Orphan chemoreceptor family protein

Overview
NameOrphan chemoreceptor family protein
Smed IDSMED30033769
Length (bp)6949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Orphan chemoreceptor family protein (SMED30033769) t-SNE clustered cells

Violin plots show distribution of expression levels for Orphan chemoreceptor family protein (SMED30033769) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Orphan chemoreceptor family protein (SMED30033769) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Orphan chemoreceptor family protein (SMED30033769) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033769

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033769SMESG000076072.1 SmedASXL_059374SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30033769SMESG000076072.1 SmedASXL_010172SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033769SMESG000076072.1 SmedASXL_010172SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30033769SMESG000076072.1 dd_Smed_v4_17134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30033769SMESG000076072.1 SMED30033769smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30033769SMESG000076072.1 Contig53877newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033769SMESG000076072.1 Contig53877uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30033769SMESG000076072.1 dd_Smed_v4_17134_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ovarySMED30033769SMESG000076072.1 SMED30033769smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oviductSMED30033769SMESG000076072.1 SMED30033769smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
sperm ductSMED30033769SMESG000076072.1 SMED30033769smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30033769SMESG000076072.1 SMED30033769smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30033769SMESG000076072.1 SMED30033769smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30033769SMESG000076072.1 KX018822smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oviductSMED30033769SMESG000076072.1 KX018822smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
sperm ductSMED30033769SMESG000076072.1 KX018822smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30033769SMESG000076072.1 KX018822smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30033769SMESG000076072.1 KX018822smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30033769SMESG000076072.1 SMED_21334_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30033769SMESG000076072.1 SMED_21334_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Orphan chemoreceptor family protein vs. TrEMBL
Match: A0A193KTZ7 (Orphan chemoreceptor family protein OS=Schmidtea mediterranea OX=79327 GN=ophis PE=2 SV=1)

