Actin binding LIM protein family member 2

Overview
NameActin binding LIM protein family member 2
Smed IDSMED30033766
Length (bp)2590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin binding LIM protein family member 2 (SMED30033766) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin binding LIM protein family member 2 (SMED30033766) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin binding LIM protein family member 2 (SMED30033766) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin binding LIM protein family member 2 (SMED30033766) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033766

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033766SMESG000037349.1 dd_Smed_v4_12268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033766SMESG000037349.1 dd_Smed_v4_12268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033766SMESG000037349.1 dd_Smed_v4_12268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033766SMESG000037349.1 dd_Smed_v4_12268_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Human
Match: ABLIM2 (actin binding LIM protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19195])

HSP 1 Score: 111.694 bits (278), Expect = 3.923e-25
Identity = 49/113 (43.36%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V +KYFH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 71.2478 bits (173), Expect = 3.613e-12
Identity = 40/131 (30.53%), Postives = 58/131 (44.27%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A   Y   D   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +FA G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKSCGKLLNAE--YISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Human
Match: ABLIM2 (actin binding LIM protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19195])

HSP 1 Score: 112.079 bits (279), Expect = 4.576e-25
Identity = 49/113 (43.36%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V +KYFH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 71.633 bits (174), Expect = 3.239e-12
Identity = 40/131 (30.53%), Postives = 58/131 (44.27%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A   Y   D   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +FA G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKSCGKLLNAE--YISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Human
Match: ABLIM2 (actin binding LIM protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19195])

HSP 1 Score: 112.464 bits (280), Expect = 4.626e-25
Identity = 49/113 (43.36%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V +KYFH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 72.0182 bits (175), Expect = 2.602e-12
Identity = 40/131 (30.53%), Postives = 58/131 (44.27%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A   Y   D   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +FA G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKSCGKLLNAE--YISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Human
Match: ABLIM2 (actin binding LIM protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19195])

HSP 1 Score: 112.849 bits (281), Expect = 4.818e-25
Identity = 49/113 (43.36%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V +KYFH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 72.4034 bits (176), Expect = 2.477e-12
Identity = 38/130 (29.23%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A  +  ++   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +FA G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKSCGKLLNA-EYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Human
Match: ABLIM2 (actin binding LIM protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19195])

HSP 1 Score: 112.464 bits (280), Expect = 5.009e-25
Identity = 49/113 (43.36%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V +KYFH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 72.0182 bits (175), Expect = 2.660e-12
Identity = 38/130 (29.23%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A  +  ++   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +FA G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKSCGKLLNA-EYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 77.411 bits (189), Expect = 1.882e-15
Identity = 38/101 (37.62%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  102 NKMGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFA 404
            N + K  C +C K  +G V+    K +H   + C +CG  L    F+ RN   +C  DY N+F+ KC  C  AI+   VS +N++FH ECF C  CN  F 
Sbjct:   82 NTIPKGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFG 182          

HSP 2 Score: 62.3882 bits (150), Expect = 2.515e-10
Identity = 29/86 (33.72%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKC 380
            C  C +      + V  K FH  CF C +C +      F+ +N   YC  D+   F  KC  CS  I+S  ++AL  H+H +CF C
Sbjct:  148 CQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVC 233          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 78.1814 bits (191), Expect = 6.406e-15
Identity = 38/101 (37.62%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  102 NKMGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFA 404
            N + K  C +C K  +G V+    K +H   + C +CG  L    F+ RN   +C  DY N+F+ KC  C  AI+   VS +N++FH ECF C  CN  F 
Sbjct:  169 NTIPKGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFG 269          

HSP 2 Score: 68.1662 bits (165), Expect = 9.486e-12
Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVF 401
            C  C +      + V  K FH  CF C +C +      F+ +N   YC  D+   F  KC  CS  I+S  ++AL  H+H +CF C  C + F
Sbjct:  235 CQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSF 327          

HSP 3 Score: 60.4622 bits (145), Expect = 2.936e-9
Identity = 37/140 (26.43%), Postives = 57/140 (40.71%), Query Frame = 3
Query:   96 FYNKMGKIYC------------HSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLS 479
            F+ K G+ YC            + CS+    + +     ++H  CF C+ CG + +  +F+  N    C   Y     + C  C  AI+   V+A+ R FH E F+C  CN     G    +    F C  C N    L+
Sbjct:  273 FHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSFNGASFFEHNGAPLCERHYHESRGSICSQCRGAINGRCVAAMGRKFHPEHFRCSYCNHQLTKGTFKEVDRRPF-CHKCYNNTYALT 411          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 76.6406 bits (187), Expect = 1.400e-14
Identity = 38/101 (37.62%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  102 NKMGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFA 404
            N + K  C +C K  +G V+    K +H   + C +CG  L    F+ RN   +C  DY N+F+ KC  C  AI+   VS +N++FH ECF C  CN  F 
Sbjct:  108 NTIPKGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFG 208          

HSP 2 Score: 66.6254 bits (161), Expect = 2.043e-11
Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVF 401
            C  C +      + V  K FH  CF C +C +      F+ +N   YC  D+   F  KC  CS  I+S  ++AL  H+H +CF C  C + F
Sbjct:  174 CQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSF 266          

HSP 3 Score: 58.9214 bits (141), Expect = 7.451e-9
Identity = 37/140 (26.43%), Postives = 57/140 (40.71%), Query Frame = 3
Query:   96 FYNKMGKIYC------------HSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLS 479
            F+ K G+ YC            + CS+    + +     ++H  CF C+ CG + +  +F+  N    C   Y     + C  C  AI+   V+A+ R FH E F+C  CN     G    +    F C  C N    L+
Sbjct:  212 FHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSFNGASFFEHNGAPLCERHYHESRGSICSQCRGAINGRCVAAMGRKFHPEHFRCSYCNHQLTKGTFKEVDRRPF-CHKCYNNTYALT 350          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Celegans
Match: alp-1 (ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:G5EFG1])

HSP 1 Score: 73.1738 bits (178), Expect = 7.590e-13
Identity = 35/92 (38.04%), Postives = 41/92 (44.57%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISS--EVVSALNRHFHRECFKCGSCN 392
            C+ CSK  + D L   +K +H  CF C  C K     AFY      YC  D+   FT KC  C   I +    V AL   FH  CF C  CN
Sbjct: 1312 CNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLEQGLPYCEQDWNALFTTKCVSCRYPIEAGDRWVEALGNAFHSNCFTCARCN 1403          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Celegans
Match: alp-1 (ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:G5EFG1])

HSP 1 Score: 72.0182 bits (175), Expect = 1.351e-12
Identity = 35/92 (38.04%), Postives = 41/92 (44.57%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISS--EVVSALNRHFHRECFKCGSCN 392
            C+ CSK  + D L   +K +H  CF C  C K     AFY      YC  D+   FT KC  C   I +    V AL   FH  CF C  CN
Sbjct:  659 CNKCSKPIISDCLNALQKKWHPTCFTCAHCQKPFGNSAFYLEQGLPYCEQDWNALFTTKCVSCRYPIEAGDRWVEALGNAFHSNCFTCARCN 750          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082094)

HSP 1 Score: 117.472 bits (293), Expect = 1.113e-26
Identity = 49/130 (37.69%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGS 503
            KIYC  C+KKC G+VL+V + +FH+ CF C  C K+L  G F+ +++ YYC+ DY   +  KC  C   +  EVVS + + +H++CF C  C   F  G++VT   +  LC  C+     +S  ++ TG 
Sbjct:   43 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVTGAP-VSPSRQATGG 171          

HSP 2 Score: 77.411 bits (189), Expect = 3.631e-14
Identity = 102/445 (22.92%), Postives = 173/445 (38.88%), Query Frame = 3
Query:  150 GDVLKVGE------KYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSAL-NRHFHRECFKCGSCNIVFAPGNRVTMKNETFL---CISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPT---SLSSP----IQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKK-----HSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDK----MPSSNAIDFTQSLDHLAINSSQNHQKN------LLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRD 1388
            G++LK G+      + +H  CF CK C   L+ G +  ++   YC   Y   F  KC  CS  IS +V+ A  N HFH  C +C  C   F  G  + ++        C    +E   + N    T S     S         D +S   +++    S  P+   SL S      +     L LR +  P                D  + +  SYL       ++    Y K     H +R +    + +N  S++  R      +   S +   +  +++ +R  T   ++     +  I+L+ YPA +K P      IERDD+PAP       + ++     + G+    + D+       +  +   +    L   + Q  + N      + + ++   K+R   + N D  +ASR+PSAS EP+ K R+      S SR+
Sbjct:  215 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSALSEMYIRSRTPSFNGSLYSSSRKHYRTVSPGLILREYGRPNAE-------------DISRIYTYSYLTDAPHYLRKPIDPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAM---KVLVDA-IRSETPRPKSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPPYPYTDPERRRRYSDTYKGVPASDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRN 641          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0346713)

HSP 1 Score: 117.472 bits (293), Expect = 1.199e-26
Identity = 49/130 (37.69%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGS 503
            KIYC  C+KKC G+VL+V + +FH+ CF C  C K+L  G F+ +++ YYC+ DY   +  KC  C   +  EVVS + + +H++CF C  C   F  G++VT   +  LC  C+     +S  ++ TG 
Sbjct:   27 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVTGA-PVSPSRQATGG 155          

HSP 2 Score: 80.8777 bits (198), Expect = 2.884e-15
Identity = 108/477 (22.64%), Postives = 184/477 (38.57%), Query Frame = 3
Query:  150 GDVLKVGE------KYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSAL-NRHFHRECFKCGSCNIVFAPGNRVTMKNETFL---CISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKK-----HSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDK----MPSSNAIDFTQSLDHLAINSSQNHQKN------LLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRD----STYFNDPNRHFGYSLDFISFTNRSFLVGNVP-YNI 1490
            G++LK G+      + +H  CF CK C   L+ G +  ++   YC   Y   F  KC  CS  IS +V+ A  N HFH  C +C  C   F  G  + ++        C    +E   + N    T S     S         D +S   +++  Y +  P             L LR +  P                D  + +  SYL       ++    Y K     H +R +    + +N  S++  R      +   S +   +  +++ +R  T   ++     +  I+L+ YPA +K P      IERDD+PAP       + ++     + G+    + D+       +  +   +    L   + Q  + N      + + ++   K+R   + N D  +ASR+PSAS EP+ K R+      S SR+      ++ D    F  S  +     +S  +GN P YN+
Sbjct:  199 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSALSEMHYRTVSP------------GLILREYGRPNAE-------------DISRIYTYSYLTDAPHYLRKPIDPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAM---KVLVDA-IRSETPRPKSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPPYPYTDPERRRRYSDTYKGVPASDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQKPFYED--EMFDRSTSYRGSLGKS--LGNAPSYNV 641          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082097)

