (381), Expect = 5.115e-44
Identity = 68/98 (69.39%), Postives = 80/98 (81.63%), Query Frame = 1
Query:  610 RDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNY 903
            +D NM WDF +LRPET HQ  FLFSDRGIPDGFRHM+G+GSHTFK+VN K +A YCKF   T+QGIKN PV++ATELAGT+PDY+ +DLY AI   NY
Sbjct:    1 QDANMFWDFITLRPETTHQTSFLFSDRGIPDGFRHMNGYGSHTFKMVNSKGKAVYCKFHVKTDQGIKNCPVERATELAGTDPDYSTRDLYNAIAEGNY 98          
BLAST of Catalase vs. Ensembl Nematostella
Match: EDO41682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Q8])

HSP 1 Score: 82.8037 bits (203), Expect = 2.589e-19
Identity = 38/99 (38.38%), Postives = 67/99 (67.68%), Query Frame = 1
Query: 1282 PNYYPNSYNGPQHN-PRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
            PNY+PNS++GP  +  +Y   + T++GD  R+++ D+DNF+Q   F+TKVL++  + RL +NIA +++ A + I+ R V  F+KVH + G  I + +++
Sbjct:    3 PNYFPNSFSGPMDDVAKYSPSQFTVSGDCARYNSADDDNFTQVTTFWTKVLNDEERMRLVKNIAGHVKDAKDFIQKRCVQQFTKVHPDFGNGIARELQK 101          
BLAST of Catalase vs. Ensembl Medaka
Match: cat (catalase [Source:NCBI gene;Acc:101158017])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 304/495 (61.41%), Postives = 373/495 (75.35%), Query Frame = 1
Query:  106 CSDPLAVYREEHKDEKL-VLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFR----NYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEE 1575
             +D +  ++E     K  VL    G PIG+K +  T GPRGP+L+QD VF DEMAHFDRERIPERVVHAKG GA GYFE THDIT+YCKA +F  IGK T + VRFSTV  ESGSADTVRDPRGFAVKFYT+EGNWDL GNNTP+FFIRD + FPSF+HTQKRNP+TH++DP+M WDF SLRPE +HQ  FLFSDRG+PDG+RHM+G+GSHTFKLVN   +  YCKF + T+QGIKNL V++A  LA T PDYAI DL+ AI N NYPSWT  IQVMT+EQA K  FNPFD+TKVW HK++PLI VG+MVLN+NP NYF EVEQ AF P+NM PGIE SPD+MLQGR+FSY DTHRHRLG N+  IPVN   CPFR    NY+ DGPM + DN G  PNYYPNS++ P+  P+++E +  ++ DV R+++ DEDN +Q   F+TKVL+   ++RL +N+A +L+ A   I+ R V N   VH + G  +   +++
Sbjct:    8 TTDQMKTWKENRGSRKPDVLTTGAGHPIGDKLNLQTAGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYCKAKVFEHIGKTTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTDEGNWDLTGNNTPVFFIRDALLFPSFVHTQKRNPQTHMKDPDMVWDFWSLRPECLHQVSFLFSDRGLPDGYRHMNGYGSHTFKLVNADGDRVYCKFHYKTDQGIKNLSVEEAEHLASTNPDYAIGDLFNAIANGNYPSWTFYIQVMTFEQAEKFQFNPFDLTKVWSHKEFPLIPVGRMVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFSYPDTHRHRLGANYLQIPVN---CPFRTRVANYQRDGPMCMFDNQGGAPNYYPNSFSAPETQPQFVESKFQVSPDVARYNSADEDNVTQVCTFFTKVLNEDERQRLCQNMAGSLKEAQLFIQKRMVENLKAVHPDYGNRVQTLLDK 499          
BLAST of Catalase vs. Planmine SMEST
Match: SMESG000055572.1 (SMESG000055572.1)

HSP 1 Score: 1025.77 bits (2651), Expect = 0.000e+0
Identity = 506/506 (100.00%), Postives = 506/506 (100.00%), Query Frame = 1
Query:   94 MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 1611
            MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL
Sbjct:    1 MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 506          
BLAST of Catalase vs. Planmine SMEST