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 476/478 (99.58%), Postives = 476/478 (99.58%), Query Frame = 3
Query: 5394 MVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYXXXXXXXXXXXXXXXXKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTSTCDGSVACSKCLYMRQGSAKYYLKVKRRASVILLMISFSYLICHAWNTAFTGVFXXXXXXXXXXXQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSXXXXXXXXXXXXXXXXXXRTEFARIFQNVGRSIRNRFGIFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN 6827
            MVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTST DGSVACSKCLYMRQGSAKYYLKVKRRASVILLMISFSYLICHAWNTAFTGVFLRYYYLYAARLQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTEFARIFQNVGRSIRNRFG FKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN
Sbjct:    1 MVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTSTYDGSVACSKCLYMRQGSAKYYLKVKRRASVILLMISFSYLICHAWNTAFTGVFLRYYYLYAARLQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTEFARIFQNVGRSIRNRFGTFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN 478          
BLAST of Orphan chemoreceptor family protein vs. TrEMBL
Match: A0A498M9K3 (PiggyBac transposable element-derived 2-like protein OS=Labeo rohita OX=84645 GN=ROHU_008556 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.528e-7
Identity = 32/70 (45.71%), Postives = 41/70 (58.57%), Query Frame = -3
Query:  276 STDLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCFLK 485
            S+D E KK + PTA +P  DVR D  AH +I    + RC++ G +G  + KC  C  HLC T   NCFLK
Sbjct:  121 SSDYETKKRQGPTAPIPIPDVRLDATAHWIIMSEKKGRCRVPGCKGTPNAKCRKCNAHLCFTSTTNCFLK 190          
BLAST of Orphan chemoreceptor family protein vs. TrEMBL
Match: A0A1B0A8N8 (Uncharacterized protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 5.072e-7
Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = -3
Query:  282 DLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCF 479
            ++E KKH+ PT  +PP D+RTD I H     + + RCKL G +GFS  +C  CKV LC  K++NCF
Sbjct:  186 EIEAKKHRGPTKPIPPKDIRTDGIGHDEKRCSSKNRCKLPGCKGFSRTECIKCKVTLCHNKNRNCF 251          
BLAST of Orphan chemoreceptor family protein vs. TrEMBL
Match: A0A1A9VFM5 (DDE_Tnp_1_7 domain-containing protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.877e-7
Identity = 34/68 (50.00%), Postives = 43/68 (63.24%), Query Frame = -3
Query:  282 STDLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCF 485
              ++E KKH+ PT  +PP DVRTD I H     N + RCKL G +GFS  +C  CKV LC  K++NCF
Sbjct:  361 EMEIEAKKHRGPTKPIPPKDVRTDGIGHDEKRCNSKNRCKLPGCKGFSRTECIKCKVTLCHNKNRNCF 428          
BLAST of Orphan chemoreceptor family protein vs. TrEMBL
Match: A0A3N0YMG2 (Uncharacterized protein OS=Anabarilius grahami OX=495550 GN=DPX16_1265 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 3.183e-6
Identity = 30/70 (42.86%), Postives = 38/70 (54.29%), Query Frame = -3