HSP 1 Score: 117.472 bits (293), Expect = 1.232e-26
Identity = 49/130 (37.69%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGS 503
            KIYC  C+KKC G+VL+V + +FH+ CF C  C K+L  G F+ +++ YYC+ DY   +  KC  C   +  EVVS + + +H++CF C  C   F  G++VT   +  LC  C+     +S  ++ TG 
Sbjct:   38 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVTGAP-VSPSRQATGG 166          

HSP 2 Score: 82.0333 bits (201), Expect = 1.396e-15
Identity = 99/438 (22.60%), Postives = 169/438 (38.58%), Query Frame = 3
Query:  150 GDVLKVGE------KYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSAL-NRHFHRECFKCGSCNIVFAPGNRVTMKNETFL---CISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKK-----HSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDK----MPSSNAIDFTQSLDHLAINSSQNHQKN------LLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRD 1388
            G++LK G+      + +H  CF CK C   L+ G +  ++   YC   Y   F  KC  CS  IS +V+ A  N HFH  C +C  C   F  G  + ++        C    +E   + N    T S     S         D +S   +++  Y +  P             L LR +  P                D  + +  SYL       ++    Y K     H +R +    + +N  S++  R      +   S +   +  +++ +R  T   ++     +  I+L+ YPA +K P      IERDD+PAP       + ++     + G+    + D+       +  +   +    L   + Q  + N      + + ++   K+R   + N D  +ASR+PSAS EP+ K R+      S SR+
Sbjct:  210 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSALSEMHYRTVSP------------GLILREYGRPNAE-------------DISRIYTYSYLTDAPHYLRKPIDPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAM---KVLVDA-IRSETPRPKSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPPYPYTDPERRRRYSDTYKGVPASDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRN 617          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Fly
Match: Unc-115a (gene:FBgn0051352 transcript:FBtr0300565)

HSP 1 Score: 117.472 bits (293), Expect = 1.260e-26
Identity = 49/130 (37.69%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGS 503
            KIYC  C+KKC G+VL+V + +FH+ CF C  C K+L  G F+ +++ YYC+ DY   +  KC  C   +  EVVS + + +H++CF C  C   F  G++VT   +  LC  C+     +S  ++ TG 
Sbjct:   38 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVTGA-PVSPSRQATGG 166          

HSP 2 Score: 78.1814 bits (191), Expect = 2.101e-14
Identity = 102/445 (22.92%), Postives = 173/445 (38.88%), Query Frame = 3
Query:  150 GDVLKVGE------KYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSAL-NRHFHRECFKCGSCNIVFAPGNRVTMKNETFL---CISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPT---SLSSP----IQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKK-----HSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDK----MPSSNAIDFTQSLDHLAINSSQNHQKN------LLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRD 1388
            G++LK G+      + +H  CF CK C   L+ G +  ++   YC   Y   F  KC  CS  IS +V+ A  N HFH  C +C  C   F  G  + ++        C    +E   + N    T S     S         D +S   +++    S  P+   SL S      +     L LR +  P                D  + +  SYL       ++    Y K     H +R +    + +N  S++  R      +   S +   +  +++ +R  T   ++     +  I+L+ YPA +K P      IERDD+PAP       + ++     + G+    + D+       +  +   +    L   + Q  + N      + + ++   K+R   + N D  +ASR+PSAS EP+ K R+      S SR+
Sbjct:  210 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSALSEMYIRSRTPSFNGSLYSSSRKHYRTVSPGLILREYGRPNAE-------------DISRIYTYSYLTDAPHYLRKPIDPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAM---KVLVDA-IRSETPRPKSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPPYPYTDPERRRRYSDTYKGVPASDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRN 636          

HSP 3 Score: 57.7658 bits (138), Expect = 4.669e-8
Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 3
Query: 1926 SFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            S   H+P+    I  Y  L+  + ++   +D   LE +LS  EF  + +  RSEFYRLP+W++N+LKRR+ LF
Sbjct:  770 SMLVHEPAK---IYPYHLLLITNYRLPSDVDRCNLERHLSDIEFEHILQCARSEFYRLPQWRRNELKRRVKLF 839          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Fly
Match: Unc-115a (gene:FBgn0051352 transcript:FBtr0344275)

HSP 1 Score: 117.472 bits (293), Expect = 1.340e-26
Identity = 49/130 (37.69%), Postives = 75/130 (57.69%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGS 503
            KIYC  C+KKC G+VL+V + +FH+ CF C  C K+L  G F+ +++ YYC+ DY   +  KC  C   +  EVVS + + +H++CF C  C   F  G++VT   +  LC  C+     +S  ++ TG 
Sbjct:   43 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVTGA-PVSPSRQATGG 171          

HSP 2 Score: 82.4185 bits (202), Expect = 1.053e-15
Identity = 99/438 (22.60%), Postives = 169/438 (38.58%), Query Frame = 3
Query:  150 GDVLKVGE------KYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSAL-NRHFHRECFKCGSCNIVFAPGNRVTMKNETFL---CISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKK-----HSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDK----MPSSNAIDFTQSLDHLAINSSQNHQKN------LLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRD 1388
            G++LK G+      + +H  CF CK C   L+ G +  ++   YC   Y   F  KC  CS  IS +V+ A  N HFH  C +C  C   F  G  + ++        C    +E   + N    T S     S         D +S   +++  Y +  P             L LR +  P                D  + +  SYL       ++    Y K     H +R +    + +N  S++  R      +   S +   +  +++ +R  T   ++     +  I+L+ YPA +K P      IERDD+PAP       + ++     + G+    + D+       +  +   +    L   + Q  + N      + + ++   K+R   + N D  +ASR+PSAS EP+ K R+      S SR+
Sbjct:  215 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSALSEMHYRTVSP------------GLILREYGRPNAE-------------DISRIYTYSYLTDAPHYLRKPIDPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAM---KVLVDA-IRSETPRPKSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPPYPYTDPERRRRYSDTYKGVPASDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRN 622          

HSP 3 Score: 57.7658 bits (138), Expect = 4.224e-8
Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 3
Query: 1926 SFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            S   H+P+    I  Y  L+  + ++   +D   LE +LS  EF  + +  RSEFYRLP+W++N+LKRR+ LF
Sbjct:  756 SMLVHEPAK---IYPYHLLLITNYRLPSDVDRCNLERHLSDIEFEHILQCARSEFYRLPQWRRNELKRRVKLF 825          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Zebrafish
Match: ablim2 (actin binding LIM protein family, member 2 [Source:ZFIN;Acc:ZDB-GENE-100316-5])

HSP 1 Score: 108.997 bits (271), Expect = 5.873e-24
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G + C +C K C G+VL+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H  CF C +C   F  G+RVT   +  +C  C   +
Sbjct:   24 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCGCDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCTQPV 142          

HSP 2 Score: 63.5438 bits (153), Expect = 8.374e-10
Identity = 29/95 (30.53%), Postives = 48/95 (50.53%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            +K++H  CF CK C K L+A  +  ++   YC  DY   F  +C  C   I+ +V+ A  +H+H  C +C  C+ +F  G  + ++  T     C
Sbjct:  173 DKHWHLGCFKCKVCNKVLNA-EYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYLQGSTIWHPPC 266          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Zebrafish
Match: ablim2 (actin binding LIM protein family, member 2 [Source:ZFIN;Acc:ZDB-GENE-100316-5])

HSP 1 Score: 105.916 bits (263), Expect = 1.651e-23
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G + C +C K C G+VL+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H  CF C +C   F  G+RVT   +  +C  C   +
Sbjct:   17 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCGCDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCTQPV 135          

HSP 2 Score: 60.8474 bits (146), Expect = 4.448e-9
Identity = 31/96 (32.29%), Postives = 47/96 (48.96%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            +K++H  CF CK C K L+A   Y   D   YC  DY   F  +C  C   I+ +V+ A  +H+H  C +C  C+ +F  G  + ++  T     C
Sbjct:  166 DKHWHLGCFKCKVCNKVLNAE--YISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYLQGSTIWHPPC 259          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Zebrafish
Match: ablim2 (actin binding LIM protein family, member 2 [Source:ZFIN;Acc:ZDB-GENE-100316-5])

HSP 1 Score: 106.686 bits (265), Expect = 1.766e-23
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G + C +C K C G+VL+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H  CF C +C   F  G+RVT   +  +C  C   +
Sbjct:   17 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCGCDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCTQPV 135          

HSP 2 Score: 61.6178 bits (148), Expect = 3.175e-9
Identity = 29/95 (30.53%), Postives = 48/95 (50.53%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            +K++H  CF CK C K L+A  +  ++   YC  DY   F  +C  C   I+ +V+ A  +H+H  C +C  C+ +F  G  + ++  T     C
Sbjct:  166 DKHWHLGCFKCKVCNKVLNA-EYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYLQGSTIWHPPC 259          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Zebrafish
Match: BX465192.1 (actin binding LIM protein family, member 2 [Source:NCBI gene;Acc:568454])

HSP 1 Score: 105.531 bits (262), Expect = 3.760e-23
Identity = 48/124 (38.71%), Postives = 65/124 (52.42%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSN 482
            G + C +C K C G+VL+V  K+FH  CF CK C   L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H  CF C +C   F  G+RVT   +  +C  C   +  L++
Sbjct:   17 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCECDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCTQPVRTLTH 140          

HSP 2 Score: 59.6918 bits (143), Expect = 1.053e-8
Identity = 30/96 (31.25%), Postives = 47/96 (48.96%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            +K++H  CF CK C K L+A   Y   D   YC  DY   F  +C  C   I+ +V+ A  +H+H  C +C  C+ +F  G  + ++  +     C
Sbjct:  165 DKHWHLGCFKCKVCNKVLNAE--YISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYLQGSSIWHPPC 258          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Zebrafish
Match: BX465192.1 (actin binding LIM protein family, member 2 [Source:NCBI gene;Acc:568454])

HSP 1 Score: 102.449 bits (254), Expect = 2.017e-22
Identity = 47/119 (39.50%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G + C +C K C G+VL+V  K+FH  CF CK C   L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H  CF C +C   F  G+RVT   +  +C  C   +
Sbjct:   17 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCECDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCTQPV 135          