Match: SMESG000055550.1 (SMESG000055550.1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 387/506 (76.48%), Postives = 432/506 (85.38%), Query Frame = 1
Query:   94 MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 1611
            M  P  DPL+VY+ +H+DEK++L R TGAPIGNKF+SLT+G RGP+LLQDSVF+DEMAHFDRERIPERVVHAKG GA G+FECTHDITKY KA+IFNKIG +TD+ VRFSTVGQESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDPIFFPSFIHTQKRNP+THLRDPNM WDFQSLRPET HQ  FLFSDRGIPDG+RHMHGFGSHTFKLVNDK+EA YCKFIF TNQGIKNL V+KATEL+GT+ DYAIKDL+ AI   NYPSWT+ IQVM+Y +A +CPFNPFD+TKVWP KDYPLIQVG++VLN+NPRNYFMEVEQ AFCP NM+PGIEASPD+MLQGR+FSY DT RHRLG NF LIPVNKP+CPFRNYEVDGPMRVDDNNG+MPNY+PN +               +TGD+ R D+ DEDN+SQ  IFYTKVLD  AK RLAENIA +L H NE+IRARTV NFSKVHE L +DIL  ME  +GV TNL  HL
Sbjct:    1 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASIFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLFSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPRKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNKH---------------ITGDIYRHDSSDEDNYSQVTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 491          
BLAST of Catalase vs. Planmine SMEST
Match: SMESG000055550.1 (SMESG000055550.1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 378/506 (74.70%), Postives = 418/506 (82.61%), Query Frame = 1
Query:   94 MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQDSVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIGKKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTXXXXXXXXXXXXXXXHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRGIPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELAGTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWPHKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGRIFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYYPNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCAKKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKTNLTSHL 1611
            M  P  DPL+VY+ +H+DEK++L R TGAPIGNKF+SLT+G RGP+LLQDSVF+DEMAHFDRERIPERVVHAKG GA G+FECTHDITKY KA+IFNKIG +TD+ VRFSTVGQESGSADTVRDPRGFA+KFYTE G WDLVGNNTPIFFIRDPIFFPSFIHTQKRNP+THLRDPNM WDFQSLRPET HQ  FLFSDRGIPDG+RHMHGFGSHTFKLVNDK+EA YCKFIF TNQGIKNL V+KATEL+GT+ DYAIKDL+ AI   NYPSWT+ IQVM+Y +A +CPFNPFD+TKVWP KDYPLIQVG++VLN+NPRNYFMEVEQ AFCP NM+PGIEASPD+MLQGR+FSY DT RHRLG NF LIPVNKP+CPFRNYEVDGPMRVDDNNG+MPNY+PNSY                                   IFYTKVLD  AK RLAENIA +L H NE+IRARTV NFSKVHE L +DIL  ME  +GV TNL  HL
Sbjct:    1 MPLPSDDPLSVYKSDHRDEKILLTRNTGAPIGNKFNSLTVGHRGPILLQDSVFLDEMAHFDRERIPERVVHAKGAGAFGFFECTHDITKYTKASIFNKIGCRTDIGVRFSTVGQESGSADTVRDPRGFAIKFYTETGIWDLVGNNTPIFFIRDPIFFPSFIHTQKRNPKTHLRDPNMFWDFQSLRPETTHQFAFLFSDRGIPDGYRHMHGFGSHTFKLVNDKDEAVYCKFIFKTNQGIKNLSVEKATELSGTDQDYAIKDLFNAIETGNYPSWTLYIQVMSYREAEQCPFNPFDVTKVWPRKDYPLIQVGRIVLNRNPRNYFMEVEQIAFCPVNMIPGIEASPDKMLQGRLFSYRDTQRHRLGANFQLIPVNKPQCPFRNYEVDGPMRVDDNNGEMPNYFPNSYG--------------------------------VTIFYTKVLDADAKMRLAENIAGHLCHCNEIIRARTVRNFSKVHEKLAQDILYRMERDHGVITNLNCHL 474          