Query:  276 STDLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCFLK 485
            + + E K+ K P A +P  DVR D  AH +I    + RCK+ G  G    KC  C VHLC T   NCFL+
Sbjct:   39 AGEYEEKRRKGPAAPIPVPDVRLDATAHWMIMAEKKGRCKVPGCTGTPKAKCRKCDVHLCFTSTSNCFLR 108          
BLAST of Orphan chemoreceptor family protein vs. Ensembl Medaka
Match: ENSORLT00000027873.1 (piggyBac transposable element-derived protein 3 [Source:NCBI gene;Acc:101162175])

HSP 1 Score: 58.9214 bits (141), Expect = 5.350e-8
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = -3
Query:  276 DLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCFLK 479
            + + KK + P   +P  +VRTD + H  +  N R+RCK    +G +  KC  C +HLCL ++ NCFL+
Sbjct:  521 EFQKKKRRGPAKAIPAQEVRTDAVGHWPVVENGRQRCKFPQCKGQTVIKCGKCNIHLCLKRNSNCFLE 588          
BLAST of Orphan chemoreceptor family protein vs. Ensembl Medaka
Match: ENSORLT00000031528.1 (piggyBac transposable element-derived protein 3 [Source:NCBI gene;Acc:101162175])

HSP 1 Score: 58.9214 bits (141), Expect = 5.350e-8
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = -3
Query:  276 DLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCFLK 479
            + + KK + P   +P  +VRTD + H  +  N R+RCK    +G +  KC  C +HLCL ++ NCFL+
Sbjct:  521 EFQKKKRRGPAKAIPAQEVRTDAVGHWPVVENGRQRCKFPQCKGQTVIKCGKCNIHLCLKRNSNCFLE 588          
BLAST of Orphan chemoreceptor family protein vs. Ensembl Medaka
Match: ENSORLT00000038512.1 (piggyBac transposable element-derived protein 2-like [Source:NCBI gene;Acc:111947160])

HSP 1 Score: 51.6026 bits (122), Expect = 8.943e-6
Identity = 24/70 (34.29%), Postives = 37/70 (52.86%), Query Frame = -3
Query:  276 STDLENKKHKAPTACVPPLDVRTDQIAH*VIY*NPRKRCKLLGFRGFSHFKCN*CKVHLCLTKDKNCFLK 485
            + + + K+ + P   +P  DVR D  AH ++    + RCK+ G +G    KC  C + LC T   NCFL+
Sbjct:  483 AGEYKEKRRRGPATPIPVADVRLDATAHWMVMDEKKGRCKVPGCKGTPKAKCQKCDISLCFTSTSNCFLR 552          
BLAST of Orphan chemoreceptor family protein vs. Planmine SMEST
Match: SMESG000076072.1 (SMESG000076072.1)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 459/481 (95.43%), Postives = 460/481 (95.63%), Query Frame = 3
Query: 5385 KQLMVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYXXXXXXXXXXXXXXXXKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTSTCDGSVACSKCLYMRQGSAKYYLKVKRRASVILLMISFSYLICHAWNTAFTGVFXXXXXXXXXXXQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSXXXXXXXXXXXXXXXXXXRTEFARIFQNVGRSIRNRFGIFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN 6827
            KQLMVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTST DGSVACSKCLYMRQGSA                   +YLICHAWNTAFTGVFLRYYYLYAARLQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTEFARIFQNVGRSIRNRFG FKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN
Sbjct:   20 KQLMVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTSTYDGSVACSKCLYMRQGSA-------------------NYLICHAWNTAFTGVFLRYYYLYAARLQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTEFARIFQNVGRSIRNRFGTFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN 481          
BLAST of Orphan chemoreceptor family protein vs. Planmine SMEST
Match: SMESG000076072.1 (SMESG000076072.1)

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 456/478 (95.40%), Postives = 457/478 (95.61%), Query Frame = 3
Query: 5394 MVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYXXXXXXXXXXXXXXXXKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTSTCDGSVACSKCLYMRQGSAKYYLKVKRRASVILLMISFSYLICHAWNTAFTGVFXXXXXXXXXXXQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSXXXXXXXXXXXXXXXXXXRTEFARIFQNVGRSIRNRFGIFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN 6827
            MVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTST DGSVACSKCLYMRQGSA                   +YLICHAWNTAFTGVFLRYYYLYAARLQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTEFARIFQNVGRSIRNRFG FKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN
Sbjct:    1 MVFCRLITSIPLAIILVFITILAILGNIFLFTVICQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQSEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRALIIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFVYVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSFRFGKMDLSTNRRQLNEYDSSGPSDRSTSTYDGSVACSKCLYMRQGSA-------------------NYLICHAWNTAFTGVFLRYYYLYAARLQNVSDNSTEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTEFARIFQNVGRSIRNRFGTFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYYYPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTIN 459          
The following BLAST results are available for this feature:
BLAST of Orphan chemoreceptor family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KTZ70.000e+099.58Orphan chemoreceptor family protein OS=Schmidtea m... [more]
A0A498M9K32.528e-745.71PiggyBac transposable element-derived 2-like prote... [more]
A0A1B0A8N85.072e-748.48Uncharacterized protein OS=Glossina pallidipes OX=... [more]
A0A1A9VFM55.877e-750.00DDE_Tnp_1_7 domain-containing protein OS=Glossina ... [more]
A0A3N0YMG23.183e-642.86Uncharacterized protein OS=Anabarilius grahami OX=... [more]
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Orphan chemoreceptor family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000027873.15.350e-838.24piggyBac transposable element-derived protein 3 [S... [more]
ENSORLT00000031528.15.350e-838.24piggyBac transposable element-derived protein 3 [S... [more]
ENSORLT00000038512.18.943e-634.29piggyBac transposable element-derived protein 2-li... [more]
back to top