HSP 2 Score: 59.3066 bits (142), Expect = 1.229e-8
Identity = 30/96 (31.25%), Postives = 47/96 (48.96%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            +K++H  CF CK C K L+A   Y   D   YC  DY   F  +C  C   I+ +V+ A  +H+H  C +C  C+ +F  G  + ++  +     C
Sbjct:  166 DKHWHLGCFKCKVCNKVLNAE--YISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYLQGSSIWHPPC 259          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 96.2857 bits (238), Expect = 6.028e-20
Identity = 42/119 (35.29%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G I C+ C + C G+V++V   +FH  CF C+ C   L    F+F+N  Y C  DY   +  +C  C + I+ EV+SAL R +H +CF C  C   F  G++VT + +  +C +C + +
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCSHSL 134          

HSP 2 Score: 67.3958 bits (163), Expect = 6.422e-11
Identity = 46/170 (27.06%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  111 GKIYCHSCSKKC-VGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETF---LCISCLNEIEKLSNQK----------ENTGSPNDIFSKPIDNSMT--KDLLSDDTI 572
            G  +C  C ++   G  L   EK +H  CF C+ CG  L  G +  ++   YC +DY  +F  KC  C+  IS  V+ A  +H+H  C +C  C  +F+ G  + +        +C       +KL  ++           + GSPN +    ++N +   KDL +   I
Sbjct:  144 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSISPPGSSIGSPNRVICAKVNNEILNYKDLAALPKI 312          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 96.6709 bits (239), Expect = 6.156e-20
Identity = 42/119 (35.29%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G I C+ C + C G+V++V   +FH  CF C+ C   L    F+F+N  Y C  DY   +  +C  C + I+ EV+SAL R +H +CF C  C   F  G++VT + +  +C +C + +
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCSHSL 134          

HSP 2 Score: 67.781 bits (164), Expect = 6.184e-11
Identity = 46/170 (27.06%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  111 GKIYCHSCSKKC-VGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETF---LCISCLNEIEKLSNQK----------ENTGSPNDIFSKPIDNSMT--KDLLSDDTI 572
            G  +C  C ++   G  L   EK +H  CF C+ CG  L  G +  ++   YC +DY  +F  KC  C+  IS  V+ A  +H+H  C +C  C  +F+ G  + +        +C       +KL  ++           + GSPN +    ++N +   KDL +   I
Sbjct:  144 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSISPPGSSIGSPNRVICAKVNNEILNYKDLAALPKI 312          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 95.9005 bits (237), Expect = 7.586e-20
Identity = 42/115 (36.52%), Postives = 64/115 (55.65%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            G I C+ C + C G+V++V   +FH  CF C+ C   L    F+F+N  Y C  DY   +  +C  C + I+ EV+SAL R +H +CF C  C   F  G++VT + +  +C +C
Sbjct:   18 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNC 132          

HSP 2 Score: 65.0846 bits (157), Expect = 3.001e-10
Identity = 48/185 (25.95%), Postives = 80/185 (43.24%), Query Frame = 3
Query:  111 GKIYCHSCSKKC-VGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETF---LCISCLNEIEKLSNQKE----------NTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPI 623
            G  +C  C ++   G  L   EK +H  CF C+ CG  L  G +  ++   YC +DY  +F  KC  C+  IS  V+ A  +H+H  C +C  C  +F+ G  + +        +C       +KL  ++           + GSPN +       S  +D+   + I  +   S+ P  + SP+
Sbjct:  146 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSISPPGSSIGSPNRVICMLERYSYGEDIY--EGIDLRQRRSSSPGYIDSPL 327          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 96.2857 bits (238), Expect = 7.934e-20
Identity = 42/119 (35.29%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G I C+ C + C G+V++V   +FH  CF C+ C   L    F+F+N  Y C  DY   +  +C  C + I+ EV+SAL R +H +CF C  C   F  G++VT + +  +C +C + +
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCSHSL 134          

HSP 2 Score: 67.3958 bits (163), Expect = 7.168e-11
Identity = 46/170 (27.06%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  111 GKIYCHSCSKKC-VGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETF---LCISCLNEIEKLSNQK----------ENTGSPNDIFSKPIDNSMT--KDLLSDDTI 572
            G  +C  C ++   G  L   EK +H  CF C+ CG  L  G +  ++   YC +DY  +F  KC  C+  IS  V+ A  +H+H  C +C  C  +F+ G  + +        +C       +KL  ++           + GSPN +    ++N +   KDL +   I
Sbjct:  144 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSISPPGSSIGSPNRVICAKVNNEILNYKDLAALPKI 312          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 95.5153 bits (236), Expect = 8.496e-20
Identity = 42/119 (35.29%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G I C+ C + C G+V++V   +FH  CF C+ C   L    F+F+N  Y C  DY   +  +C  C + I+ EV+SAL R +H +CF C  C   F  G++VT + +  +C +C + +
Sbjct:   18 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCSHSL 136          

HSP 2 Score: 64.3142 bits (155), Expect = 5.752e-10
Identity = 34/106 (32.08%), Postives = 53/106 (50.00%), Query Frame = 3
Query:  111 GKIYCHSCSKKC-VGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTM 425
            G  +C  C ++   G  L   EK +H  CF C+ CG  L  G +  ++   YC +DY  +F  KC  C+  IS  V+ A  +H+H  C +C  C  +F+ G  + +
Sbjct:  146 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYL 250          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 112.079 bits (279), Expect = 1.071e-24
Identity = 52/131 (39.69%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            I+CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N +Y C  DY   +  +C  C   +  EVV+AL + +H  CF C  C   F PG+RVT      LC  C   +   S+ KE + S N
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMS--SSPKEASCSSN 225          

HSP 2 Score: 75.8702 bits (185), Expect = 1.464e-13
Identity = 43/137 (31.39%), Postives = 62/137 (45.26%), Query Frame = 3
Query:  129 SCSKKCVG--------DVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDI 515
            SCS  C G          L   +K +H  CF CK CGK L  G +  ++ + YC  DY   F  KC  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     K S + E    P +I
Sbjct:  221 SCSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDC-----KQSTKTEEKLRPPNI 351          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 105.145 bits (261), Expect = 1.414e-24
Identity = 52/131 (39.69%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            I+CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N +Y C  DY   +  +C  C   +  EVV+AL + +H  CF C  C   F PG+RVT      LC  C   +   S+ KE + S N
Sbjct:   20 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMS--SSPKEASCSSN 148          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 105.916 bits (263), Expect = 1.547e-24
Identity = 52/131 (39.69%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            I+CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N +Y C  DY   +  +C  C   +  EVV+AL + +H  CF C  C   F PG+RVT      LC  C   +   S+ KE + S N
Sbjct:   44 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMS--SSPKEASCSSN 172          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 110.923 bits (276), Expect = 1.800e-24
Identity = 52/131 (39.69%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            I+CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N +Y C  DY   +  +C  C   +  EVV+AL + +H  CF C  C   F PG+RVT      LC  C   +   S+ KE + S N
Sbjct:   34 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMS--SSPKEASCSSN 162          

HSP 2 Score: 75.485 bits (184), Expect = 2.156e-13
Identity = 43/137 (31.39%), Postives = 62/137 (45.26%), Query Frame = 3
Query:  129 SCSKKCVG--------DVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDI 515
            SCS  C G          L   +K +H  CF CK CGK L  G +  ++ + YC  DY   F  KC  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     K S + E    P +I
Sbjct:  158 SCSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDC-----KQSTKTEEKLRPPNI 288          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Mouse
Match: Ablim2 (actin-binding LIM protein 2 [Source:MGI Symbol;Acc:MGI:2385758])

HSP 1 Score: 110.153 bits (274), Expect = 1.848e-24
Identity = 48/113 (42.48%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V  KYFH  CF CK CG  L  G F+ R   + C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 70.4774 bits (171), Expect = 5.193e-12
Identity = 39/131 (29.77%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A   Y   D   YC  DY ++F  +C  C   I+  V+ A  +H+H  C  C  C  +F+ G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKTCGKLLNAE--YISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. UniProt/SwissProt
Match: sp|Q6H8Q1|ABLM2_HUMAN (Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 2.406e-24
Identity = 49/113 (43.36%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V +KYFH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 72.0182 bits (175), Expect = 1.278e-11
Identity = 38/130 (29.23%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A  +  ++   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +FA G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKSCGKLLNA-EYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. UniProt/SwissProt
Match: sp|Q8K4G5|ABLM1_MOUSE (Actin-binding LIM protein 1 OS=Mus musculus OX=10090 GN=Ablim1 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 8.167e-24
Identity = 52/131 (39.69%), Postives = 70/131 (53.44%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            I+CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N +Y C  DY   +  +C  C   +  EVV+AL + +H  CF C  C   F PG+RVT      LC  C   +   S+ KE + S N
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMS--SSPKEASCSSN 225          

HSP 2 Score: 75.8702 bits (185), Expect = 1.069e-12
Identity = 43/137 (31.39%), Postives = 62/137 (45.26%), Query Frame = 3
Query:  129 SCSKKCVG--------DVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDI 515
            SCS  C G          L   +K +H  CF CK CGK L  G +  ++ + YC  DY   F  KC  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     K S + E    P +I
Sbjct:  221 SCSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDC-----KQSTKTEEKLRPPNI 351          
BLAST of Actin binding LIM protein family member 2 vs. UniProt/SwissProt
Match: sp|O14639|ABLM1_HUMAN (Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 8.537e-24
Identity = 53/131 (40.46%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            I+CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N  Y C  DY   +  +C  C   +  EVV+AL + +H  CF C  C   F PG+RVT      LC  C   +   S+ KE T S N
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMS--SSPKETTFSSN 225          

HSP 2 Score: 77.411 bits (189), Expect = 3.129e-13
Identity = 48/170 (28.24%), Postives = 76/170 (44.71%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKP---IDNSMTKDLLS--DDTITDQGYMSADPTSLSSPIQVEEDDL 644
            G  L   +K +H  CF CK CGK L  G +  ++   YC  DY   F  KC  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C    +     +    S   I+S+P   I  S    + +  D+ I D   ++A P  + +   +E  DL
Sbjct:  236 GQALLALDKQWHLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIP-KVKAIYDIERPDL 403          
BLAST of Actin binding LIM protein family member 2 vs. UniProt/SwissProt
Match: sp|Q8BL65|ABLM2_MOUSE (Actin-binding LIM protein 2 OS=Mus musculus OX=10090 GN=Ablim2 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.293e-23
Identity = 48/113 (42.48%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V  KYFH  CF CK CG  L  G F+ R   + C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKC 134          

HSP 2 Score: 70.4774 bits (171), Expect = 3.633e-11
Identity = 39/131 (29.77%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A   Y   D   YC  DY ++F  +C  C   I+  V+ A  +H+H  C  C  C  +F+ G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKTCGKLLNAE--YISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. UniProt/SwissProt
Match: sp|Q6KC51|ABLM2_RAT (Actin-binding LIM protein 2 OS=Rattus norvegicus OX=10116 GN=Ablim2 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.648e-22
Identity = 47/113 (41.59%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            I C++C   C G+VL+V  K+FH  CF CK CG  L  G F+ R   + C  DY   +  +CF C   I  EVVSAL + +H +CF C  C + F PG+RVT   +  +C  C
Sbjct:   22 ILCNTCGNVCKGEVLRVQNKHFHIRCFVCKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDCFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKDCMCQKC 134          

HSP 2 Score: 70.0922 bits (170), Expect = 4.870e-11
Identity = 37/130 (28.46%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNS 539
            G  L   +K++H  CF CK CGK L+A  +  ++   YC  DY  +F  +C  C   I+  V+ A  +H+H  C  C  C  +F+ G  + ++  +    +C          KE   S   I S P  ++
Sbjct:  163 GQALVALDKHWHLGCFKCKTCGKLLNA-EYISKDGLPYCEADYHTKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASST 291          
BLAST of Actin binding LIM protein family member 2 vs. TrEMBL
Match: A0A267DES0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024368g1 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.175e-35
Identity = 109/364 (29.95%), Postives = 168/364 (46.15%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVT-MKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSP--IQVEEDDLKLRSFKEPALRNLRLQSNTS-------------RSLFDFGK-FFKSSYLXXXXXXXXXXXX--XYKKHSNRSTHSFLSNTN----QH------SISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQN 1118
            K+YC +C K+C G+VL+V EKY H+ CF C  C   L+ G F+ R   +YC +DY   F  +C IC+  ++ EV++AL   FH  CFKC SC+  FAPG+RVT   N+ +LC +C     + ++   N             N   +  L  D+    G  S+ P S + P  +  ++      SF  P+   L  +   S             R    FG      SYL +++  E+      +Y++ ++ S    ++ +     QH       +S +  + S+    GSV  G      S  R   S+S    +  D+ + L+ YP G K   + P PIERD+WPAP  S++LL E   R + 
Sbjct:    8 KVYCIACQKRCKGEVLRVQEKYMHRDCFKCAACSVGLEKGGFFVREAKFYCPDDYQKLFGVRCRICTEYVTGEVITALGSTFHPRCFKCQSCDSPFAPGDRVTQWSNQLYLCKACSQRTGRAASSVSN------------GNGHHQRALDSDSTVAGGASSSTPLSRAYPQHLAYQQHQHSPTSFSCPSESGLGDRGGGSSSIIGGSGSVVHRRFPSGFGSHLLARSYLSMEQETEQRTHPNDRYRRTTSPSVCGSVTGSGAPSPQHFHLPPSRVSRQASLASRSTHPGSVAAG-----GSGRRTPRSLSP---SPGDDPLLLSLYPGGSKPDLSRPAPIERDNWPAPAFSSLLLAELGRRHRG 351          
BLAST of Actin binding LIM protein family member 2 vs. TrEMBL
Match: Q5DH95 (SJCHGC07563 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.434e-35
Identity = 66/168 (39.29%), Postives = 95/168 (56.55%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSL 611
            MGKIYC  C +KC GDVL+V  KYFH+ CF C  C K L+ G F+ ++  +YC +DY   F  KC +CS  ++ EVV+ALN  FHR CFKC  C+  F PG+RVT+  E F C  C+++I       +   S  ++   P+  +  +  +S   +    Y+   PT +
Sbjct:    1 MGKIYCEKCRQKCRGDVLRVSSKYFHKDCFKCTKCNKNLEHGGFFMKDGGFYCEDDYQRYFVAKCKVCSENLTGEVVTALNFSFHRGCFKCNKCSTTFCPGDRVTVWQEKFYCPRCIDQIYSAETSGDGV-SKKNLLQTPLSVTDDEGCVSASDMASSQYIRERPTEV 167          
BLAST of Actin binding LIM protein family member 2 vs. TrEMBL
Match: A0A1I8HQ07 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016676g1 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 5.807e-35
Identity = 109/364 (29.95%), Postives = 168/364 (46.15%), Query Frame = 3
Query:  114 KIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVT-MKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSP--IQVEEDDLKLRSFKEPALRNLRLQSNTS-------------RSLFDFGK-FFKSSYLXXXXXXXXXXXX--XYKKHSNRSTHSFLSNTN----QH------SISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQN 1118
            K+YC +C K+C G+VL+V EKY H+ CF C  C   L+ G F+ R   +YC +DY   F  +C IC+  ++ EV++AL   FH  CFKC SC+  FAPG+RVT   N+ +LC +C     + ++   N             N   +  L  D+    G  S+ P S + P  +  ++      SF  P+   L  +   S             R    FG      SYL +++  E+      +Y++ ++ S    ++ +     QH       +S +  + S+    GSV  G      S  R   S+S    +  D+ + L+ YP G K   + P PIERD+WPAP  S++LL E   R + 
Sbjct:    8 KVYCIACQKRCKGEVLRVQEKYMHRDCFKCAACSVGLEKGGFFVREAKFYCPDDYQKLFGVRCRICTEYVTGEVITALGSTFHPRCFKCQSCDSPFAPGDRVTQWSNQLYLCKACSQRTGRAASSVSN------------GNGHHQRALDSDSTVAGGASSSTPLSRAYPQHLAYQQHQHSPTSFSCPSESGLGDRGGGSSSIIGGSGSVVHRRFPSGFGSHLLARSYLSMEQETEQRTHPNDRYRRTTSPSVCGSVTGSGAPSPQHFHLPPSRVSRQASLASRSTHPGSVAAG-----GSGRRTPRSLSP---SPGDDPLLLSLYPGGSKPDLSRPAPIERDNWPAPAFSSLLLAELGRRHRG 351          
BLAST of Actin binding LIM protein family member 2 vs. TrEMBL
Match: A0A5K4FA43 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.108e-34
Identity = 63/120 (52.50%), Postives = 82/120 (68.33%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            MGKIYC  C +KC GDVLKV  KYFH+ CF C +C K+L+ G F+ ++  +YC +DY   F  KC ICS  ++ EVV+ALN  FHR CFKC  C+I F PG+RVT+  E F C  C+N++
Sbjct:    1 MGKIYCDKCRRKCRGDVLKVSNKYFHKDCFKCTECNKSLEHGGFFVKDGGFYCQDDYRRYFVAKCKICSEDLTGEVVTALNFSFHRGCFKCNKCSITFRPGDRVTVWQEKFYCPHCINQV 120          

HSP 2 Score: 73.559 bits (179), Expect = 1.926e-9
Identity = 64/212 (30.19%), Postives = 93/212 (43.87%), Query Frame = 3
Query:  990 KLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQE-------KKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHL--AINSSQNH----QKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRD-------STYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKL 1565
            KLA  PAG++   + P PIER DWPAP +S V+L E       ++  +    G     ++D + S  A+    S D +   I+ S  H    Q  L E  ++  K R+  +   D +SASR+P+AS EP  KPR++ H     +R        +   N P  H  +  +     N S    N P    G             +KPGYT G+L
Sbjct:  464 KLACLPAGQERDKSTPRPIERYDWPAPPASGVVLAELMRERRQRRREQARLSGTQFSGDIDDLESQEALSIDYSFDGIPDTIDHSVEHIGIGQAILREEAES--KRRSRSQTYLDPVSASRTPNASVEPSFKPRYATHQFALTNRGTISPGTTTVTMNIPTDHHHHHQN-----NASRYNTNPPTLTLGS-----------SIKPGYTGGQL 657          

HSP 3 Score: 71.633 bits (174), Expect = 6.158e-9
Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = 3
Query: 1881 GRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            G S  +  I+   + S  SHK    P +I Y  L        + +D   +ET+LS EEF ++F L+R+ FYRLPEWK+NDLKRR  LF
Sbjct:  803 GSSPSHPTIQLSSSPSAISHKKPSLPQLIPYEKLKEYRGIYPKGIDRTAVETHLSDEEFQQVFALSRTAFYRLPEWKRNDLKRRAQLF 890          
BLAST of Actin binding LIM protein family member 2 vs. TrEMBL
Match: A0A5K4F807 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.390e-34
Identity = 63/120 (52.50%), Postives = 82/120 (68.33%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            MGKIYC  C +KC GDVLKV  KYFH+ CF C +C K+L+ G F+ ++  +YC +DY   F  KC ICS  ++ EVV+ALN  FHR CFKC  C+I F PG+RVT+  E F C  C+N++
Sbjct:    1 MGKIYCDKCRRKCRGDVLKVSNKYFHKDCFKCTECNKSLEHGGFFVKDGGFYCQDDYRRYFVAKCKICSEDLTGEVVTALNFSFHRGCFKCNKCSITFRPGDRVTVWQEKFYCPHCINQV 120          

HSP 2 Score: 82.4185 bits (202), Expect = 3.261e-12
Identity = 72/234 (30.77%), Postives = 108/234 (46.15%), Query Frame = 3
Query:  990 KLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQE-------KKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHL--AINSSQNH----QKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRH-FGYSLDFISFTNRSFLVG--------------------NVPYNIYGKPQYKS----LVQPVVKL----KPGYTQGKL 1565
            KLA  PAG++   + P PIER DWPAP +S V+L E       ++  +    G     ++D + S  A+    S D +   I+ S  H    Q  L E  ++  K R+  +   D +SASR+P+AS EP  KPR++ H   S SR  +      +H  GYS++FI   NR++ +G                    N+P + +   Q  +       P + L    KPGYT G+L
Sbjct:  464 KLACLPAGQERDKSTPRPIERYDWPAPPASGVVLAELMRERRQRRREQARLSGTQFSGDIDDLESQEALSIDYSFDGIPDTIDHSVEHIGIGQAILREEAES--KRRSRSQTYLDPVSASRTPNASVEPSFKPRYATHQFASASRHRSSSPARYKHPIGYSMEFIHLGNRNWTLGRSQTLTNRGTISPGTTTVTMNIPTDHHHHHQNNASRYNTNPPTLTLGSSIKPGYTGGQL 695          

HSP 3 Score: 71.2478 bits (173), Expect = 8.046e-9
Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = 3
Query: 1881 GRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            G S  +  I+   + S  SHK    P +I Y  L        + +D   +ET+LS EEF ++F L+R+ FYRLPEWK+NDLKRR  LF
Sbjct:  841 GSSPSHPTIQLSSSPSAISHKKPSLPQLIPYEKLKEYRGIYPKGIDRTAVETHLSDEEFQQVFALSRTAFYRLPEWKRNDLKRRAQLF 928          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Cavefish
Match: ablim2 (actin binding LIM protein family, member 2 [Source:ZFIN;Acc:ZDB-GENE-100316-5])

HSP 1 Score: 103.605 bits (257), Expect = 2.928e-23
Identity = 49/119 (41.18%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  111 GKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            G I C +C K C G+VL+V  K+FH  CF CK CG  L  G F+ R   + C  DY   +  +CF C   I  EVVSAL + +H  CF C SC   F  G+RVT   +  +C +C   +
Sbjct:   31 GPIPCQNCGKACKGEVLRVQNKHFHIKCFVCKVCGCDLAQGGFFVRQGEFICTLDYQRLYGTRCFSCEQFIEGEVVSALGKTYHPRCFVCASCKQPFPAGDRVTFNGKECICQNCTQPL 149          

HSP 2 Score: 53.9138 bits (128), Expect = 4.935e-7
Identity = 28/88 (31.82%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKN 431
            +K++H  CF CK C K L+A   Y   D   YC  DY   +  +C  C   I+ +V+ A ++H+H  C +C  C  +F  G  + ++ 
Sbjct:  171 DKHWHLGCFKCKVCNKVLNAE--YISKDGIPYCEMDYHAMYGIQCENCKKYITGKVLEAGDKHYHPTCARCVRCEQMFGEGEEMYLQG 256          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 100.523 bits (249), Expect = 2.345e-21
Identity = 44/117 (37.61%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C+ C + C G+VL+V  ++FH  CF CK CG  L  G F+ +N  Y C  DY      +C  C + +  EVV+AL + +H  CF C  C   F  G+RVT   +  LC  C+  +
Sbjct:   20 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCVQPM 136          

HSP 2 Score: 73.9442 bits (180), Expect = 4.607e-13
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC-----LNEIEKLSNQK-ENTGSPNDIF 518
            G  L   ++ +H  CF CK CGK L +G +  ++   YC  DY   F  +C  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     ++E  + ++Q+     SP DIF
Sbjct:  159 GQALLALDRQWHLGCFKCKACGKVL-SGEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEKHRAASQRLGRKPSPLDIF 286          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 100.523 bits (249), Expect = 2.482e-21
Identity = 44/117 (37.61%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C+ C + C G+VL+V  ++FH  CF CK CG  L  G F+ +N  Y C  DY      +C  C + +  EVV+AL + +H  CF C  C   F  G+RVT   +  LC  C+  +
Sbjct:   23 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCVQPM 139          

HSP 2 Score: 73.9442 bits (180), Expect = 4.740e-13
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC-----LNEIEKLSNQK-ENTGSPNDIF 518
            G  L   ++ +H  CF CK CGK L +G +  ++   YC  DY   F  +C  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     ++E  + ++Q+     SP DIF
Sbjct:  162 GQALLALDRQWHLGCFKCKACGKVL-SGEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEKHRAASQRLGRKPSPLDIF 289          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 100.523 bits (249), Expect = 2.658e-21
Identity = 44/117 (37.61%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C+ C + C G+VL+V  ++FH  CF CK CG  L  G F+ +N  Y C  DY      +C  C + +  EVV+AL + +H  CF C  C   F  G+RVT   +  LC  C+  +
Sbjct:   23 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCVQPM 139          

HSP 2 Score: 73.9442 bits (180), Expect = 4.842e-13
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC-----LNEIEKLSNQK-ENTGSPNDIF 518
            G  L   ++ +H  CF CK CGK L +G +  ++   YC  DY   F  +C  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     ++E  + ++Q+     SP DIF
Sbjct:  162 GQALLALDRQWHLGCFKCKACGKVL-SGEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEKHRAASQRLGRKPSPLDIF 289          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 100.523 bits (249), Expect = 2.745e-21
Identity = 44/117 (37.61%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C+ C + C G+VL+V  ++FH  CF CK CG  L  G F+ +N  Y C  DY      +C  C + +  EVV+AL + +H  CF C  C   F  G+RVT   +  LC  C+  +
Sbjct:   23 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCVQPM 139          

HSP 2 Score: 73.9442 bits (180), Expect = 5.133e-13
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC-----LNEIEKLSNQK-ENTGSPNDIF 518
            G  L   ++ +H  CF CK CGK L +G +  ++   YC  DY   F  +C  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T     C     ++E  + ++Q+     SP DIF
Sbjct:  162 GQALLALDRQWHLGCFKCKACGKVL-SGEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEKHRAASQRLGRKPSPLDIF 289          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Sea Lamprey
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 104.375 bits (259), Expect = 3.227e-23
Identity = 43/117 (36.75%), Postives = 65/117 (55.56%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I CH CS+ C G+ L+V +++FH  CF CK CG  L    F+ ++  Y C +DY  +   +C  C + +  EVV+AL + +H +CF C  C   F  G+RVT   +  LC  C+  +
Sbjct:   12 ILCHKCSEPCKGEALRVQDRHFHIKCFICKVCGCDLAQNGFFMKSGEYLCTHDYQQQHGTRCTGCGDFVEGEVVTALGKTYHPQCFVCAVCRCPFPAGDRVTFNGKDCLCQRCIQPV 128          

HSP 2 Score: 70.8626 bits (172), Expect = 7.978e-13
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPN 509
            G  L   +K +H  CF CK CGK L  G +  ++   YC  DY ++F  KC  C   I+ +V+ A  +H+H  C +C  C  +F+ G  + M+  +     C    ++    +E   +PN
Sbjct:  151 GQALLALDKQWHLGCFKCKTCGKVL-TGEYISKDGVPYCEQDYQSQFGIKCEECGKFITGKVLEAGEKHYHPSCARCVRCKQMFSEGEEMFMQGSSIWHPEC----KRAERAEEKQKTPN 265          

HSP 3 Score: 48.9062 bits (115), Expect = 5.072e-6
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 3
Query: 1998 KILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            K+ R +D  +LE +LS EEF  +F +   EF RL  WK+NDLK++  LF
Sbjct:  748 KLPRDVDRARLERHLSPEEFDNIFGMTIQEFDRLALWKKNDLKKKARLF 796          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006267.1 (pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 gene:ENSPMAG00000005668.1 transcript:ENSPMAT00000006267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 2.584e-22
Identity = 50/137 (36.50%), Postives = 65/137 (47.45%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKL----SNQKENTGSPNDI 515
            I+C+ C   C G+VL+V  ++FH  CF CK CG  L    F+ +N  Y C  DY   +  +C  C + +  EVV+AL R +H  CF C  C   F  G RVT      LC  C   I  +    SN     G   DI
Sbjct:   23 IHCYKCRDLCRGEVLRVENRHFHVSCFTCKVCGCDLAQCGFFVKNGEYVCTLDYQRLYGTRCQACGDFVEGEVVTALGRTYHPRCFVCSVCRQPFPSGARVTFNGRECLCHECTQPISPVLRDPSNPSNCAGCGRDI 159          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.009e-11
Identity = 31/114 (27.19%), Postives = 50/114 (43.86%), Query Frame = 3
Query:   96 FYNKMGKIYCHSC------------SKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISS--EVVSALNRHFHRECFKCGSCNI 395
            F  + G +YC +C             KK +G+++    + +H  CF C  CGK      F+  +   YC  DY   F+ KC  C   + +  + + AL   +H  CF C  C++
Sbjct:  457 FVEEQGNVYCETCYEKYFAPDCAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPFGNSLFHMEDGEPYCEKDYVVLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHV 570          

HSP 2 Score: 60.077 bits (144), Expect = 1.539e-9
Identity = 31/94 (32.98%), Postives = 38/94 (40.43%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFA 404
            C  C++   G  L    K +H   FNC  C  TL    F     N YC   Y   F   C  C   I  E++ AL + +H  CF C SC   F 
Sbjct:  419 CGQCNQIIRGPFLVALGKSWHPAEFNCAQCHTTLTETGFVEEQGNVYCETCYEKYFAPDCAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPFG 512          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 62.003 bits (149), Expect = 3.502e-10
Identity = 32/99 (32.32%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFA 404
            + K  C +C K   G V+    + +H   F C +C + + A  F+ R+   YC  DY   F+ +C  CS  I  +VV+AL++ +H E F C  C   F 
Sbjct:  317 LAKGQCAACLKPIAGQVVTAMGRTWHPEHFVCTECQEEIGARNFFERDGLPYCEKDYHFLFSPRCAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFFG 415          

HSP 2 Score: 60.077 bits (144), Expect = 1.344e-9
Identity = 33/106 (31.13%), Postives = 47/106 (44.34%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETF 440
            C  CS   +  V+   +K +H   F C  CG       F+ ++   YC  DY   F  KC  CS AI    +SAL+  +H ECF C  C   F  G+    + + +
Sbjct:  381 CAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFFGDEGFHEKDGKPYCRQDYFEMFAPKCGGCSRAIVENYISALSALWHPECFVCRECFTPFINGSFFEHEGQPY 486          

HSP 3 Score: 52.7582 bits (125), Expect = 2.865e-7
Identity = 30/110 (27.27%), Postives = 45/110 (40.91%), Query Frame = 3
Query:   96 FYNKMGKIYCH------------SCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSC 389
            F+ K GK YC              CS+  V + +      +H  CF C++C      G+F+      YC   Y  R  + C  C   I+   ++A+ + FH E F C  C
Sbjct:  419 FHEKDGKPYCRQDYFEMFAPKCGGCSRAIVENYISALSALWHPECFVCRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFC 528          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 56.225 bits (134), Expect = 4.822e-9
Identity = 31/95 (32.63%), Postives = 44/95 (46.32%), Query Frame = 3
Query:  156 VLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETF 440
            V+   ++ +H   F C  CG+      F+ R+   YC  DY   F  KC  CS AI    +SALN  +H ECF C  C   F  G+    + + +
Sbjct:   63 VVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCSRAIMQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPY 157          

HSP 2 Score: 48.521 bits (114), Expect = 2.245e-6
Identity = 28/97 (28.87%), Postives = 42/97 (43.30%), Query Frame = 3
Query:   99 YNKMGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSC 389
            Y  M    C+ CS+  + + L      +H  CF C++C      G+F+      YC   Y  R  + C  C   I+   +SA+ + FH E F C  C
Sbjct:  103 YYGMFAPKCNGCSRAIMQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITGRCISAMAKKFHPEHFVCAFC 199          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 50.0618 bits (118), Expect = 1.551e-6
Identity = 29/100 (29.00%), Postives = 40/100 (40.00%), Query Frame = 3
Query:  123 CHSCSKKCVGD------VLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDN-----YYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSC 389
            C  C+K  + D       LK   KY+H+ CF C+DC K L    F ++ D        C  DY  R    C +C   +     +A    +  E F C  C
Sbjct:   28 CARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYFRRHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSCTIC 127          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Nematostella
Match: EDO43201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ98])

HSP 1 Score: 88.5817 bits (218), Expect = 2.093e-19
Identity = 39/118 (33.05%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLN 461
            + ++ C  C+K C G+ L     Y+H+ C  C  CG+ L +  FY   + YYC +DY N++  KC  C   +  E++S   ++FH  CF C SC   F P +++      +LC +C N
Sbjct:    2 IAEVLCRKCTKPCSGEALLHENAYYHENCLCCSVCGQGLRSKPFYVMGEQYYCKDDYQNQYGKKCDSCQLYLEGEIISIHGKNFHEACFACNSCRQPFPPSDKIIFTGTDYLCQTCNN 119          

HSP 2 Score: 60.077 bits (144), Expect = 9.125e-10
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  102 NKMGKIYCHSCSKKCVG-DVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMK-NETF 440
            N M  + C  C +   G   L   EK +H  CF+C  C   L +  +   +   YC  DY   F   C  C+  I+ +V+ A N+H+H +C +C  CN +F  G  + ++ NE +
Sbjct:  143 NGMANVACAGCGEAIKGSQALLALEKQWHLWCFSCTKC-HCLLSLEYMGMDGKPYCEKDYQELFGVTCAACNGYITGKVLQAGNKHYHPKCSRCARCNNIFGEGEEMFLQGNEIW 256          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Nematostella
Match: EDO44183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWK9])

HSP 1 Score: 73.559 bits (179), Expect = 1.904e-13
Identity = 43/126 (34.13%), Postives = 61/126 (48.41%), Query Frame = 3
Query:  120 YCHSCSKKCVGDVLKVG-EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFA-PGNRVTMKNETFLCISCLN-EIEKLSNQK 488
            YC +C + C+    K    K FH  CF C  C + L    FY R    YC  DY ++F + C IC++ I+  V+   +  FH ECF C  C+   A   N V ++    LC +C N E E L + +
Sbjct:   10 YCATCGEPCIKTEYKYAIGKRFHNACFRCVVCEERLSTD-FYARGSELYCKKDYLSKFNSVCHICAHNIAGLVMVIGDHKFHTECFHCQHCDSFLAVDDNYVMVERHRLLCGNCYNKETEALESTQ 134          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Nematostella
Match: EDO39581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J0])

HSP 1 Score: 59.6918 bits (143), Expect = 7.572e-10
Identity = 41/140 (29.29%), Postives = 64/140 (45.71%), Query Frame = 3
Query:  123 CHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDN-YYCLNDYTNRFTNKCFICSNAISSE-------VVSALNRHFHRECFKCGSCNIVFAP---GNRVTMKNETFLCISC-LNEIEKLSNQKENTGSP 506
            C  C +     +L+   K FH  CFNC++C K LD   F   N N  +CL DY  +++ +C  C   I  E        + ++N+ FH  C+KC  CN   +    G+     +   LC  C   +I+KL+ + +    P
Sbjct:   96 CWYCHQHITDRILRATGKCFHPHCFNCEECHKNLDGVPFTLDNFNKVHCLEDYYRKYSPRCASCHQLILPEDGQDETVRIVSMNKDFHVRCYKCEDCNKQLSSEKGGSGCYPLDGHLLCQDCNAKKIQKLTAELDKPPRP 235          

HSP 2 Score: 51.6026 bits (122), Expect = 4.154e-7
Identity = 29/92 (31.52%), Postives = 42/92 (45.65%), Query Frame = 3
Query:  123 CHSCSKKCVGDV--LKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCN 392
            C  C +K  G+       +K FH  CF C  CG  L    FY  +++ YC  DY +     C+ C   I+  ++ A  + FH  CF C  C+
Sbjct:   36 CSKCGQKVSGEGTGCTAMDKLFHIKCFICVKCGCQLTGKVFYKVDNDAYCEADYLDSLET-CWYCHQHITDRILRATGKCFHPHCFNCEECH 126          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 60.4622 bits (145), Expect = 8.998e-10
Identity = 37/130 (28.46%), Postives = 57/130 (43.85%), Query Frame = 3
Query:  144 CVGDVLKVGEKY---------FHQICFNCKDCGKTLDAGAFYF-RNDNYYCLNDYTNRFTNKCFICSNAISSE--VVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENT 497
            CVG   ++ ++Y         +H  C  C DC   LD     F R    YC  DY   F  KC  CS   S    V+ A N+ +H +CF+C +C+    PG+   ++ +   C +    +EK +   + T
Sbjct:   17 CVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRLFGTKCAKCSLNFSKNDFVMRARNKIYHIDCFRCVACSRQLVPGDEFALREDGLFCKADHEIVEKATATAQAT 146          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 58.5362 bits (140), Expect = 2.546e-9
Identity = 53/182 (29.12%), Postives = 83/182 (45.60%), Query Frame = 3
Query:  159 LKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNY-YCLNDYTNRFT-NKCFICSNAISSE--VVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSD-DTITDQGY-MSADPTSLSSPIQVEEDDLKLRSFKEPALRNLR 686
            L   ++ +H  C  C DC   LD     F  D    C  DY  RF+  KC  CS AISS+  V+ A ++ +H  CF C  C  + A G    M+    + I C  + E+L   +E + +P  I S        + + +  ++IT+ GY +S  P  L++        ++  SFK   LR ++
Sbjct:   22 LMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATGEYFGMRG---IRIYCKEDYEEL--LREESRNPTKINSLSKGRPRKRRIATAIESITNLGYDLSDRPGELTTGADGRPKRVRT-SFKHHQLRAMK 197          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 107.071 bits (266), Expect = 1.468e-23
Identity = 48/117 (41.03%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C +C K C G+ L+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C + I  EVVSAL + +H  CF C SC   F  G+RVT   +  +C  C   +
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKCTQPL 150          

HSP 2 Score: 64.6994 bits (156), Expect = 2.926e-10
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENT 497
            +K++H  CF CK C K L+A  +  ++   YC  DY   F  KC  C   I+ +V+ A  +H+H  C +C  C  +FA G  + ++  +     C    ++    K+  
Sbjct:  181 DKHWHLGCFKCKLCNKVLNA-EYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYLQGSSIWHPPCRQAAKQEEKSKKQV 288          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 107.457 bits (267), Expect = 1.663e-23
Identity = 48/117 (41.03%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C +C K C G+ L+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C + I  EVVSAL + +H  CF C SC   F  G+RVT   +  +C  C   +
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKCTQPL 150          

HSP 2 Score: 64.6994 bits (156), Expect = 3.026e-10
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENT 497
            +K++H  CF CK C K L+A  +  ++   YC  DY   F  KC  C   I+ +V+ A  +H+H  C +C  C  +FA G  + ++  +     C    ++    K+  
Sbjct:  181 DKHWHLGCFKCKLCNKVLNA-EYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYLQGSSIWHPPCRQAAKQEEKSKKQV 288          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 106.686 bits (265), Expect = 2.167e-23
Identity = 48/117 (41.03%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C +C K C G+ L+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C + I  EVVSAL + +H  CF C SC   F  G+RVT   +  +C  C   +
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKCTQPL 150          

HSP 2 Score: 64.3142 bits (155), Expect = 4.169e-10
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENT 497
            +K++H  CF CK C K L+A  +  ++   YC  DY   F  KC  C   I+ +V+ A  +H+H  C +C  C  +FA G  + ++  +     C    ++    K+  
Sbjct:  181 DKHWHLGCFKCKLCNKVLNA-EYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYLQGSSIWHPPCRQAAKQEEKSKKQV 288          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 106.686 bits (265), Expect = 2.167e-23
Identity = 48/117 (41.03%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I C +C K C G+ L+V  K+FH  CF CK CG  L  G F+ R   Y C  DY   +  +CF C + I  EVVSAL + +H  CF C SC   F  G+RVT   +  +C  C   +
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKCTQPL 150          

HSP 2 Score: 63.929 bits (154), Expect = 4.913e-10
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 3
Query:  171 EKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 455
            +K++H  CF CK C K L+A  +  ++   YC  DY   F  KC  C   I+ +V+ A  +H+H  C +C  C  +FA G  + ++  +     C
Sbjct:  181 DKHWHLGCFKCKLCNKVLNA-EYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYLQGSSIWHPPC 274          
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Medaka
Match: ablim1a (actin binding LIM protein 1 [Source:NCBI gene;Acc:101172270])

HSP 1 Score: 102.449 bits (254), Expect = 5.975e-22
Identity = 46/117 (39.32%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  117 IYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEI 467
            I CH C + C G+VL+V  K+FH  CF CK CG  L  G F+ +N  Y C  DY      +C  C + +  EVV+AL + +H  CF C  C   F  G+RVT   +  LC  C+  +
Sbjct:   47 IQCHKCGEPCKGEVLRVQNKHFHLKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRMHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQFCVEPM 163          

HSP 2 Score: 70.4774 bits (171), Expect = 5.636e-12
Identity = 47/172 (27.33%), Postives = 78/172 (45.35%), Query Frame = 3
Query:  150 GDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLN--EIEKLSNQKENTGSPNDIFSKP---IDNSMTKDLLS--DDTITDQGYMSADPTSLSSPIQVEEDDL 644
            G  L   ++ +H  CF CK C K L  G +  ++   YC  DY   F  +C  C   I+ +V+ A ++H+H  C +C  CN +F  G  + ++  T    +C N    E+   ++    S   I S+P   I  S    + +  D+ I D   ++A P  + +   +E  DL
Sbjct:  186 GQALLALDRQWHLGCFKCKACSKVL-TGEYISKDGAPYCEKDYQIHFGVQCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPNCKNTTRAEERHRERPTRSSSESICSRPGSSIPGSPGHTIYAKVDNEILDYRDLAAIP-KVKAIYDIERPDL 355          
BLAST of Actin binding LIM protein family member 2 vs. Planmine SMEST
Match: SMESG000037349.1 (SMESG000037349.1)

HSP 1 Score: 1320.45 bits (3416), Expect = 0.000e+0
Identity = 678/679 (99.85%), Postives = 679/679 (100.00%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKKHSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGXXXXXXXXXXXXXXXXXXXXXXGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLEIQERQEKERQIQYKKHSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGEQSCASN+NNNEINIQNSTSNTGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF
Sbjct:    1 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLEIQERQEKERQIQYKKHSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGEQSCASNSNNNEINIQNSTSNTGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 679          
BLAST of Actin binding LIM protein family member 2 vs. Planmine SMEST
Match: SMESG000037349.1 (SMESG000037349.1)

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 662/679 (97.50%), Postives = 663/679 (97.64%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKKHSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGXXXXXXXXXXXXXXXXXXXXXXGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLEIQERQEKERQIQYKKHSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPY                KLKPGYTQGKLYEMKINSLLKKPDFGEQSCASN+NNNEINIQNSTSNTGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF
Sbjct:    1 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLLSDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSRSLFDFGKFFKSSYLEIQERQEKERQIQYKKHSNRSTHSFLSNTNQHSISSRRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPY----------------KLKPGYTQGKLYEMKINSLLKKPDFGEQSCASNSNNNEINIQNSTSNTGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 663          
BLAST of Actin binding LIM protein family member 2 vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 218.009 bits (554), Expect = 3.967e-60
Identity = 213/758 (28.10%), Postives = 329/758 (43.40%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCL-------NEIEKLSNQKENTGSPNDIFSKPIDNS-MTKDLLS---DDTITD-----------QGYMSADPTSLSSPIQVEEDDLKLRSFKEPA----------LRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKKHSNRSTHSFLSNTNQHSISS-----RRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEK-HPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKM-PSSNAIDFTQSLDHLAINSSQNHQKNLLE----VIQTSPKHRNSCKVNC----------------DVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGXXXXXXXXXXXXXXXXXXXXXXGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFT--------------------SSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            MGKI C  C KKC GDVLK+ +K+ H+ CFNC  C K L+ G F+ R++ Y+C  DY   +  KC  C+     EVV+ L   FH +CF+C +CN  F  G++ T+ +  +LC  C        N +  LS+QK  T S  DI  +  +   + +D+++   D + TD           Q ++    TS  S ++  + ++   S   P           LR+ R + + ++  +++G++   SYL+IQER          KH+  +     SN N +++        R V          L G     N  +RP    S  DVN  + V +LA YP G++  PD+ P PI+R D+PAP S +V+LQ+ K  K+     S+ S  D    + + ID    L     +  +  +K  +E    V++ + K+    +                   D ISASRSP AS EP  KPR+  HT  S SRD+ Y   P  H  Y    + ++N     G +P      PQ            PGYTQG L     +S   +P  G    AS+             N     T N  +       +  S Y +   +A   + DE T                     + + A  G K TR  +  +   E    S   ++ S    L+  +    K  I      Y  L   +  + + +D  +LE +L+  +F  +F+++RS F RLPEWK+NDLKR+++L+
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITES--DIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERIT--------KHTPPNAVYCGSNRNPNTVPPITSHFHRPVNPFGQMFKKPLPGQ---YNRGIRPQ---STNDVNLSEEVKRLAHYPDGKRPDPDSAP-PIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYR---VQYSNTGGRTGTLPGAYTSTPQ------------PGYTQGYL-SCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVN-----TTNYLLDGHMSPSMTTSGYSV---DATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQS---YLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 714          
BLAST of Actin binding LIM protein family member 2 vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 215.698 bits (548), Expect = 4.126e-59
Identity = 216/773 (27.94%), Postives = 333/773 (43.08%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCL-------NEIEKLSNQKENTGSPNDIFSKPIDNS-MTKDLLS---DDTITD-----------QGYMSADPTSLSSPIQVEEDDLKLRSFKEPA----------LRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKKHSNRSTHSFLSNTNQHSI----------------SSRRQVKSKCNDIGSV----LCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYPAGEK-HPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKM-PSSNAIDFTQSLDHLAINSSQNHQKNLLE----VIQTSPKHRNSCKVNC----------------DVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGXXXXXXXXXXXXXXXXXXXXXXGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFT--------------------SSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            MGKI C  C KKC GDVLK+ +K+ H+ CFNC  C K L+ G F+ R++ Y+C  DY   +  KC  C+     EVV+ L   FH +CF+C +CN  F  G++ T+ +  +LC  C        N +  LS+QK  T S  DI  +  +   + +D+++   D + TD           Q ++    TS  S ++  + ++   S   P           LR+ R + + ++  +++G++   SYL+IQER          KH+  +     SN N +++                SS      K N  G +    L G     N  +RP    S  DVN  + V +LA YP G++  PD+ P PI+R D+PAP S +V+LQ+ K  K+     S+ S  D    + + ID    L     +  +  +K  +E    V++ + K+    +                   D ISASRSP AS EP  KPR+  HT  S SRD+ Y   P  H  Y    + ++N     G +P      PQ            PGYTQG L     +S   +P  G    AS+             N     T N  +       +  S Y +   +A   + DE T                     + + A  G K TR  +  +   E    S   ++ S    L+  +    K  I      Y  L   +  + + +D  +LE +L+  +F  +F+++RS F RLPEWK+NDLKR+++L+
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITES--DIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERIT--------KHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKVNPFGQMFKKPLPGQ---YNRGIRPQ---STNDVNLSEEVKRLAHYPDGKRPDPDSAP-PIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYR---VQYSNTGGRTGTLPGAYTSTPQ------------PGYTQGYL-SCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVN-----TTNYLLDGHMSPSMTTSGYSV---DATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQS---YLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 729          
BLAST of Actin binding LIM protein family member 2 vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 213.772 bits (543), Expect = 1.677e-58
Identity = 215/775 (27.74%), Postives = 332/775 (42.84%), Query Frame = 3
Query:  108 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISCL-------NEIEKLSNQKENTGSPNDIFSKPIDNS-MTKDLLS---DDTITD-----------QGYMSADPTSLSSPIQVEEDDLKLRSFKEPA----------LRNLRLQSNTSRSLFDFGKFFKSSYLXXXXXXXXXXXXXYKKHSNRSTHSFLSNTNQHSIS------------SRRQVKSKCNDIGSVLCGNRFS----------INSNLRPMTSVSEADVNEKDNVIKLASYPAGEK-HPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKM-PSSNAIDFTQSLDHLAINSSQNHQKNLLE----VIQTSPKHRNSCKVNC----------------DVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDFGXXXXXXXXXXXXXXXXXXXXXXGYSWTANRTMSDTFDVQLKNSEYDLTFDEAVFENCDEFT--------------------SSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 2144
            MGKI C  C KKC GDVLK+ +K+ H+ CFNC  C K L+ G F+ R++ Y+C  DY   +  KC  C+     EVV+ L   FH +CF+C +CN  F  G++ T+ +  +LC  C        N +  LS+QK  T S  DI  +  +   + +D+++   D + TD           Q ++    TS  S ++  + ++   S   P           LR+ R + + ++  +++G++   SYL+IQER          KH+  +     SN N +++             S R   +     G  L  N F            N  +RP    S  DVN  + V +LA YP G++  PD+ P PI+R D+PAP S +V+LQ+ K  K+     S+ S  D    + + ID    L     +  +  +K  +E    V++ + K+    +                   D ISASRSP AS EP  KPR+  HT  S SRD+ Y   P  H  Y    + ++N     G +P      PQ            PGYTQG L     +S   +P  G    AS+             N     T N  +       +  S Y +   +A   + DE T                     + + A  G K TR  +  +   E    S   ++ S    L+  +    K  I      Y  L   +  + + +D  +LE +L+  +F  +F+++RS F RLPEWK+NDLKR+++L+
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITES--DIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERIT--------KHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQ---STNDVNLSEEVKRLAHYPDGKRPDPDSAP-PIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYR---VQYSNTGGRTGTLPGAYTSTPQ------------PGYTQGYL-SCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVN-----TTNYLLDGHMSPSMTTSGYSV---DATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQS---YLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 734          
The following BLAST results are available for this feature:
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABLIM23.923e-2543.36actin binding LIM protein family member 2 [Source:... [more]
ABLIM24.576e-2543.36actin binding LIM protein family member 2 [Source:... [more]
ABLIM24.626e-2543.36actin binding LIM protein family member 2 [Source:... [more]
ABLIM24.818e-2543.36actin binding LIM protein family member 2 [Source:... [more]
ABLIM25.009e-2543.36actin binding LIM protein family member 2 [Source:... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxl-11.882e-1537.62Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
pxl-16.406e-1537.62Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
pxl-11.400e-1437.62Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
alp-17.590e-1338.04ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:... [more]
alp-11.351e-1238.04ALP/Enigma encoding [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc-115b1.113e-2637.69gene:FBgn0260463 transcript:FBtr0082094[more]
Unc-115b1.199e-2637.69gene:FBgn0260463 transcript:FBtr0346713[more]
Unc-115b1.232e-2637.69gene:FBgn0260463 transcript:FBtr0082097[more]
Unc-115a1.260e-2637.69gene:FBgn0051352 transcript:FBtr0300565[more]
Unc-115a1.340e-2637.69gene:FBgn0051352 transcript:FBtr0344275[more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim25.873e-2440.34actin binding LIM protein family, member 2 [Source... [more]
ablim21.651e-2340.34actin binding LIM protein family, member 2 [Source... [more]
ablim21.766e-2340.34actin binding LIM protein family, member 2 [Source... [more]
BX465192.13.760e-2338.71actin binding LIM protein family, member 2 [Source... [more]
BX465192.12.017e-2239.50actin binding LIM protein family, member 2 [Source... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uck26.028e-2035.29uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck26.156e-2035.29uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck27.586e-2036.52uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck27.934e-2035.29uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck28.496e-2035.29uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ablim11.071e-2439.69actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim11.414e-2439.69actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim11.547e-2439.69actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim11.800e-2439.69actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim21.848e-2442.48actin-binding LIM protein 2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6H8Q1|ABLM2_HUMAN2.406e-2443.36Actin-binding LIM protein 2 OS=Homo sapiens OX=960... [more]
sp|Q8K4G5|ABLM1_MOUSE8.167e-2439.69Actin-binding LIM protein 1 OS=Mus musculus OX=100... [more]
sp|O14639|ABLM1_HUMAN8.537e-2440.46Actin-binding LIM protein 1 OS=Homo sapiens OX=960... [more]
sp|Q8BL65|ABLM2_MOUSE1.293e-2342.48Actin-binding LIM protein 2 OS=Mus musculus OX=100... [more]
sp|Q6KC51|ABLM2_RAT1.648e-2241.59Actin-binding LIM protein 2 OS=Rattus norvegicus O... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DES01.175e-3529.95Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
Q5DH953.434e-3539.29SJCHGC07563 protein OS=Schistosoma japonicum OX=61... [more]
A0A1I8HQ075.807e-3529.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K4FA431.108e-3452.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F8071.390e-3452.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim22.928e-2341.18actin binding LIM protein family, member 2 [Source... [more]
ablim1b2.345e-2137.61actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b2.482e-2137.61actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b2.658e-2137.61actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b2.745e-2137.61actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim1a3.227e-2336.75actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000006267.12.584e-2236.50pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 g... [more]
ENSPMAT00000007081.11.009e-1127.19pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
PXN3.502e-1032.32paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
PXN4.822e-932.63paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LRG11.551e-629.00GTPase-activating protein (GAP); contains Rho1p-sp... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432012.093e-1933.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441831.904e-1334.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395817.572e-1029.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460738.998e-1028.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433542.546e-929.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim21.468e-2341.03actin binding LIM protein family member 2 [Source:... [more]
ablim21.663e-2341.03actin binding LIM protein family member 2 [Source:... [more]
ablim22.167e-2341.03actin binding LIM protein family member 2 [Source:... [more]
ablim22.167e-2341.03actin binding LIM protein family member 2 [Source:... [more]
ablim1a5.975e-2239.32actin binding LIM protein 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Actin binding LIM protein family member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037349.10.000e+099.85SMESG000037349.1[more]
SMESG000037349.10.000e+097.50SMESG000037349.1[more]
SMESG000080177.13.967e-6028.10SMESG000080177.1[more]
SMESG000080177.14.126e-5927.94SMESG000080177.1[more]
SMESG000080177.11.677e-5827.74SMESG000080177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033766 ID=SMED30033766|Name=Actin binding LIM protein family member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2590bp
CAATTCCTTATTGCTCCTTTGCAATTTTGTTTGATTTTCCTTGATAATGC
TTTCTCAATGAATGATTTATCAATTTAAATTAACTATCTAGTCGTTTTTA
TAATAAAATGGGCAAAATTTATTGTCATAGTTGTTCGAAGAAATGCGTAG
GAGATGTTCTAAAAGTCGGAGAAAAATATTTTCATCAAATTTGCTTTAAT
TGTAAAGATTGCGGTAAAACTCTTGATGCTGGTGCATTTTATTTTCGGAA
CGATAATTATTATTGTCTTAATGATTACACTAATCGTTTTACAAACAAAT
GCTTTATTTGTTCAAATGCCATCAGTTCAGAAGTGGTGTCTGCTCTAAAC
CGCCATTTTCATCGGGAGTGCTTTAAATGTGGTAGTTGCAATATTGTATT
TGCTCCTGGAAATCGTGTAACAATGAAAAACGAAACTTTTCTTTGCATTT
CTTGCTTAAACGAAATAGAAAAATTATCAAATCAAAAAGAAAATACAGGT
TCTCCTAATGACATATTCTCTAAACCCATTGATAATTCAATGACCAAGGA
TTTATTATCAGATGACACAATAACTGATCAAGGATATATGAGTGCCGATC
CAACTTCGCTTTCATCACCAATTCAAGTGGAAGAAGATGATTTAAAACTT
CGATCGTTTAAGGAACCAGCGTTGAGAAATTTAAGATTGCAATCAAATAC
AAGTCGTAGCCTATTTGATTTTGGAAAATTTTTTAAATCATCATATTTGG
AAATCCAAGAACGCCAGGAAAAAGAACGTCAAATCCAATATAAGAAACAT
TCAAATAGATCAACTCACTCTTTTTTGTCAAACACTAATCAACATTCAAT
TTCATCGAGACGTCAAGTTAAATCCAAATGCAATGATATTGGTTCTGTGC
TGTGTGGAAACAGATTCTCTATTAACTCAAATTTGAGACCAATGACATCA
GTCAGTGAAGCAGATGTCAATGAAAAGGATAATGTGATTAAGTTGGCATC
GTACCCTGCAGGAGAAAAACATCCAGATAACATTCCATACCCTATTGAGA
GAGATGACTGGCCTGCACCTTTGTCTTCTGCAGTTCTTTTACAAGAAAAA
AAAAATCGTAAACAAAATTTTTTTGGAATATCAGTGCAAAGTGAATTAGA
CAAAATGCCAAGCAGCAACGCAATCGATTTTACACAATCATTGGATCATC
TAGCAATCAATTCCTCTCAAAATCACCAAAAGAATCTTTTAGAGGTTATT
CAAACATCTCCAAAACATAGAAATAGTTGCAAAGTTAATTGCGACGTCAT
TTCAGCTTCACGTTCACCAAGCGCAAGCACGGAGCCAATGACAAAGCCGC
GGTTTTCAGATCATACTGATAAATCAAGATCTCGAGATTCCACCTATTTT
AATGATCCAAATCGTCATTTTGGATATTCATTGGATTTTATTAGCTTTAC
TAATCGATCATTTCTTGTTGGCAATGTGCCATACAATATATACGGGAAAC
CACAATATAAATCACTGGTGCAACCTGTAGTTAAACTGAAGCCTGGATAC
ACACAAGGAAAACTGTATGAGATGAAAATAAATTCTTTGCTCAAAAAGCC
TGATTTTGGTGAACAAAGCTGTGCTAGTAATAACAACAATAACGAAATTA
ACATCCAAAATAGCACCAGTAATACTGGATACTCTTGGACCGCTAACCGC
ACTATGTCAGACACATTTGATGTTCAATTGAAAAATAGTGAATATGATTT
GACTTTCGATGAAGCTGTTTTCGAAAATTGTGATGAGTTTACATCGTCTG
ATATTGATGCAATTACCGGGCTTAAATCAACAAGGAGAAGGTATTCAAAA
GATCGAATTAAAGAACCAACCATAACATCGGGTCGATCAAGTATCAATAG
TAAAATCGAGTCTTTAGAAACTTGGTCATTTTGGTCACATAAGCCATCTA
TAAAGCCTCCAATTATTTCATATTCTGATCTGGTTTCTAAAGATCCTAAA
ATTTTAAGATCTCTTGATGCTCATAAATTAGAGACGTATTTATCTAGTGA
AGAATTTTTACGCTTATTTAAATTGAACCGATCAGAATTCTACAGACTTC
CAGAATGGAAACAAAATGATCTTAAGCGGCGGATTAATTTATTTTAATTG
TCACTTTATTTGGAAATTATTATTGAATATGTGGAGTGAAATGTTATGTG
AGAATTTGTCGTTCTAAATTAGGATTTGTTATTAATGAAATTATTGGATA
TGAATATGCCGACCCCTTCTGGATGCTTATCTGTGACAATATTATAATCA
TAAGTATCTTTCCTTCATAACAACATTTTTTATAACCGATCTCTCTATCT
CTCTCTCTCTTTCTCATTAGGCTTTGTGATGTGATATATAATATTTGTTT
AAGGAATTTTATGTTTTCTGATGATATTGAGATTTTCTGGCAGAAATTTT
AATTTTTTATTATCAAAATATGTTGCTTAATTTCGTTACTTTCTTTCGTT
TATTGTGATATTCAGGTCTTTTATTTCACTTTCTAGAATCAAGATGATTT
TATCGCTTAGTACTGATCTAAGATCATTGAAATATTTGGC
back to top

protein sequence of SMED30033766-orf-1

>SMED30033766-orf-1 ID=SMED30033766-orf-1|Name=SMED30033766-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDN
YYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAP
GNRVTMKNETFLCISCLNEIEKLSNQKENTGSPNDIFSKPIDNSMTKDLL
SDDTITDQGYMSADPTSLSSPIQVEEDDLKLRSFKEPALRNLRLQSNTSR
SLFDFGKFFKSSYLEIQERQEKERQIQYKKHSNRSTHSFLSNTNQHSISS
RRQVKSKCNDIGSVLCGNRFSINSNLRPMTSVSEADVNEKDNVIKLASYP
AGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKM
PSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSCKVNCDVISA
SRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNR
SFLVGNVPYNIYGKPQYKSLVQPVVKLKPGYTQGKLYEMKINSLLKKPDF
GEQSCASNNNNNEINIQNSTSNTGYSWTANRTMSDTFDVQLKNSEYDLTF
DEAVFENCDEFTSSDIDAITGLKSTRRRYSKDRIKEPTITSGRSSINSKI
ESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEF
LRLFKLNRSEFYRLPEWKQNDLKRRINLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036886Villin_headpiece_dom_sf
IPR003128Villin_headpiece
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003128Villin headpieceSMARTSM00153VHP_1coord: 644..679
e-value: 2.4E-14
score: 63.6
IPR003128Villin headpiecePFAMPF02209VHPcoord: 644..679
e-value: 6.2E-15
score: 55.0
IPR003128Villin headpiecePROSITEPS51089HPcoord: 614..679
score: 17.571
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 64..116
e-value: 1.0E-12
score: 58.2
coord: 5..56
e-value: 5.3E-8
score: 42.6
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 6..61
e-value: 3.5E-10
score: 40.0
coord: 65..116
e-value: 4.0E-8
score: 33.3
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 6..39
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 65..98
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 64..123
score: 9.009
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 4..63
score: 12.157
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 60..164
e-value: 1.4E-17
score: 66.0
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 3..59
e-value: 1.2E-12
score: 49.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 224..253
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 402..428
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 232..253
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 414..428
NoneNo IPR availablePANTHERPTHR24213FAMILY NOT NAMEDcoord: 231..679
coord: 2..122
NoneNo IPR availableCDDcd09327LIM1_abLIMcoord: 6..57
e-value: 5.51466E-18
score: 75.7555
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 32..95
IPR036886Villin headpiece domain superfamilyGENE3DG3DSA:1.10.950.10coord: 617..679
e-value: 1.8E-17
score: 64.8
IPR036886Villin headpiece domain superfamilySUPERFAMILYSSF47050VHP, Villin headpiece domaincoord: 616..679