The following BLAST results are available for this feature:
BLAST of Catalase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CAT0.000e+063.31catalase [Source:HGNC Symbol;Acc:HGNC:1516][more]
CAT4.589e-1189.66catalase [Source:HGNC Symbol;Acc:HGNC:1516][more]
back to top
BLAST of Catalase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctl-20.000e+060.81Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Pr... [more]
ctl-20.000e+060.81Peroxisomal catalase 1 [Source:UniProtKB/Swiss-Pr... [more]
ctl-30.000e+061.24Catalase [Source:UniProtKB/TrEMBL;Acc:Q8MYL7][more]
ctl-30.000e+061.24Catalase [Source:UniProtKB/TrEMBL;Acc:Q8MYL7][more]
ctl-10.000e+060.70Catalase-2 [Source:UniProtKB/Swiss-Prot;Acc:O6123... [more]
back to top
BLAST of Catalase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cat0.000e+063.37gene:FBgn0000261 transcript:FBtr0075058[more]
CG93140.000e+054.99gene:FBgn0032061 transcript:FBtr0339543[more]
CG93140.000e+054.99gene:FBgn0032061 transcript:FBtr0079731[more]
back to top
BLAST of Catalase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cat0.000e+060.20catalase [Source:NCBI gene;Acc:30068][more]
cat0.000e+062.05catalase [Source:NCBI gene;Acc:30068][more]
back to top
BLAST of Catalase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncmap0.000e+061.62non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+060.83non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+061.91non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+063.31non-compact myelin associated protein [Source:Xenb... [more]
ncmap0.000e+063.31non-compact myelin associated protein [Source:Xenb... [more]
back to top
BLAST of Catalase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cat0.000e+063.31catalase [Source:MGI Symbol;Acc:MGI:88271][more]
Cat7.911e-3257.00catalase [Source:MGI Symbol;Acc:MGI:88271][more]
back to top
BLAST of Catalase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00432|CATA_BOVIN0.000e+063.51Catalase OS=Bos taurus OX=9913 GN=CAT PE=1 SV=3[more]
sp|Q5RF10|CATA_PONAB0.000e+063.10Catalase OS=Pongo abelii OX=9601 GN=CAT PE=2 SV=3[more]
sp|P04040|CATA_HUMAN0.000e+063.31Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3[more]
sp|Q64405|CATA_CAVPO0.000e+062.90Catalase OS=Cavia porcellus OX=10141 GN=CAT PE=2 S... [more]
sp|Q2I6W4|CATA_CALJA0.000e+062.70Catalase OS=Callithrix jacchus OX=9483 GN=CAT PE=2... [more]
back to top
BLAST of Catalase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A385G1K50.000e+077.08Catalase OS=Dugesia japonica OX=6161 GN=CAT PE=2 S... [more]
A0A131XP470.000e+066.67Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1[more]
A0A0K8RIX40.000e+067.27Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1[more]
A0A131XUB40.000e+066.67Catalase OS=Ixodes ricinus OX=34613 PE=2 SV=1[more]
A0A4D5RXB20.000e+068.55Catalase (Fragment) OS=Ixodes scapularis OX=6945 P... [more]
back to top