BLAST of Orphan chemoreceptor family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000076072.10.000e+095.43SMESG000076072.1[more]
SMESG000076072.10.000e+095.40SMESG000076072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033769 ID=SMED30033769|Name=Orphan chemoreceptor family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=6949bp
CCCATAAAATATAATGAAAGAGCATCCCAAAAACAAATTGAATTAAAATT
ATACAAAAAAGAATAATAAAAATCAAAAAATAATTTAAAAATAATTTAAA
AATCTAATTTAAAATTTAATATCAAAAAATAGAAAAACGGCAATGTAGCA
AATTTGCTACATCAAGCAATGGTTAAGTCAATATAAAAATAAATATTTTA
CGTATTTCACATTTTTTTTTAAATATAAATAAAAGCATTAGACATTTTAC
AAACATTTATTAATAAAAAACAATTTTTTAAAAAGCAATTTTTATCCTTA
GTTAGACAAAGATGTACCTTACATTAATTGCATTTAAAATGTGAAAAACC
TCTGAATCCGAGTAATTTACATCTTTTTCGTGGATTTTAATATATTACTC
AATGGGCAATTTGGTCTGTTCGAACATCCAACGGTGGAACACAAGCAGTT
GGTGCTTTGTGTTTTTTGTTTTCAAGATCGGTTGAATACTATTTGGTCTT
CTTTTGCCATTTTGTGTACCAATACGGCACATACAATTTCTGCTCTAAAC
TTCCAGAGCATCTATCGACTTTGTTCCCCGTTTTTCAAAAGTATTTTTAT
TTCGGTCAAAATCAGGTGAAAACTTCTCAAGACACACTCAACTGTTGATG
TCGCCAAGACAGAATTTTAGGTTAGTATAGTGTGTTTTGTGGCGCATCTA
GCGGTCACTTTATGAACTAAATCCGTTAAACAGCTTTGTAGCTCATATGC
AGCACTATGAAATGGTTAGTTTTTATTTATTTTAGGCGATCTTAATGTGA
AATTATGCTATGTAACAAATTTGCTACACAATGCAATTAAGGGCTAATAA
ACTAATAATTTAGAATGCTTGAATTTTTTTAGTTAATAAAATGTGACAAT
TTTTCTGTTCTATTTTTATAGTTTTTGATAATTGTTTTTAATTTTTATTA
AATCGTGTAAAAATATAAATTCTTGAGTTGTAATTTGAAAACCACATGCA
TTTCCCCCTACCTACCATGTTTATAAGTGTTTTAAAAGTAAATTTAAAAT
ACATATTTCAATTCAAAACTGAATTAGTTATTAATTAAGAAAAATGCTTT
TAAATTTGTATCAATTTAAACGTAATATTGTTTGAATTCAATTTGAACCA
GTTTCGTGTTTGATTTAAATTAATTAAATTTTGAAATTCTCATGTTATTT
TTATCGTTTATTTTTAAATATATGCCAATCCATAATTTTCATTGAAAGTC
CCATTTGGAATTTGTTAGTGTTTTATTAAATTTATTATCTCAAAATAATG
ATCGAACAAATAAAAAATTTTTAAATCAAATATTACTCATTCCTAATTGA
ATTTAAGCCTTTGCTAGCGTTACTTAATCAAATTTATTGGAAGATTTTTA
TTATGTATAATATTTGATGTTGATGTTATGTTGAAGCATCTGAACACCAA
AAAGAGTATCTTTAGAGATGGCGTGTTGAGGTTTCACTTGCACGAGAATT
TGTCGGAGTTAGTGAGTTATATACCTATAGGTTAGGCAAAAAAGAGATAA
TAAAGTTTGATAGTTAATTTACATCTAGAAATTTTTAATAATATCAACTT
TATTTTTGAAGTCTGTTAAAAATTTATAAATAAATTTGAATAATATTTTT
ACATAAGGCATACAAAATATTAATCTTGCCAAATTCATTAAAATAATTTA
ACTTTTAAATATTTTTGATAGAACATTTAAATTTATTCATATTAACAAAT
TGAATTAGATAATATCTATTATTAAAACAAATTAATTTATTTCTAATATC
GGTGGGGAATTTTAATTAAATTTTAATTAAATCTTAATAATATTTTGAGC
CATACAAATCTTAACATAACATAAATATTAAAATATATATATTAATACAT
CTTATAAGGTTTCGGTATATCTTTAATTCGAATAATACGATTTGTTATAT
GTATTTGTAAATTTTGGCCTACTTATTTATAAGGCAATTTCTGGATTTTA
TTCCCACAGTGTCTCTGAATGAAACATAAAATAAGAACATTAAACAAAGT
TGAACGTGTCAAATAAAAGTATTTGTAGAAATTCTAATATTTTTTACTTC
CAATAATAATACATTTATTATAAATAATATAAAACCTAATAAAATAAAAC
AATAATATTAATTCGTTTTTCTAAGAACTCTATATTAATATTATTTTAGA
TATTGAATGTAAATTTTATTTTAATTTATGAACGAACGTATTTTCTTATA
ATAAGCTATTGTATTATTAATATATTTGGAATTTATTCACAAAATCAGGA
ATATTATGGATCTGGAGTAAAAAAAGTTTTACCTCAAGGAATCTGTGGAA
TAGAAAAGGGAAAAATGAAAACATTACATTGTTTATTAGTTAAAGGAAAA