BLAST of Catalase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat0.000e+059.19catalase [Source:NCBI gene;Acc:103032916][more]
back to top
BLAST of Catalase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat0.000e+061.18catalase [Source:NCBI gene;Acc:30068][more]
back to top
BLAST of Catalase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CTA11.646e-14350.61Catalase A; breaks down hydrogen peroxide in the p... [more]
CTT17.069e-10739.44Cytosolic catalase T; has a role in protection fro... [more]
back to top
BLAST of Catalase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO416845.115e-4469.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416822.589e-1938.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Catalase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat0.000e+061.41catalase [Source:NCBI gene;Acc:101158017][more]
back to top
BLAST of Catalase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055572.10.000e+0100.00SMESG000055572.1[more]
SMESG000055550.10.000e+076.48SMESG000055550.1[more]
SMESG000055550.10.000e+074.70SMESG000055550.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033774 ID=SMED30033774|Name=Catalase|organism=Schmidtea mediterranea sexual|type=transcript|length=1761bp
TGCAATTGGATAATTCATTCTGCATGTGTGCATGTAAACTCAATTTAAAT
TGGACTTGGATTGATAATCATTAATTTTTGAGAGTTACTAACAATGTCGT
GCCCTTGTTCTGATCCATTAGCTGTTTATCGAGAGGAGCACAAAGATGAG
AAGTTGGTATTAGCCCGACAAACTGGAGCACCTATCGGTAATAAGTTTAG
CTCGTTAACAATTGGACCTCGAGGTCCGATGTTATTGCAGGATTCTGTTT
TTATCGATGAAATGGCACATTTCGACAGAGAAAGAATACCAGAACGAGTT
GTTCATGCCAAAGGAGGGGGAGCTTTGGGTTATTTTGAATGCACTCATGA
TATAACAAAATACTGCAAAGCTGCTATATTCAATAAAATTGGCAAAAAAA
CCGATTTAATAGTTCGATTTTCGACAGTTGGTCAAGAAAGTGGCAGTGCT
GACACTGTAAGAGATCCTCGTGGGTTCGCGGTAAAATTTTATACTGAAGA
AGGTAATTGGGACTTAGTTGGAAATAACACTCCAATATTCTTCATTCGGG
ATCCAATATTTTTCCCTAGTTTTATTCACACTCAAAAAAGAAATCCAAGA
ACCCATTTAAGAGATCCTAATATGAAATGGGATTTCCAGTCTCTCAGACC
AGAAACGGTTCACCAGGCTTGCTTCTTATTCTCTGATCGAGGAATTCCAG
ACGGTTTCCGTCACATGCACGGATTTGGATCCCACACCTTCAAATTGGTC
AATGATAAAAATGAAGCTTTTTATTGCAAATTTATATTTAATACTAATCA
AGGAATTAAAAACCTACCAGTTGACAAAGCAACTGAATTAGCTGGCACAG
AGCCCGATTACGCAATCAAGGACTTATATGCCGCAATCGGAAATAAGAAT
TATCCTTCCTGGACTATGTGTATTCAAGTGATGACATATGAGCAAGCTGC
TAAATGCCCGTTTAATCCATTCGACATTACCAAAGTTTGGCCTCATAAGG
ATTATCCATTAATCCAAGTTGGTCAGATGGTCCTCAATAAAAATCCACGG
AATTATTTTATGGAAGTGGAACAAGCGGCATTCTGTCCAGCAAATATGGT
TCCCGGAATCGAAGCTAGTCCGGATAGAATGTTACAAGGCAGAATATTTT
CCTATAGTGACACTCATCGACATCGACTTGGTCCAAATTTTAACTTGATT
CCTGTCAACAAGCCTCGATGTCCATTTAGAAATTACGAAGTCGATGGACC
TATGCGAGTCGATGATAACAACGGGGATATGCCAAATTATTACCCGAATA
GTTACAATGGACCTCAACATAACCCAAGATACTTAGAACATCGCGATACA
CTTACTGGCGACGTTGACCGATTTGACAATGGGGATGAAGACAATTTTAG
TCAACCTGCAATTTTTTACACTAAAGTGCTCGATAATTGTGCCAAAAAGC
GACTTGCCGAGAATATCGCTGAAAATTTGCGACACGCGAATGAAGTTATT
AGAGCGCGAACAGTCAATAATTTTTCTAAAGTTCATGAAAATCTTGGTAA
AGACATATTAAAATGCATGGAAGAATGTTATGGCGTAAAAACCAACCTAA
CCAGCCATTTGTAATGACATTCTTACCGACTTTTTAAACTATTTGGATGT
GAATTAGTAGTAAATGTTGATTTTGCGTCAAATAAAATTTATCTTTTTTT
CAAAAAAAAACAATATTACATTGAAAACATGACGTCATTTGTAATAATAA
TTTAAATTACC
back to top

protein sequence of SMED30033774-orf-1

>SMED30033774-orf-1 ID=SMED30033774-orf-1|Name=SMED30033774-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MSCPCSDPLAVYREEHKDEKLVLARQTGAPIGNKFSSLTIGPRGPMLLQD
SVFIDEMAHFDRERIPERVVHAKGGGALGYFECTHDITKYCKAAIFNKIG
KKTDLIVRFSTVGQESGSADTVRDPRGFAVKFYTEEGNWDLVGNNTPIFF
IRDPIFFPSFIHTQKRNPRTHLRDPNMKWDFQSLRPETVHQACFLFSDRG
IPDGFRHMHGFGSHTFKLVNDKNEAFYCKFIFNTNQGIKNLPVDKATELA
GTEPDYAIKDLYAAIGNKNYPSWTMCIQVMTYEQAAKCPFNPFDITKVWP
HKDYPLIQVGQMVLNKNPRNYFMEVEQAAFCPANMVPGIEASPDRMLQGR
IFSYSDTHRHRLGPNFNLIPVNKPRCPFRNYEVDGPMRVDDNNGDMPNYY
PNSYNGPQHNPRYLEHRDTLTGDVDRFDNGDEDNFSQPAIFYTKVLDNCA
KKRLAENIAENLRHANEVIRARTVNNFSKVHENLGKDILKCMEECYGVKT
NLTSHL*
back to top
Aliases
The feature 'Catalase' has the following synonyms
Synonym
cat-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037060Catalase_core_sf
IPR040333Catalase_3
IPR018028Catalase
IPR011614Catalase_core
IPR010582Catalase_immune_responsive
IPR024711Catalase_clade1/3
IPR024708Catalase_AS
IPR002226Catalase_haem_BS
IPR020835Catalase_sf
Vocabulary: molecular function
TermDefinition
GO:0020037heme binding
GO:0004096catalase activity
GO:0004601peroxidase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006979response to oxidative stress
GO:0055114oxidation-reduction process
GO:0042744hydrogen peroxide catabolic process
GO:0098869cellular oxidant detoxification
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018028Catalase, mono-functional, haem-containingPRINTSPR00067CATALASEcoord: 121..138
score: 82.86
coord: 305..332
score: 61.56
coord: 100..118
score: 60.18
coord: 140..158
score: 74.18
coord: 37..60
score: 51.73
coord: 337..363
score: 66.67
IPR018028Catalase, mono-functional, haem-containingPANTHERPTHR11465CATALASEcoord: 22..490
IPR018028Catalase, mono-functional, haem-containingPROSITEPS51402CATALASE_3coord: 20..498
score: 74.52
IPR011614Catalase core domainSMARTSM01060Catalase_2coord: 24..408
e-value: 5.7E-276
score: 932.8
IPR011614Catalase core domainPFAMPF00199Catalasecoord: 25..405
e-value: 1.2E-191
score: 636.8
IPR010582Catalase immune-responsive domainPFAMPF06628Catalase-relcoord: 431..488
e-value: 2.1E-14
score: 53.5
IPR024711Catalase, mono-functional, haem-containing, clades 1 and 3PIRSFPIRSF038928Catalase_clade1-3coord: 13..496
e-value: 8.0E-210
score: 695.6
IPR037060Catalase core domain superfamilyGENE3DG3DSA:2.40.180.10coord: 21..496
e-value: 2.4E-228
score: 760.7
NoneNo IPR availablePANTHERPTHR11465:SF9CATALASEcoord: 22..490
IPR024708Catalase active sitePROSITEPS00438CATALASE_2coord: 60..76
IPR002226Catalase haem-binding sitePROSITEPS00437CATALASE_1coord: 350..358
IPR040333Catalase, clade 3CDDcd08156catalase_clade_3coord: 64..488
e-value: 0.0
score: 815.615
IPR020835Catalase superfamilySUPERFAMILYSSF56634Heme-dependent catalase-likecoord: 16..493