CAGTTAAGTTTGTTTAACGAAAGTAAACAAATGAGGAATAAAAAAAATTA
ATTATTTGGAAATCGTAATTTCGTCGTCATGGTAAATGGGAAAGAGACGC
AAAGAAAGTCAAATCAATTTCACATTCTCAATTTATCAACGTCAAAAAAG
TACTTTCCCCTAAAATTTTAAGGTTACAATTATACGGTCACCGTTATTGG
TTTGCTTTCATTTGGACAATTAGAATTGTTATTTTTTGAATTGTTGTCGG
AGTGGCATTCATTTTGGTAGTACCTTATAAATGAATAAAAACGTAAAGCT
TTACCCTTCTACATCTTTCGTAACCGTATTTCTAAAGAAATTGCAAAAAC
CTATAAGTCTAAGATAATAAGTTAATGTATAACAAGAAATATGATTGCTA
GATAAGAAACCCTAATTAGGTGATACTGTCTAATGTTACAACTTTGTTTG
CTTTATGATTTATATTTATTTCTTACAATTATTATATTTACAAAATTATA
TATAGATTGAATACAATTACTTAAATAAAAAATAAAAGTTTATATATTTC
TTGTAGGTGCTTATGGTAATTAATCGCCAAGAGCAGTTAAAAATTGTCAA
GTAAACCCATGAAGGTTTGTGAATATCAGACTAAATTTTTGCGCCATTTT
GTACATTTGGACATGAATATTGTAAAACAGAAAGTAGCAACAAGATATTT
TTATAGTATTCAATTGTTGAACAATTACAAACACGTTTATCAAAATTAAC
ATTGACAAAAAATCTAAATGGAACTTAGAAGTGGTTTCTCCTATGAAATA
ATGAAGCAAGTTGACTTGATGATTAGGCTATATGGTGAGTATCCCGAAAT
AATTAGTCATGTCTCAAATATCCTGCGTCCAACAAACTCAATTAGTGGAC
ACCCCACAGATTTCTATTTAAAAAATTAAAAACAGTAACCATTTCAATGT
TATTTTATCACTGAAGTAAATATTACATGTATTTTATCTATCAGAATTCC
GTACTCTAATCATAAGTGACTGAATTCGGTGAAGTCAAATTTTATACCGC
TCTGTATTTGAAGGCAATAAAATAATAACGGTGACATGACTATTTTAAAT
GTTAAACTTTTTTTATAAAATATTTCATAAAATATACTAAAGTCCCACCA
AATTGTCCTTTAAAAAATTATTTTATTCAATACATTCTTCACAATTTGTA
ATTGTTTCATACAATGATATAGTACGCGAAGTAATTACAAGACACAGGCA
AGTAGAAGTAAAAAATTATAATACGGATAAAGAGTAATCTTAGAAACCAT
GTCAGAATGTCGAATTTAGCATGTAAATGTCAGTAATCAAGAGAATGATT
ATTACAATAACAAGCTACTCAGCATAATTTTCAGCTTATTAAAAATAAAG
GCAAAGGCTAAAATCTGTGTTAATTGTAATTATAAAATAATATATGATCT
TTTGTCAAAAACAAAATAAATAAAAGTTCATTAAAAAGATCAAAAGTAAC
CAATAAAAATAATTTTACTGGTGTATTTGGTATATATTGTAAATTATTCA
TATTTTAAAATAAGTCAAAAGTCGTTTTTTAACTGTTTTATATACTAGAC
CGAGGTGGCTCTTATCCTGTAAGAACTTCCTTTATAATTTATATATTGAT
TCATAACAATGTAAAAAAAATCACAAATTTTTGTAAAAAAAACATTTTTA
TTTTAGATTTTGATTCACAAAATGTTTTATTTAAATAGTTTATTAAAGTT
GTTTAAATATTTTTACTGTTTCAACACGAGCTTACTTTTTTAAAATTCTA
CTTAGGACGCAAAAACTATCAAAATGTTCATTATATTTGCAACAATTTAA
ATAAAGATAAAGCATCATTATAATTATTTAAATACCATAGTAATATATTT
TTTGTAGAAAAGTAGGTATCACATATATATTGTGCAATTCGGTACCCTAT
AGTGTTGTACCTTAATTAAATATATTAGTTAGTTATGTACAATATATTAT
TGTTTATAGTACTTCTATTTAATATATTTGTTTTCTGAAACCCCTTAAAA
TGAGTAATAAAAAGAACAATAGCGATTTTAATAAAATGTAAACTGAGAAG
TTTGCATTTGTGGAAGTTAATGTGAATTAACAATGTTTATTTTGTAATTT
GCAAATGCAGAACAATAAATCTAGCAATATCGAATGTAAAACATTTAGAT
TTCAATGAAAAAGAAAAGGCTGTCAAATATTTAGAAAAAACACTGGGCAA
ACAAAGTTTTTTTTAATTTGTTCAAATCTTCATCATGTATAACAGAAGCA
CGTTTTGAATTAGCCTGAGAAATTGCATAAGCTCAAAATTCTTTAACAGA
TAGTGAATTTGTTAATAAATAATTCTTTTTAAAGATTTTAAAAACAATTA
AAGATTCATCGATCTCAACTAAAAAGTGAAAGAACGAATCATAATTATTG
CTAAAAAAACCTTAAATGTGCAAGTTGCTGATATTATTTCCGCTAAATTC
ATATCGGTTGCGGTGGATGAATCTACTGATATGTATGATGATGGCTAAAT
ATGTAACATATATTTTGGTGTAGAAAATTGGAAAACATGTTTACCGAAAT
TTGAATAAATTATGCGAGAAACTTCTCAGTACATCATATTCAGTCGCTGG
AACTCATTTCTAACTAGTTATTCAAATACTAGGATGCTTGCTTTTGATCC
TGTTTCATCAATAAACTTTATTAAAAAAATACGTACTTTACCAGACTTAA
TGATGAAAGTCTTTTGGTCTTTAATATAGTAACCGTAGAGAATTTATTTT
TAAAATATCCTAACAAAATGTTTAATTTGATTTGGCTCTTTGTAGGAAAA
AGAATACCCGCCTCTGTACTAGACCAGCTGTGGCCAAAGTGTGGGTCGCG
ATTTCATTTTTGGGGCCGTCAAGTAATTTCATCCACAAACCACATATGGG
GTGGAGTAAAGAAAACCCCACATATGAGTATAAAAAGCAATTGATGGTTT
TCTGTAGACTAATAACATCTATTCCATTAGCGATTATCCTTGTTTTCATT
ACGATTCTCGCAATTTTGGGAAATATATTTCTATTCACTGTTATATGTCA
ATCGAGGAAAGCCCATAAAAAATCCTATTCACATTATCTCACTCTATTGA
CAATCACAGATAGCCTTTCCATACTCTTTCTTCTTAAAGAATTTATCGAA
AGATTCTATCAGAAAACTCACAAAATTAATAATTTATATGAGCAAAGTGA
AATTATGTGCAAATTGGAACATTTTATCAGGTTTTCTTGTTTCTTCATTT
CTGGAATTGCAACCGTTTTTTTGACAGTTGAACGATTTTTGATCGTCTAT
TGGCCCGTAAGAGGTCGTCTATTATGTGGTGGCAATCGGGCACTCATCAT
TATTTTCGGTATTATTGTATTTAGTTGTTCCGCTCAGTCGTTTCGGTTAG
TTTTTGTGGAACAAGATAGTGGCGTATGCGTTTTTAAAATGAATCAAAAA
ATAAATCATTTTATCCTCAGCTGTTATTCTTCTGGTTTGTTTGTATATGT
AATTCCTGCAGTTGTAATTTTGGTCTTTAACATATTAATCCTTATGAAAT
TACAGAAATCTAACAATAAGACCAAATGTCAAAAGTGTGTCAAAGAAAGA
CTGAATGCATTCAACATATTATCGGCTAAATTCTGGAAATCGTTTCGATT
TGGGAAAATGGATTTATCAACTAATCGGCGGCAATTGAATGAATATGATA
GCAGTGGACCTAGTGACAGGAGCACGTCGACGTGTGATGGAAGTGTAGCT
TGCTCTAAATGTCTTTATATGCGACAAGGCTCAGCGAAGTACTATTTGAA
AGTTAAACGGAGAGCTTCCGTTATCCTACTAATGATTTCATTCAGTTATT
TAATTTGCCATGCATGGAATACTGCATTCACTGGGGTTTTCCTTAGATAT
TACTATCTTTATGCAGCAAGGCTTCAAAATGTCTCAGACAATTCAACAGA
AAAGGCTCAACTGAAGGATTCTGTTCTGGGATACTTTAGACGAAAACTTT
GTCTCTATAACGATATTATAGATATGTTCAGCATCATTGGTTATGGAAAC
AATTTCTATATATATTACATTTTTGGGAATATTTTCCGAACAGAATTTGC
AAGGATCTTTCAGAACGTTGGAAGGTCTATACGAAATCGATTTGGAATTT
TTAAAAGCCAAACGAATCAAAAAGATAAATTACGGAAGGTTTCCAAAAAT
TATTCCGTTATACATAAAAATGATTATTTAAAACCCTTGTATTATTATCC
GACATCCGAATGCTGTGTCCATTCCAATTTAGAGCCGAGAAAAATTATAT
ATCAAAAGAATTCTTATCAATCAGTTCGTTCGTGTCCATTAAAGTATCAA
GATAGTTCCCAATCTTCAACGATAAATTATGTTAACATCATTTGTATATA
TTCCAAAATTTCGTCCAATATTTTGTAAAGGAGATTTTCTTTAAATGTTT
ATGTTAACACGAGTCTCTAATACGTTGTATTTGTAAATATGTATTCGAG
back to top

protein sequence of SMED30033769-orf-1

>SMED30033769-orf-1 ID=SMED30033769-orf-1|Name=SMED30033769-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=511bp
MGWSKENPTYEYKKQLMVFCRLITSIPLAIILVFITILAILGNIFLFTVI
CQSRKAHKKSYSHYLTLLTITDSLSILFLLKEFIERFYQKTHKINNLYEQ
SEIMCKLEHFIRFSCFFISGIATVFLTVERFLIVYWPVRGRLLCGGNRAL
IIIFGIIVFSCSAQSFRLVFVEQDSGVCVFKMNQKINHFILSCYSSGLFV
YVIPAVVILVFNILILMKLQKSNNKTKCQKCVKERLNAFNILSAKFWKSF
RFGKMDLSTNRRQLNEYDSSGPSDRSTSTCDGSVACSKCLYMRQGSAKYY
LKVKRRASVILLMISFSYLICHAWNTAFTGVFLRYYYLYAARLQNVSDNS
TEKAQLKDSVLGYFRRKLCLYNDIIDMFSIIGYGNNFYIYYIFGNIFRTE
FARIFQNVGRSIRNRFGIFKSQTNQKDKLRKVSKNYSVIHKNDYLKPLYY
YPTSECCVHSNLEPRKIIYQKNSYQSVRSCPLKYQDSSQSSTINYVNIIC
IYSKISSNIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000204ovary
PLANA:0000205oviduct
PLANA:0000207sperm duct
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity