Multidrug resistance-associated protein 1

Overview
NameMultidrug resistance-associated protein 1
Smed IDSMED30033764
Length (bp)4887
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug resistance-associated protein 1 (SMED30033764) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30033764) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug resistance-associated protein 1 (SMED30033764) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30033764) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033764

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033764SMESG000036835.1 Contig3426GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033764SMESG000064939.1 Contig3426GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033764SMESG000064939.1 dd_Smed_v4_9357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033764SMESG000064939.1 dd_Smed_v4_9357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033764SMESG000064939.1 dd_Smed_v4_9357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033764SMESG000064939.1 Contig49363newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033764SMESG000064939.1 Contig49363uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30033764SMESG000036835.1 Contig3426GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033764SMESG000064939.1 Contig3426GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1221.45 bits (3159), Expect = 0.000e+0
Identity = 696/1565 (44.47%), Postives = 997/1565 (63.71%), Query Frame = 2
Query:   86 VSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK----PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXX-----XKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK---KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++ +  CS    D  LW  NV W+T NPD T CFQ T+L W+P  +L   C     + L +    Y      N  K+ L   L+ +   DLF S  ++  G+       + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ +  +K  A  D FR IT  + F ++ I  + +CF+D    +  L   + +D        PN            CPE  ASFLS+ITF W T LI RG+R+PL   DL+ L +ED+ +++VP++ + W +E  +  ++ +K  Y     +S    Q   S  +++N     +   +P+    P   +VL  T    F  S   K I+D   F  P IL   I F+ +     W G+FY   +F+ +  +T +  Q+  +C V+G+R KTA+I  +Y+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW  LGP+ +AG+ +++ M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L+A  +  W CTP LVAL +F  YV  D NNIL  Q AFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E     D      I++ N  F+W  ++ P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +    Y  V++ACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YLFDDPLSAVDAHVGKHIFE V    G+L   TRILVTH ++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + ++ +E+          K  KQ +   + +T+S G++     S  +S    +S+  +     +K     +   KL++ + A+ G VKL V+  Y++      + L+I  + C++++AL S N  LS W++   +N +Q+       L +YG L  +Q I +   S++++ G  LAS+ LH  +L SI+R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI + I+I +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L +TT L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WPQ G++EF N+ +RYR  LD  LR++N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W +LE+A+LK F +     L+   +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I+E   P  LL  ++ LF+SMAKDAGL
Sbjct:    1 MALRGFCSADGSD-PLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLW-ACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSD----RSPLFSETIHD--------PNP-----------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVY-----SSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQ-MENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALAS-NYWLSLWTDDPIVNGTQE--HTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAKDAGL 1530          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1221.45 bits (3159), Expect = 0.000e+0
Identity = 696/1565 (44.47%), Postives = 997/1565 (63.71%), Query Frame = 2
Query:   86 VSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK----PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXX-----XKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK---KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++ +  CS    D  LW  NV W+T NPD T CFQ T+L W+P  +L   C     + L +    Y      N  K+ L   L+ +   DLF S  ++  G+       + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ +  +K  A  D FR IT  + F ++ I  + +CF+D    +  L   + +D        PN            CPE  ASFLS+ITF W T LI RG+R+PL   DL+ L +ED+ +++VP++ + W +E  +  ++ +K  Y     +S    Q   S  +++N     +   +P+    P   +VL  T    F  S   K I+D   F  P IL   I F+ +     W G+FY   +F+ +  +T +  Q+  +C V+G+R KTA+I  +Y+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW  LGP+ +AG+ +++ M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L+A  +  W CTP LVAL +F  YV  D NNIL  Q AFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E     D      I++ N  F+W  ++ P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +    Y  V++ACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YLFDDPLSAVDAHVGKHIFE V    G+L   TRILVTH ++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + ++ +E+          K  KQ +   + +T+S G++     S  +S    +S+  +     +K     +   KL++ + A+ G VKL V+  Y++      + L+I  + C++++AL S N  LS W++   +N +Q+       L +YG L  +Q I +   S++++ G  LAS+ LH  +L SI+R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI + I+I +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L +TT L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WPQ G++EF N+ +RYR  LD  LR++N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W +LE+A+LK F +     L+   +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I+E   P  LL  ++ LF+SMAKDAGL
Sbjct:    1 MALRGFCSADGSD-PLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLW-ACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSD----RSPLFSETIHD--------PNP-----------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVY-----SSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQ-MENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALAS-NYWLSLWTDDPIVNGTQE--HTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAKDAGL 1530          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 662/1467 (45.13%), Postives = 949/1467 (64.69%), Query Frame = 2
Query:  410 FLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK----PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXX---------------KLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKK---LVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ +  +K  A  D FR IT  + F ++ I  + +CF+D    +  L   + +D        PN            CPE  ASFLS+ITF W T LI RG+R+PL   DL+ L +ED+ +++VP++ + W +E  +  ++ +K  Y     +S    Q   S  +++N     +   +P+    P   +VL  T    F  S   K I+D   F  P IL   I F+ +     W G+FY   +F+ +  +T +  Q+  +C V+G+R KTA+I  +Y+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW  LGP+ +AG+ +++ M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L+A  +  W CTP LVAL +F  YV  D NNIL  Q AFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E     D      I++ N  F+W  ++ P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +    Y  V++ACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YLFDDPLSAVDAHVGKHIFE V    G+L   TRILVTH ++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + ++ +E+                    K  KQ +   + +T+S G++     S  +S    +S+  +     +K     ++   L++ + A+ G VKL V+  Y++      + L+I  + C++++AL S N  LS W++   +N +Q+       L +YG L  +Q I +   S++++ G  LAS+ LH  +L SI+R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI + I+I +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L +TT L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WPQ G++EF N+ +RYR  LD  LR++N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W +LE+A+LK F +     L+   +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I+E   P  LL  ++ LF+SMAKDAGL
Sbjct:    6 LVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSD----RSPLFSETIHD--------PNP-----------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVY-----SSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQ-MENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALAS-NYWLSLWTDDPIVNGTQE--HTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAKDAGL 1439          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 662/1467 (45.13%), Postives = 949/1467 (64.69%), Query Frame = 2
Query:  410 FLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK----PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXX---------------KLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKK---LVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ +  +K  A  D FR IT  + F ++ I  + +CF+D    +  L   + +D        PN            CPE  ASFLS+ITF W T LI RG+R+PL   DL+ L +ED+ +++VP++ + W +E  +  ++ +K  Y     +S    Q   S  +++N     +   +P+    P   +VL  T    F  S   K I+D   F  P IL   I F+ +     W G+FY   +F+ +  +T +  Q+  +C V+G+R KTA+I  +Y+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW  LGP+ +AG+ +++ M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L+A  +  W CTP LVAL +F  YV  D NNIL  Q AFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E     D      I++ N  F+W  ++ P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +    Y  V++ACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YLFDDPLSAVDAHVGKHIFE V    G+L   TRILVTH ++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + ++ +E+                    K  KQ +   + +T+S G++     S  +S    +S+  +     +K     ++   L++ + A+ G VKL V+  Y++      + L+I  + C++++AL S N  LS W++   +N +Q+       L +YG L  +Q I +   S++++ G  LAS+ LH  +L SI+R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI + I+I +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L +TT L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WPQ G++EF N+ +RYR  LD  LR++N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W +LE+A+LK F +     L+   +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I+E   P  LL  ++ LF+SMAKDAGL
Sbjct:    6 LVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSD----RSPLFSETIHD--------PNP-----------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVY-----SSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQ-MENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALAS-NYWLSLWTDDPIVNGTQE--HTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAKDAGL 1439          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC3 (ATP binding cassette subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:54])

HSP 1 Score: 1178.31 bits (3047), Expect = 0.000e+0
Identity = 675/1575 (42.86%), Postives = 962/1575 (61.08%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSI---RVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTP-KPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVST-SNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXK----------------------------LIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            LC +       W SN+   T NPDLT CFQ ++L W+P ++L +     + + LR     Y      + +K +L   L+ +   DLF S    + G  P    F+ P++  V  LL   + +   ++GV SSG+L I+W L  +V AI+ +   I   + +   +D FRF T  I F +V  + I  CF      ++     S+ ++D      PN             PE  A FLS++ F W T++   G+R PL   DL+ LKEED  + +V  +   W        RK  KQ       T+ H+  + P +N          ++  P KP FL+ LL T    F  S   K+I D  +FI P +L   I FI N     W GF     +FL SM ++ I Q +     VTG++ +T I+ +IY+KAL ++ + ++  TVGEIVNLMSVDA +F D   F +LLW +P+ II+ +YFLWQ LGP+ +AG+  ++ ++P+N  +  K++  Q +QM++KD RIKL+SEIL+GIK+LKL+AWE S  ++V+ IR+ E  +LR A +L+  T+  W C+P LV L +   YV  DPNN+L  +KAFVS+SLFNIL  P++MLP  I    Q  VS KRI  FL+ EELDP +VE  T S    I+I +G F+W ++  P L  +++++ +G+LV +VG VG GKSSL+SA+LGEM K+ G V  K  VAYVPQQAW QN +LQ+N+LFGK++   +Y + LEACAL+ DL++LP GDQTEIGEKGINLSGGQ+QR+SLAR+VY ++ ++L DDPLSAVD+HV KHIF+ V   +G+L+  TR+LVTHG+++L + D I V+ DG VSE G Y  LL+ +G FA+F+  Y   +D    ED     +                            +++++  ++LS   S G  +G    RR+   S   +              +  L  EE A IG V+L VF  Y +       +   L Y    AA +  N+ LS+W+     ++ Q+  +    LG+Y  L   Q   +++ ++++A G   A++ LH  +L + IR+P SFFDTTPSGRILN   KDI  VD  +   + + L S    IS++++I  ++P F + ++PL+  Y  +Q+FY  TSRQL+R++S+ +SPIYSHF E++ G S IRAY  +  F    +   D +Q   +  I  NRW+   +E +GN V+L + +FAV  R ++  GL GLSVSY+L +T +L  M+R   D+ESN+VA+ER+KEY++ E+EAPW +   +PP  WP  G++EF N+SVRYRPGLDL LR+L+  V  GEK+GIVGRTGAGKSS+ L LFR++E A+G I+ID +++  +GLHDLRS+LTIIPQDP+LFSG LR+NLDPF  YS+ +IW ALE+++L +F +    GL+F  SE GENLSVGQRQLVCLARALL+K+ ILVLDEATAA+D+ETD LIQ +IRT F +CTVLTIAHRLNTIMDY RV+VL +G + E ++P  L+A  + +F+ MA+DAGLA
Sbjct:    4 LCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYL-LYLRHHCRGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIFWFL-CVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFALVLSALILACF------REKPPFFSAKNVD------PNPY-----------PETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAW--------RKQEKQ-------TARHKASAAPGKNASGEDEVLLGARPRPRKPSFLKALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRFMDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEA--------KADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLR--LGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERVKEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIA-ARGIFYGMARDAGLA 1527          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-7 (pep chromosome:WBcel235:V:19674843:19693043:1 gene:WBGene00003413.1 transcript:Y43F8C.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-7)

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 615/1554 (39.58%), Postives = 884/1554 (56.89%), Query Frame = 2
Query:  179 LCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYS--TRGKFN---IIKSILVCGL----FFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVK----------TPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKD-TPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRK-AMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDK---PISIVNGNFSWGENEAP---ILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKL--IKQELRKK-------LSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWS-EAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRD---TIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            +C Q+T+L W+P  F ++     +P L  +  +      R  F+   IIK +LV  L       +C  LF   S          A ++ P L  +       V+ +    G+ SSGI  +   + L+  A   Y + IR++          T  + +F  I  +  +  + +   + CFAD    K    K+SS                         PEL++SFL+++T  W   + + G R+ L IDD++ L E    + +  + +  W            + + LK    +S   +  PSE            KD    P  +  L     ++F  +  LK + D   F  P +L   +NFI   N   W G      +F VS  R+ I   + ++    G + +T++ + +YKK L +S ++R++RTVGEIVNLM++D  +FQ         W  P  I   + +L+  LG + + G+V+++  +P+N +    ++K Q +QM++KD R K+++E+L+GIK++KL+AWE+ +E  +  IR KE  +++K AM  N   S     +P LVALFSFG +VL++P+++LTPQ AFVS++LFN L  PM+M+   I   +Q +VS KR+  FL  EELD   V+ S + ++    + + N   SW   EA     L+D++L     SL+ +VG VGSGKSSL+ A+LGEM K+ G +     VAYVPQQ W QN +L+DNI FG+     +Y +VL ACAL  D+KILPAGDQTEIGEKGINLSGGQK R+SLAR+VYQN  VYL DDPLSAVDAHVG+HIFEKV   +GLL + TRILVTHGL Y   AD+I VM +G + E+GT++ L+K  G F DF+  Y    D+ S     ++     I  E++         L++T          +     S     +     T+         KL+ +E    G V++  +  Y++   YL ++  I  +  Y+   +  +  LS+WS E    + S    A+ + LG+YG L F++     +  L+L +    ASK LH  ++ +++R+P SF+DTTP GRILNR  KDI+T+D+ +P   R  +    +V  ++I+I I++P F + ++PL+  Y    ++Y+ TSRQL+R++S+ +SPIYSHF E+I G +SIRA+   D+F      + D      +  +  NRW+   LE +GN +I  + +FAV  ++       G+ G+SVSYAL IT  L   VR   +IE+N+V++ER+ EYT   +EAPW I   +P   WP  G ++F  +S RYR GLDL L +++  V  GEK+GIVGRTGAGKSS ALALFR+IE A G I IDD++++ +GLHDLRS +TIIPQDPVLFSG LR NLDPF  YSD +IW ALE+A+LK F A    GL + ISE GENLSVGQRQLV LARALL+ T +LVLDEATAAVD+ TD LIQ +IR  FK CTV TIAHRLNTIMDYDR+MVL +G I E +TP  L+AD+ S F  M  DA 
Sbjct:   21 ICAQHTVLVWVPAAFFLL----TLPFLSAQCHLTAQRFARLPFSAHFIIKLLLVAFLAANSLATWCYVLFSKNSYA-------AAYYVYPGLWVLVWTGTFLVHLIRLRCGLVSSGIQHVTSLIFLLCGAPEFY-QWIRMENSNSFPNDLTTTDSAQFLSIAYLSWYSALILYTFSLCFADPRGAKTDDEKASSKSA--------------------ASPELQSSFLNRLTLWWFNSIPWTGARRDLEIDDIFELNERSGTEFLSELWESFW------------EPKRLKYIHDTSIWAKKDPSEQ----------EKDPVVIPSVVSSLFMMFRWEFLLASTLKFVSDTMQFASPFLLHELLNFISAKNAPFWKGMALSILMFSVSELRSLILNGYFYIMFRMGTKIQTSLTAAVYKKTLLISNSARRDRTVGEIVNLMAIDVERFQMITPQIQQFWSCPYQITFALVYLFITLGYSALPGVVIMVIFVPMNIISSMIVRKWQIEQMKLKDERTKMVNEVLNGIKVVKLYAWEVPMEAYIDEIRTKELALIKKSAMVRNILDSFN-TASPFLVALFSFGTFVLSNPSHLLTPQIAFVSLALFNQLRSPMTMIALLINQAVQAVVSNKRLKEFLVAEELDEKCVDRSVNIERSHNAVRVENLTASWDPEEAAGEKTLQDVDLTAPRNSLIAVVGKVGSGKSSLLQALLGEMGKLRGRIGVNGRVAYVPQQPWIQNMTLRDNITFGRPFDRKRYDQVLYACALKADIKILPAGDQTEIGEKGINLSGGQKARVSLARAVYQNLDVYLLDDPLSAVDAHVGRHIFEKVIGPNGLLREKTRILVTHGLTYTKMADEILVMLEGKIEESGTFEHLIKRRGLFFDFMEEYKSGSDNSSEAGGSQDDDFEAIGGEIQDYMNPEDVVLTVTNDLDETIRTPELTTQISTMSSPEKPPTGTSPAAATESQNKLIKKEGIAQGKVEIATYQLYVKAAGYLLSIAFIGFFIVYMTLQILRSFWLSAWSDEYDPDSPSAHPMAKGWRLGVYGALGFSETACFFVALLALVFVGQRASKNLHGPLIHNLMRSPMSFYDTTPLGRILNRCAKDIETIDMMLPMNFRYLVMCVLQVAFTLIVIIISTPLFAVVILPLALIYLIFLRYYVPTSRQLKRLESVHRSPIYSHFGETIQGAASIRAFGKVDEFRQDSGRILDTFIRCRYSSLVSNRWLAVRLEFVGNCIIFFAALFAVLSKEFGWITSPGVIGVSVSYALNITEVLNFAVRQVSEIEANIVSVERVNEYTNTPNEAPWRIEGREPAPGWPSRGVVKFDGYSTRYREGLDLVLHDISADVAAGEKIGIVGRTGAGKSSFALALFRMIEAAGGRIVIDDVEVSQIGLHDLRSNITIIPQDPVLFSGTLRFNLDPFFTYSDDQIWRALELAHLKHFAAGLPDGLLYKISEAGENLSVGQRQLVALARALLRHTRVLVLDEATAAVDVATDALIQETIREEFKECTVFTIAHRLNTIMDYDRIMVLDKGSILEFDTPDALMADKNSAFAKMVADAA 1519          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-2 (pep chromosome:WBcel235:X:563719:572701:-1 gene:WBGene00003408.1 transcript:F57C12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-2)

HSP 1 Score: 548.51 bits (1412), Expect = 1.050e-167
Identity = 338/864 (39.12%), Postives = 477/864 (55.21%), Query Frame = 2
Query:  176 TLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFN---IIKSILVCGLFFIYCLDLF----KSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLI--VNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADP-NNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSD-GLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFA 2734
            T C Q+T  + IP +FL++   I I  LL  ++         +   I+  +LV  L      DL+    +S + ++V     + QF    L+ +  L V   N     KG+ +SG++ +YW L ++  +     Y         A +  R    II F    +     CFAD   +   + KS S+                       CPE  ASF++++TF W T L Y G +K L  +DL+ L E D  + ++P   +     +D  H+ I K                 PS  +  N            P F+  +  T  Y        K+ +D   F+ P +L   I FI + N+ +W G   +  +F  S  ++    Q+       G+  ++ + S +Y KAL LS  +RK +T+G IVNLMSVD  K QD      L W +P+ I +++YFLW+ LG A +AGLV+LI  LP+N +I  +++K QT+QM++KD RIK++SEIL+G+K+LKL++WE S+E  V  IRE+E  +L+K  +  A    +W C P L ++ SF  YV  DP NN+LTP+  FV++SLF+IL  P++M+       +Q  VS  R+  F   EE+ P         D  I + NG FSW  +E P LR+I+ +I++G LV IVG VGSGKSSL+ A+LGEM K+SG+V+    +AYVPQQAW QN SL++NILF K      Y  V++ CAL EDL  LPAGD+TEIGEKGINLSGGQKQR+SLAR+VYQN  + L DDPLSAVD+HVGKHIFE V SS  G L+  TR+LVTHGL YL   D++ V+K+G +SE GTY+ELL N G FA
Sbjct:   31 TKCGQHTDFSTIPTLFLVVFSFIVIYQLLHTRTAQLRCFSPISFRIILGCLLVVDLIATVIYDLYLYVSQSPNFEVVHFYGDLVQFGGICLALI--LTVACKN-----KGIITSGVITLYWLLVVVCGIPEFRFYLSGFIYNEYALEGIRATLYIIAFTFSALELFLCCFAD---VPSDMYKSESS-----------------------CPEYTASFINRLTFQWFTGLAYLGNKKSLENEDLWDLNEIDKAENLIPSFMQNLKPRIDEYHQNIKKD----------------PSAALPKN-----------HPSFVIPIFKTYKYTLLAGFFYKLCFDMLQFLAPQLLKQLIGFIEDKNQPVWIGCSIVGIMFFSSFLQSMFLHQYYHSMFRLGMHVRSVLTSAVYSKALNLSNEARKGKTIGAIVNLMSVDIQKIQDMAPTIMLFWSAPLQIFLSIYFLWKFLGVAALAGLVVLILALPVNGLIAIQMRKCQTEQMKLKDERIKMMSEILNGMKVLKLYSWERSMENMVLKIRERELHILKKLSYFMAAIVFSWICAPFLASVISFVVYVYLDPENNVLTPEITFVALSLFDILRMPLAMVAMVYGEAVQCSVSNTRLKEFFAAEEMSPQTSISHGETDSAIEVENGLFSWSSDEDPTLREISFKIQKGQLVAIVGKVGSGKSSLLHALLGEMNKLSGSVQINGNIAYVPQQAWIQNMSLRNNILFNKPYDLENYEDVVKNCALKEDLANLPAGDRTEIGEKGINLSGGQKQRVSLARAVYQNPDIILLDDPLSAVDSHVGKHIFENVISSSTGCLASKTRVLVTHGLTYLKHCDQLIVLKEGTISELGTYQELLNNSGAFA 834          

HSP 2 Score: 536.184 bits (1380), Expect = 3.893e-163
Identity = 294/592 (49.66%), Postives = 398/592 (67.23%), Query Frame = 2
Query: 2954 NKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIG--SGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            N +L+++E  + G VK EV+I Y Q  S    +L    Y       +  N  L+  S+     N     A+   LGIY  L   Q+  +LI S+ L  G+  AS+ LH  +L +I+R+P +FFD TP GRILNRIGKDI+ +D T+P+ +R    +   V++++++I  A+P+  +A   LS  YF + +FYI TSRQL+R++S  +SPIYSHFQESI G SSIRA+ V D F  + ++  D   + ++  I  NRW+   LE++GN+++L +   AV+ RD+ G  +GL GLSVSYAL IT +L   VR + ++E+N+V++ERIKEYT   +E   +         WP+ G+I   NFSVRYRPGLDL L  ++  +   EK+GIVGRTGAGKSSL LALFR+IE   G+I+ID I+I  L L  LRS LTI+PQDPVLFSG +++NLDPF+ YSD ++W ALE A+LK F      GLE  ISE GENLSVGQRQL+CLARALL+KT +LVLDEA AAVD+ETD LIQ +IR  FK CTVLTIAHRLNT+MD DR++VL +G++ E ++PK LLA+   +F+SMAKDA +
Sbjct:  936 NTQLIEKETVETGKVKFEVYIAYFQAISIPITLLFFFLYVGSSGLGILSNFYLAKLSDHAKSGNRTSSDAK-MELGIYAVLGMGQSFVVLIASIILTIGVLRASRILHAGLLGNIMRSPMAFFDVTPIGRILNRIGKDIEAIDRTLPDVIRHMSMTIFNVVATLVVIMWATPWAGIAFAILSVIYFIVLRFYISTSRQLKRLESASRSPIYSHFQESIQGASSIRAFGVVDNFIKQSQQRVDDHLIAYYPSIVANRWLAVRLEMVGNLIVLSAAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVSVERIKEYTVTPTEG--NNSRRLAAKSWPEKGEISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFRIIEADGGSIEIDGINIANLQLEQLRSCLTIVPQDPVLFSGTMKMNLDPFSAYSDSQVWEALENAHLKPFVKSLQDGLEHKISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLIQKTIREQFKECTVLTIAHRLNTVMDSDRLLVLDKGRVAEFDSPKNLLANPDGIFYSMAKDANV 1524          

HSP 3 Score: 91.6633 bits (226), Expect = 4.022e-18
Identity = 76/266 (28.57%), Postives = 128/266 (48.12%), Query Frame = 2
Query: 3905 VAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINL---DPFNL--YSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSC----TVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLL 4675
            V+  R+KE+   E  +P         S    +  IE  N    +    D  LR ++F +Q+G+ + IVG+ G+GKSSL  AL   +    G+++I                +  +PQ   + + +LR N+    P++L  Y D      ++   LK   A    G    I E G NLS GQ+Q V LARA+ +  +I++LD+  +AVD    + I  ++ ++   C    T + + H L  +   D+++VL++G I E+ T ++LL
Sbjct:  585 VSNTRLKEFFAAEEMSPQ-----TSISHGETDSAIEVENGLFSWSSDEDPTLREISFKIQKGQLVAIVGKVGSGKSSLLHALLGEMNKLSGSVQI-------------NGNIAYVPQQAWIQNMSLRNNILFNKPYDLENYED-----VVKNCALKEDLANLPAGDRTEIGEKGINLSGGQKQRVSLARAVYQNPDIILLDDPLSAVDSHVGKHIFENVISSSTGCLASKTRVLVTHGLTYLKHCDQLIVLKEGTISELGTYQELL 827          

HSP 4 Score: 71.633 bits (174), Expect = 4.566e-12
Identity = 71/241 (29.46%), Postives = 108/241 (44.81%), Query Frame = 2
Query: 2075 ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKE---PVAYVPQQAWCQNRSLQDNILFGKSM-----VYSKYH-----KVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTR--------ILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN-DGPF 2731
            ISI N +  +      +L  I+  I     V IVG  G+GKSSL  A+   +    G+++          + Q   C     QD +LF  +M      +S Y      + LE   L   +K L  G + +I E G NLS GQ+Q I LAR++ + + V + D+  +AVD             +D L+ KT R        + + H L  +  +D++ V+  G V+E  + K LL N DG F
Sbjct: 1286 ISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFRIIEADGGSIEIDGINIANLQLEQLRSCLTIVPQDPVLFSGTMKMNLDPFSAYSDSQVWEALENAHLKPFVKSLQDGLEHKISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVE-----------TDSLIQKTIREQFKECTVLTIAHRLNTVMDSDRLLVLDKGRVAEFDSPKNLLANPDGIF 1515          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 541.191 bits (1393), Expect = 7.211e-165
Identity = 296/593 (49.92%), Postives = 395/593 (66.61%), Query Frame = 2
Query: 2960 KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAG---TINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIG--SGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            +L+++E  + G VK EV++ Y +      A++  L Y +     V  N+ L+ WS+      ++ +   +     LGIY  L   QA  +   S+ +A GM  AS+ LH  +L +I+R+P +FFD TP GRILNR GKD+D VD  IP T+ +++ +    I  I II  A+P  I  L+PL   YF + +FY+ TSRQL+R++S  +SPIYSHFQESI G SSIRAY V DKF  + +   D++   ++  I  NRW+   LE++GN+++L S   AV+ RD+ G  +GL GLSVSYAL IT +L   VR + ++E+N+VA+ERI EYT   +E   +  +   P  WP+NG+I   NFSVRYRPGLDL L  +   +   EK+GIVGRTGAGKSSL LALFR+IE   G I+ID  +I  L L  LRS+LTI+PQDPVLFSG +R+NLDPF  +SD +IW AL  A+L SF      GL   ISE GENLSVGQRQL+CLARALL+KT +LVLDEA AAVD+ETD L+Q +IR  FK CTVLTIAHRLNT+MD DR++VL +G + E +TPKKLL++   +F+SMAKDA +
Sbjct:  943 QLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIALSGNGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDVDGVDTDIPRTMSMFIRTAVSSIEIIAIILWATPLAISLLLPLFIVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG--NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAKDANV 1533          

HSP 2 Score: 535.028 bits (1377), Expect = 1.129e-162
Identity = 335/873 (38.37%), Postives = 484/873 (55.44%), Query Frame = 2
Query:  176 TLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQ--FLQPILSAVFSLLVIYVNRLTYI--------------KGVHSSGILFIYWSLQLI--VNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADP-NNILTPQKAFVSISLFNILNFPMSMLPGAIVFT--IQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAP-ILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSS-DGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDG 2725
            T C Q+T  + IP +FL+I      PIL  +    Y +R  +  ++S     L  I+C  L       +V L   V    +L    S +++ +  Y + + Y               +G+ +SG++ +YW L ++  V  +  Y      K       R    +  +V   +    +CFAD+                      P+N    K      CPE  ASFL+++TF W + L Y G +K L  +DL+ L E D  + I+P        E++   RKI K                    N E+   K +       P  L  +  T  +     G  K+++D   F+ P +L   I+FI + N+ +W G      +FL S+ ++ I  Q+       G+  ++ + S +Y K L LS  +RK +T G IVNLMSVD  + QD   F  L W +P+ I++++YFLW+ LG + +AG V+LI ++P N+ I  K++  Q +QM+ KD RIK++SEIL+G+K+LKL++WE S+E+ V  +REKE  VL+K  +LNA T+++W C P LVA+ +FG YVL DP NN+LTPQ  FV+++LFNIL FP+++   A+VF+  +Q   S  R+  F   EE+ P         D  I +  G+F+WG  E    L DI   I+ G LV IVG VGSGKSSL+ A+LGEM K+SG+V+    VAYVPQ AW QN SL++NILF +      Y  V+E CAL++DL+ LPA D+TEIGEKGINLSGGQKQR+SLAR+VYQN+ + L DDPLSAVD+HVGKHIFE V S+  G L   TR+L+THGL YL   D++ V+KD  +SE GTY+EL+ ++G
Sbjct:   31 TNCGQHTDFSTIPTLFLVIFS----PILFYE---LYKSRNSY--LRSFSAISLRIIFCCLL-------VVDLTATVIYDFYLLFTKSPLYNAIHFYGDLVQYAGFCLALVLTIACRNRGIITSGVITLYWLLVVVCGVPELRYYITGRLYKEYEIHSCRAALYVFAYVCSALELFLSCFADT----------------------PSNGYIGKNS----CPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKK--------------------NPEAAIPKNH-------PSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVF--AMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNG 832          

HSP 3 Score: 76.2554 bits (186), Expect = 2.085e-13
Identity = 67/219 (30.59%), Postives = 112/219 (51.14%), Query Frame = 2
Query: 4049 DLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIW------IALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELI-QNSIRTA---FKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLL 4675
            D  L ++ F ++RG+ + IVGR G+GKSSL  AL   +    G++++                +  +PQ   + + +LR N+  FN   D +++       AL + +L+S  A+        I E G NLS GQ+Q V LARA+ +   I++LD+  +AVD    + I +N I TA     + T + + H L  +   D+V+VL+   I E+ T ++L+
Sbjct:  629 DRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQV-------------NGSVAYVPQLAWIQNLSLRNNI-LFNRPYDAKLYQNVIENCAL-VQDLESLPAED----RTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELM 828          

HSP 4 Score: 72.7886 bits (177), Expect = 2.069e-12
Identity = 76/278 (27.34%), Postives = 120/278 (43.17%), Query Frame = 2
Query: 1985 LVSAKRINHFL-------NGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAIL------GEMFKISGT-------VKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTR--------ILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN-DGPF 2731
            +V+ +RIN +        N + L P     S   +  ISI N +  +      +L  +   I     + IVG  G+GKSSL  A+       G   +I GT        + +  +  VPQ     + +++ N+    +    +  + L    L   +K L  G    I E G NLS GQ+Q I LAR++ + + V + D+  +AVD             +D LL KT R        + + H L  +  +D++ V+  G V+E  T K+LL N DG F
Sbjct: 1262 IVAVERINEYTITPTEGNNSQSLAPK----SWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVE-----------TDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIF 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 539.65 bits (1389), Expect = 2.302e-164
Identity = 293/593 (49.41%), Postives = 399/593 (67.28%), Query Frame = 2
Query: 2960 KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAG---TINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIG--SGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            +L+++E  + G VK EV++ Y +      A++  L Y +     V  N+ L+ WS+      ++ +   +     LGIY  L   QA  +   S+ +A GM  AS+ LH  +L +I+R+P +FFD TP GRILNR GKDI+ +D T+P+++R  + +   VIS++ +I  A+P+  +  + L F YF + +FY+ TSRQL+R++S  +SPIYSHFQESI G SSIRAY V DKF  + +   D++   ++  I  NRW+   LE++GN+++L S   AV+ RD+ G  +GL GLSVSYAL IT +L   VR + ++E+N+VA+ERI EYT   +E   +  +   P  WP+NG+I   NFSVRYRPGLDL L  +   +   EK+GIVGRTGAGKSSL LALFR+IE   G I+ID  +I  L L  LRS+LTI+PQDPVLFSG +R+NLDPF  +SD +IW AL  A+L SF      GL   ISE GENLSVGQRQL+CLARALL+KT +LVLDEA AAVD+ETD L+Q +IR  FK CTVLTIAHRLNT+MD DR++VL +G + E +TPKKLL++   +F+SMAKDA +
Sbjct:  943 QLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIALSGNGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIEAIDQTLPHSIRAMVMTIFNVISTVFVIIWATPWAGIGFLVLGFVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG--NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAKDANV 1533          

HSP 2 Score: 534.258 bits (1375), Expect = 2.026e-162
Identity = 335/873 (38.37%), Postives = 484/873 (55.44%), Query Frame = 2
Query:  176 TLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQ--FLQPILSAVFSLLVIYVNRLTYI--------------KGVHSSGILFIYWSLQLI--VNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADP-NNILTPQKAFVSISLFNILNFPMSMLPGAIVFT--IQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAP-ILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSS-DGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDG 2725
            T C Q+T  + IP +FL+I      PIL  +    Y +R  +  ++S     L  I+C  L       +V L   V    +L    S +++ +  Y + + Y               +G+ +SG++ +YW L ++  V  +  Y      K       R    +  +V   +    +CFAD+                      P+N    K      CPE  ASFL+++TF W + L Y G +K L  +DL+ L E D  + I+P        E++   RKI K                    N E+   K +       P  L  +  T  +     G  K+++D   F+ P +L   I+FI + N+ +W G      +FL S+ ++ I  Q+       G+  ++ + S +Y K L LS  +RK +T G IVNLMSVD  + QD   F  L W +P+ I++++YFLW+ LG + +AG V+LI ++P N+ I  K++  Q +QM+ KD RIK++SEIL+G+K+LKL++WE S+E+ V  +REKE  VL+K  +LNA T+++W C P LVA+ +FG YVL DP NN+LTPQ  FV+++LFNIL FP+++   A+VF+  +Q   S  R+  F   EE+ P         D  I +  G+F+WG  E    L DI   I+ G LV IVG VGSGKSSL+ A+LGEM K+SG+V+    VAYVPQ AW QN SL++NILF +      Y  V+E CAL++DL+ LPA D+TEIGEKGINLSGGQKQR+SLAR+VYQN+ + L DDPLSAVD+HVGKHIFE V S+  G L   TR+L+THGL YL   D++ V+KD  +SE GTY+EL+ ++G
Sbjct:   31 TNCGQHTDFSTIPTLFLVIFS----PILFYE---LYKSRNSY--LRSFSAISLRIIFCCLL-------VVDLTATVIYDFYLLFTKSPLYNAIHFYGDLVQYAGFCLALVLTIACRNRGIITSGVITLYWLLVVVCGVPELRYYITGRLYKEYEIHSCRAALYVFAYVCSALELFLSCFADT----------------------PSNGYIGKNS----CPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKK--------------------NPEAAIPKNH-------PSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVF--AMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNG 832          

HSP 3 Score: 76.2554 bits (186), Expect = 2.193e-13
Identity = 67/219 (30.59%), Postives = 112/219 (51.14%), Query Frame = 2
Query: 4049 DLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIW------IALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELI-QNSIRTA---FKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLL 4675
            D  L ++ F ++RG+ + IVGR G+GKSSL  AL   +    G++++                +  +PQ   + + +LR N+  FN   D +++       AL + +L+S  A+        I E G NLS GQ+Q V LARA+ +   I++LD+  +AVD    + I +N I TA     + T + + H L  +   D+V+VL+   I E+ T ++L+
Sbjct:  629 DRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQV-------------NGSVAYVPQLAWIQNLSLRNNI-LFNRPYDAKLYQNVIENCAL-VQDLESLPAED----RTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELM 828          

HSP 4 Score: 72.7886 bits (177), Expect = 2.232e-12
Identity = 76/278 (27.34%), Postives = 120/278 (43.17%), Query Frame = 2
Query: 1985 LVSAKRINHFL-------NGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAIL------GEMFKISGT-------VKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTR--------ILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN-DGPF 2731
            +V+ +RIN +        N + L P     S   +  ISI N +  +      +L  +   I     + IVG  G+GKSSL  A+       G   +I GT        + +  +  VPQ     + +++ N+    +    +  + L    L   +K L  G    I E G NLS GQ+Q I LAR++ + + V + D+  +AVD             +D LL KT R        + + H L  +  +D++ V+  G V+E  T K+LL N DG F
Sbjct: 1262 IVAVERINEYTITPTEGNNSQSLAPK----SWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVE-----------TDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIF 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-4 (pep chromosome:WBcel235:X:9884278:9889704:1 gene:WBGene00003410.1 transcript:F21G4.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-4)

HSP 1 Score: 539.265 bits (1388), Expect = 6.263e-164
Identity = 302/595 (50.76%), Postives = 404/595 (67.90%), Query Frame = 2
Query: 2957 KKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWS-----EAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDI-PEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++L   E  + G VK++ +  Y        A+L +L   +     +  N+ L+ WS      +G+    Q +A R   LG+Y GL F++ I + I  LSL YG   AS+ LH  ++R++ R P +F+DTTP GRILNRIGKDI+TVDV +P  V+ +     +V+S++III I++P F + +IPLS  Y  + ++YI TSRQL+R++SI +SPIYSH  ESI G+++IRAY + D+F    E   D      +L    NRW+   LE IGN ++L S +FA   R T  SG+ GLSVSYAL ITT L   VR    +E+N+V++ER+KEY E E+EA W   P  +PP  WP  G+I  +N+S RYRPGL+L ++ LN  ++  EK+GIVGRTGAGKSS+ L+LFR+IE AEG I +D I++  +GLHDLRS LTIIPQDPVLFSG LR NLDPFN YSDG+IW  LE+ANLK F    +  L + I+E G+N+SVGQRQLVCLARALL+KT +L+LDEATAAVD+ TD LIQ +IR  F + TVLTIAHRLNTIMDYDR++VL  G++ E ++P  LL++  S F+SMAK AGL
Sbjct:  981 RQLTGTERVETGRVKMDTYYKYFGAMGMSIAVLFVLGMTTSTIFSMGRNLWLTDWSNDNAARSGSNTTGQPIAIR---LGVYAGLGFSEIILLFIGMLSLLYGGVSASRNLHAPLMRNLFRVPMAFYDTTPFGRILNRIGKDIETVDVLLPFNVQFFAQCLLQVVSTLIIIMISTPVFGIVIIPLSVMYLMVMRYYIATSRQLKRLESITRSPIYSHLSESIQGSATIRAYHLVDRFCKLSETKVDSHVQCRYLNYVANRWLSVRLEFIGNCIVLFSALFAALTRTTTTSGVIGLSVSYALNITTVLNFAVRQITKLETNIVSVERVKEYAETETEAEWKSEPGKEPPQNWPSEGRIVMNNYSARYRPGLNLVVKQLNVEIKPHEKVGIVGRTGAGKSSVTLSLFRIIEAAEGQIVVDGINLAEIGLHDLRSNLTIIPQDPVLFSGTLRFNLDPFNHYSDGDIWKTLEMANLKEFATAHNEQLNYIITEGGDNISVGQRQLVCLARALLRKTRVLILDEATAAVDVSTDALIQKTIREEFANATVLTIAHRLNTIMDYDRIIVLNDGKVGEFDSPANLLSNRNSEFYSMAKRAGL 1572          

HSP 2 Score: 451.055 bits (1159), Expect = 2.189e-132
Identity = 299/877 (34.09%), Postives = 466/877 (53.14%), Query Frame = 2
Query:  182 CFQYTILNWIP--LMFLIIGCAINIPILLRKKSIYYSTRGKFNI-IKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPI--LSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAI--ILYSRSIRVKTPAN-----DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK-------PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE-VSTSNDKPISIVNGNFSWGENE---APILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFI 2743
            C+Q+T L W P  ++FL+           R   I ++ R +  I +  IL+     ++ + ++++         P    F+ P+    A+  L  + V+   Y  G+ +SG LFI W L   ++AI  +LY    ++  PA      D  R I   I F         +C+AD++        ++ N                        PE  +SFL++IT  W   L   G +KPL + DLY L E D+   +VP     W+++  +      +++     S ++ R  S        N + T+     P        P  +  L     +    +  +K++ D   F  P +L   I F       +W G    F +F  +   + +   + ++    G R +T + + +Y+K L+LS A+R+E+TVGEIVNLM++D  +FQ         W +P  I + ++ L+Q+LG +  +G+ +++ + PIN VI   I+K Q  QM  KD R K+++E+L+GIK++KL+AWE  +E+ ++ +RE+E  +++KA FL  F+ +    +P LVAL +F  ++  DP N+LTP+ AFVS++LFN L  PMS +   I  T+Q +VS +R+  FL  EEL+ + ++  +  N+  I +     SW   E    P L +I+  +  G LV IVG VG+GKSS++ A++GEM K+SG++     + YVPQQ W QN +L+ NI FGK      Y +VL+ACAL  DL+ILP GD TEIGEKGINLSGGQK RISLAR+VYQN  +YL DDP+SAVDAHVG  +F  V   +G+L   TRILVT+ L++L K+D I VM +G +  +G Y +L++  G F   +
Sbjct:   37 CYQHTTLVWFPTAIVFLLAPILTAQIFYRRPNPIPWTRRIQLKIGLACILIADSLSLFTVAIYETLFQGF----PYAVDFVYPLTLCLAMVVLTALIVSCRNY--GIVTSGGLFISW-LVFTISAIPELLYWIQ-QIVNPAEAWNWIDYPRCIAFFIWFFCCAFETYLHCYADASPEGYKYLSAARNP----------------------SPETTSSFLNRITMWWFNSLCSLGVKKPLEVSDLYSLNEADTSNLLVPKWYNLWDKQSKKFEETAARRRIGSNASRTNRRRTSSNDTTPLLNDQSTDDYGSVPAGQSTQKMPSIIWTLFLMFKWDVITAMFVKLLSDVLLFCNPLLLKSLIRFTEELERPMWQGVVLAFTMFFSAELSSILLSHYFYLMYRVGTRVQTCLTAAVYRKTLRLSNAARREKTVGEIVNLMAIDVDRFQQITPQTMQYWSNPFQIGLALFLLFQQLGVSVFSGVAVMVLLFPINFVITMIIRKWQIAQMYYKDERTKMVNEVLNGIKVIKLYAWEPPMEQVIEDLREQELGLIKKAAFLRTFSDMLNTASPFLVALSTFATFIYIDPKNVLTPEIAFVSLTLFNQLRSPMSQVAELITQTVQVVVSNRRLKEFLVSEELNVEAIDHRARDNNDVICLKEACLSWESAEHQPVPTLTNISFSVNRGQLVTIVGRVGAGKSSMLQALMGEMEKLSGSISMHGRLCYVPQQPWMQNNTLRQNITFGKQFDEYFYSRVLDACALYRDLQILPLGDNTEIGEKGINLSGGQKARISLARAVYQNHDIYLLDDPMSAVDAHVGSQLFGSVIGPEGMLRNKTRILVTNELSFLEKSDLIIVMNEGKIEYSGKYDDLMQQ-GAFEQLL 882          

HSP 3 Score: 75.8702 bits (185), Expect = 2.614e-13
Identity = 56/200 (28.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query: 4058 LRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIK 4648
            L N++F+V RG+ + IVGR GAGKSS+  AL   +E   G+               +  +L  +PQ P + +  LR N+     + +      L+   L        LG    I E G NLS GQ+  + LARA+ +  +I +LD+  +AVD      +  S+       ++ T + + + L+ +   D ++V+ +G+I+
Sbjct:  678 LTNISFSVNRGQLVTIVGRVGAGKSSMLQALMGEMEKLSGS-------------ISMHGRLCYVPQQPWMQNNTLRQNITFGKQFDEYFYSRVLDACALYRDLQILPLGDNTEIGEKGINLSGGQKARISLARAVYQNHDIYLLDDPMSAVDAHVGSQLFGSVIGPEGMLRNKTRILVTNELSFLEKSDLIIVMNEGKIE 864          

HSP 4 Score: 61.2326 bits (147), Expect = 8.429e-9
Identity = 59/220 (26.82%), Postives = 94/220 (42.73%), Query Frame = 2
Query: 2123 ILRDINLEIEEGSLVMIVGTVGSGKSS-------LISAILGEMFKIS------GTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTR--------ILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN 2719
            +++ +N+EI+    V IVG  G+GKSS       +I A  G++          G    +  +  +PQ     + +L+ N+            K LE   L E            I E G N+S GQ+Q + LAR++ + + V + D+  +AVD            S+D L+ KT R        + + H L  +   D+I V+ DG V E  +   LL N
Sbjct: 1350 VVKQLNVEIKPHEKVGIVGRTGAGKSSVTLSLFRIIEAAEGQIVVDGINLAEIGLHDLRSNLTIIPQDPVLFSGTLRFNLDPFNHYSDGDIWKTLEMANLKEFATAHNEQLNYIITEGGDNISVGQRQLVCLARALLRKTRVLILDEATAAVDV-----------STDALIQKTIREEFANATVLTIAHRLNTIMDYDRIIVLNDGKVGEFDSPANLLSN 1558          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090023)

HSP 1 Score: 1222.22 bits (3161), Expect = 0.000e+0
Identity = 695/1571 (44.24%), Postives = 990/1571 (63.02%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTR-GKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQF--LQPILS-AVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVN--------------AIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHN-EYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYL-------------------XXXXXXXXXXXXXXXKLIKQE-LRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVK-PPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             W++   W T +PD T CF+ T L W P  F       +   L  K S+  +    K N+ K+++  GL  I  LDL  +   +    + P+       PI+  A F LL I++  L    GV ++G  FI+W L  +++                IL S+    +  + ++++F++  I F    I  I NCFAD  + +QT  +   N++                      PEL ASFLS+IT+ W  ++  +G+R PL   DL+ L+ +DSC E++PI    WN+ + + ++    +  ++ ++  S+   +  + + E N RK  ++   P       +  +    F F  L+K+  D   F QP +L   I+F+   + E  W G  Y   +F+++ A+TFI  Q+     + G+R +TA+I+ IY+KAL++S +++KE TVGEIVNLM+VDA +F +   + +++W +P+ I + +YFLWQ+LGP+ +AGL ++I ++P+N VI S+IK  Q +QM+ KD R+KL++E+LSGIK+LKL+AWE S E++V  IR+KE   LR   +LNA TS  W C P LV+L +F  YVL D NN+L   K FVS+SLFNIL FP++MLP  I   +Q  VS  RIN FLN EELDP++V   +S   P+SI NG FSWG+     LR+IN+E+++GSLV +VGTVGSGKSS++ A LGEM K++G V     +AYVPQQAW QN +++DNILFG++    +Y+KV++ACAL  D+ IL AGD TEIGEKGINLSGGQKQRISLAR+VY ++ +YL DDPLSAVDAHVGKHIFE+V    G+L++ +R+LVTHG+ +L + D I+V+K G +SE+GT+ +L+KN G FADFI  +L                     D  E     ++  KL + E L   +S+T +     G    RR +       S +   + +K   V  KL++ E ++ GGV+  V+ +YI+      ++  ++    + A  +  N+ L+ W+    + N  D   RD +LG+YG   F Q       SL+LA G    SK LH  +L  + R P   FDTTP GR++NR  KD+DT+D  +P   R+ ++    V+++I++I +++P F+  ++P++F Y+F Q+FY+ TSRQL R++S+ +SPIYSHF E++ G S+IRAY V D+F  + +   DK+Q+  +  +  NRW+   LE++GN++IL + +FAV    T   GL GLSVSYAL +T +L  +VR S DIE+N+V++ERIKEY E + EAPW++ + K  P  WPQ G++EF NF VRYR GLDL LR ++F +Q GEK+GIVGRTGAGKSSL LALFR+IE A G I ID +DI  +GLH LRS+LTIIPQDPVLFSG+LRINLDPF + +D EIW ALE+++LKSF      GL   I+E GENLSVGQRQLVCLARALL+KT +LVLDEATAAVD+ETD+LIQ +IRT FK CTVLTIAHRLNTI+D D+V+VL +GQI E  +P +LL + KS F+SMAKDA L
Sbjct:   17 FWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYL--KASLDRNIPWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFLLLFIFIP-LNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-MPRQTKYQRGENEI----------------------PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKN---KARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPP------IYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAN--DTGLRDMYLGVYGAFGFGQVTSYFFCSLTLALGCIFCSKVLHETLLSYVFRWPMELFDTTPLGRVVNRFSKDVDTIDNVLPMLWRMVISQAFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGGQT-NPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANL 1547          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090026)

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 693/1571 (44.11%), Postives = 994/1571 (63.27%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTR-GKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQF--LQPILS-AVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVN--------------AIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHN-EYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYL-------------------XXXXXXXXXXXXXXXKLIKQE-LRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVK-PPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             W++   W T +PD T CF+ T L W P  F       +   L  K S+  +    K N+ K+++  GL  I  LDL  +   +    + P+       PI+  A F LL I++  L    GV ++G  FI+W L  +++                IL S+    +  + ++++F++  I F    I  I NCFAD  + +QT  +   N++                      PEL ASFLS+IT+ W  ++  +G+R PL   DL+ L+ +DSC E++PI    WN+ + + ++    +  ++ ++  S+   +  + + E N RK  ++   P       +  +    F F  L+K+  D   F QP +L   I+F+   + E  W G  Y   +F+++ A+TFI  Q+     + G+R +TA+I+ IY+KAL++S +++KE TVGEIVNLM+VDA +F +   + +++W +P+ I + +YFLWQ+LGP+ +AGL ++I ++P+N VI S+IK  Q +QM+ KD R+KL++E+LSGIK+LKL+AWE S E++V  IR+KE   LR   +LNA TS  W C P LV+L +F  YVL D NN+L   K FVS+SLFNIL FP++MLP  I   +Q  VS  RIN FLN EELDP++V   +S   P+SI NG FSWG+     LR+IN+E+++GSLV +VGTVGSGKSS++ A LGEM K++G V     +AYVPQQAW QN +++DNILFG++    +Y+KV++ACAL  D+ IL AGD TEIGEKGINLSGGQKQRISLAR+VY ++ +YL DDPLSAVDAHVGKHIFE+V    G+L++ +R+LVTHG+ +L + D I+V+K G +SE+GT+ +L+KN G FADFI  +L                     D  E     ++  KL + E L   +S+T +     G    RR +       S +   + +K   V  KL++ E ++ GGV+  V+ +YI+      ++  ++    + A  +  N+ L+ W+    + N  D   RD +LG+YG   F Q +   + +L L+ G   +++ +HNV+L   +R P   FD TP GRI+NR  KD+DT+D T+P  +R+ +     V+++I++I +++P F+  ++P++F Y+F Q+FY+ TSRQL R++S+ +SPIYSHF E++ G S+IRAY V D+F  + +   DK+Q+  +  +  NRW+   LE++GN++IL + +FAV    T   GL GLSVSYAL +T +L  +VR S DIE+N+V++ERIKEY E + EAPW++ + K  P  WPQ G++EF NF VRYR GLDL LR ++F +Q GEK+GIVGRTGAGKSSL LALFR+IE A G I ID +DI  +GLH LRS+LTIIPQDPVLFSG+LRINLDPF + +D EIW ALE+++LKSF      GL   I+E GENLSVGQRQLVCLARALL+KT +LVLDEATAAVD+ETD+LIQ +IRT FK CTVLTIAHRLNTI+D D+V+VL +GQI E  +P +LL + KS F+SMAKDA L
Sbjct:   17 FWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYL--KASLDRNIPWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFLLLFIFIP-LNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-MPRQTKYQRGENEI----------------------PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKN---KARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPP------IYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDEIT--LRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAN--DTGLRDMYLGVYGAFGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEMFDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGGQT-NPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANL 1547          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090025)

HSP 1 Score: 1218.37 bits (3151), Expect = 0.000e+0
Identity = 693/1571 (44.11%), Postives = 997/1571 (63.46%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTR-GKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQF--LQPILS-AVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVN--------------AIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHN-EYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXX-------------------XXXXXXKLIKQE-LRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVK-PPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             W++   W T +PD T CF+ T L W P  F       +   L  K S+  +    K N+ K+++  GL  I  LDL  +   +    + P+       PI+  A F LL I++  L    GV ++G  FI+W L  +++                IL S+    +  + ++++F++  I F    I  I NCFAD  + +QT  +   N++                      PEL ASFLS+IT+ W  ++  +G+R PL   DL+ L+ +DSC E++PI    WN+ + + ++    +  ++ ++  S+   +  + + E N RK  ++   P       +  +    F F  L+K+  D   F QP +L   I+F+   + E  W G  Y   +F+++ A+TFI  Q+     + G+R +TA+I+ IY+KAL++S +++KE TVGEIVNLM+VDA +F +   + +++W +P+ I + +YFLWQ+LGP+ +AGL ++I ++P+N VI S+IK  Q +QM+ KD R+KL++E+LSGIK+LKL+AWE S E++V  IR+KE   LR   +LNA TS  W C P LV+L +F  YVL D NN+L   K FVS+SLFNIL FP++MLP  I   +Q  VS  RIN FLN EELDP++V   +S   P+SI NG FSWG+     LR+IN+E+++GSLV +VGTVGSGKSS++ A LGEM K++G V     +AYVPQQAW QN +++DNILFG++    +Y+KV++ACAL  D+ IL AGD TEIGEKGINLSGGQKQRISLAR+VY ++ +YL DDPLSAVDAHVGKHIFE+V    G+L++ +R+LVTHG+ +L + D I+V+K G +SE+GT+ +L+KN G FADFI  +L++ ++E  E                     ++  KL + E L   +S+T +     G    RR +       S +   + +K   V  KL++ E ++ GGV+  V+ +YI+      ++  ++    + A  +  N+ L+ W+    + N  D   RD +LG+YG   F Q        L+ A G   A+K LH+++L +++RAP + FDTTP GRIL+R  KD+++VD  +P  +   +     V+++I++I +++P F+  ++P++F Y+F Q+FY+ TSRQL R++S+ +SPIYSHF E++ G S+IRAY V D+F  + +   DK+Q+  +  +  NRW+   LE++GN++IL + +FAV    T   GL GLSVSYAL +T +L  +VR S DIE+N+V++ERIKEY E + EAPW++ + K  P  WPQ G++EF NF VRYR GLDL LR ++F +Q GEK+GIVGRTGAGKSSL LALFR+IE A G I ID +DI  +GLH LRS+LTIIPQDPVLFSG+LRINLDPF + +D EIW ALE+++LKSF      GL   I+E GENLSVGQRQLVCLARALL+KT +LVLDEATAAVD+ETD+LIQ +IRT FK CTVLTIAHRLNTI+D D+V+VL +GQI E  +P +LL + KS F+SMAKDA L
Sbjct:   17 FWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYL--KASLDRNIPWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFLLLFIFIP-LNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-MPRQTKYQRGENEI----------------------PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKN---KARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPP------IYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAN--DTGLRDMYLGVYGAFGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTMFDTTPVGRILSRFSKDVESVDQKMPQVINDCIWCAFEVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGGQT-NPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANL 1547          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090022)

HSP 1 Score: 1217.99 bits (3150), Expect = 0.000e+0
Identity = 694/1571 (44.18%), Postives = 994/1571 (63.27%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTR-GKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQF--LQPILS-AVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVN--------------AIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHN-EYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXX-------------------XXXXXXKLIKQE-LRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVK-PPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             W++   W T +PD T CF+ T L W P  F       +   L  K S+  +    K N+ K+++  GL  I  LDL  +   +    + P+       PI+  A F LL I++  L    GV ++G  FI+W L  +++                IL S+    +  + ++++F++  I F    I  I NCFAD  + +QT  +   N++                      PEL ASFLS+IT+ W  ++  +G+R PL   DL+ L+ +DSC E++PI    WN+ + + ++    +  ++ ++  S+   +  + + E N RK  ++   P       +  +    F F  L+K+  D   F QP +L   I+F+   + E  W G  Y   +F+++ A+TFI  Q+     + G+R +TA+I+ IY+KAL++S +++KE TVGEIVNLM+VDA +F +   + +++W +P+ I + +YFLWQ+LGP+ +AGL ++I ++P+N VI S+IK  Q +QM+ KD R+KL++E+LSGIK+LKL+AWE S E++V  IR+KE   LR   +LNA TS  W C P LV+L +F  YVL D NN+L   K FVS+SLFNIL FP++MLP  I   +Q  VS  RIN FLN EELDP++V   +S   P+SI NG FSWG+     LR+IN+E+++GSLV +VGTVGSGKSS++ A LGEM K++G V     +AYVPQQAW QN +++DNILFG++    +Y+KV++ACAL  D+ IL AGD TEIGEKGINLSGGQKQRISLAR+VY ++ +YL DDPLSAVDAHVGKHIFE+V    G+L++ +R+LVTHG+ +L + D I+V+K G +SE+GT+ +L+KN G FADFI  +L++ ++E  E                     ++  KL + E L   +S+T +     G    RR +       S +   + +K   V  KL++ E ++ GGV+  V+ +YI+      ++  ++    + A  +  N+ L+ W+    + N  D   RD +LG+YG   F Q       SL+++ G    S+ LH  +L   +R P   FDTTP GRI+NR  KDIDT+D  +P  +R+ +     V+++I++I +++P F+  ++P++F Y+F Q+FY+ TSRQL R++S+ +SPIYSHF E++ G S+IRAY V D+F  + +   DK+Q+  +  +  NRW+   LE++GN++IL + +FAV    T   GL GLSVSYAL +T +L  +VR S DIE+N+V++ERIKEY E + EAPW++ + K  P  WPQ G++EF NF VRYR GLDL LR ++F +Q GEK+GIVGRTGAGKSSL LALFR+IE A G I ID +DI  +GLH LRS+LTIIPQDPVLFSG+LRINLDPF + +D EIW ALE+++LKSF      GL   I+E GENLSVGQRQLVCLARALL+KT +LVLDEATAAVD+ETD+LIQ +IRT FK CTVLTIAHRLNTI+D D+V+VL +GQI E  +P +LL + KS F+SMAKDA L
Sbjct:   17 FWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYL--KASLDRNIPWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFLLLFIFIP-LNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-MPRQTKYQRGENEI----------------------PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKN---KARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPP------IYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAN--DTGLRDMYLGVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRFSKDIDTIDNVLPFNIRVVIGQAYMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGGQT-NPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANL 1547          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090021)

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 694/1572 (44.15%), Postives = 994/1572 (63.23%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTR-GKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQF--LQPILS-AVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVN--------------AIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHN-EYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXX-------------------XXXXXXKLIKQE-LRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAP-NSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVK-PPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             W++   W T +PD T CF+ T L W P  F       +   L  K S+  +    K N+ K+++  GL  I  LDL  +   +    + P+       PI+  A F LL I++  L    GV ++G  FI+W L  +++                IL S+    +  + ++++F++  I F    I  I NCFAD  + +QT  +   N++                      PEL ASFLS+IT+ W  ++  +G+R PL   DL+ L+ +DSC E++PI    WN+ + + ++    +  ++ ++  S+   +  + + E N RK  ++   P       +  +    F F  L+K+  D   F QP +L   I+F+   + E  W G  Y   +F+++ A+TFI  Q+     + G+R +TA+I+ IY+KAL++S +++KE TVGEIVNLM+VDA +F +   + +++W +P+ I + +YFLWQ+LGP+ +AGL ++I ++P+N VI S+IK  Q +QM+ KD R+KL++E+LSGIK+LKL+AWE S E++V  IR+KE   LR   +LNA TS  W C P LV+L +F  YVL D NN+L   K FVS+SLFNIL FP++MLP  I   +Q  VS  RIN FLN EELDP++V   +S   P+SI NG FSWG+     LR+IN+E+++GSLV +VGTVGSGKSS++ A LGEM K++G V     +AYVPQQAW QN +++DNILFG++    +Y+KV++ACAL  D+ IL AGD TEIGEKGINLSGGQKQRISLAR+VY ++ +YL DDPLSAVDAHVGKHIFE+V    G+L++ +R+LVTHG+ +L + D I+V+K G +SE+GT+ +L+KN G FADFI  +L++ ++E  E                     ++  KL + E L   +S+T +     G    RR +       S +   + +K   V  KL++ E ++ GGV+  V+ +YI+      ++  ++    + A  +  N+ L+ W+    + N  D   RD +LG+YG   F Q +      + +  G F A+KT+HN +L  IIR     FFD TP GR+LN    D+D VD  +P T+  ++T    V+++I++I +++P F+  ++P++F Y+F Q+FY+ TSRQL R++S+ +SPIYSHF E++ G S+IRAY V D+F  + +   DK+Q+  +  +  NRW+   LE++GN++IL + +FAV    T   GL GLSVSYAL +T +L  +VR S DIE+N+V++ERIKEY E + EAPW++ + K  P  WPQ G++EF NF VRYR GLDL LR ++F +Q GEK+GIVGRTGAGKSSL LALFR+IE A G I ID +DI  +GLH LRS+LTIIPQDPVLFSG+LRINLDPF + +D EIW ALE+++LKSF      GL   I+E GENLSVGQRQLVCLARALL+KT +LVLDEATAAVD+ETD+LIQ +IRT FK CTVLTIAHRLNTI+D D+V+VL +GQI E  +P +LL + KS F+SMAKDA L
Sbjct:   17 FWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYL--KASLDRNIPWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFLLLFIFIP-LNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-MPRQTKYQRGENEI----------------------PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKN---KARVEPKAQFSNGNVTFENPHGEKNGRKKGMASIMPP------IYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAN--DTGLRDMYLGVYGAFGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCRFFDITPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGGQT-NPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANL 1548          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 1233.78 bits (3191), Expect = 0.000e+0
Identity = 691/1556 (44.41%), Postives = 977/1556 (62.79%), Query Frame = 2
Query:  104 CSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP--ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTY-----------LXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAI-LCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            CS    D  LW  N  W T  PDLT CFQ T+L WIP ++L +   + I + L+     Y      N  K+++   L+ I   D+F S  ++  G        + P +  V  LL  ++ +   +KGV SSG++  +W + ++   I   S+ +  +  PA+   FR+ T  I + ++ IS I  C +D   +   + K S+                        CPE  ASFLSKITF W T L+ +G+++PL   DL+ L  ED  + +VP + R W++E  +V R + K  Y    ST   +    P E  ES        + T +P     L  T    F  S L K+I+D   F+ P IL   I F+ + +   WHG+FY   +F+ +  +T I Q++  +C VTG+R +TAI+  +Y+KAL ++ A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLWQ LG + +AG+ +++ M+P+NAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWEL+ + KV  IRE E  VL+K  +L A ++  W C P LVAL +F  YVL D NNIL  QKAFVS++LFNIL FP++MLP  I   +Q  VS +R+  FL+ EELD DNVE    +  P  I I +G FSW +++ P L+ IN+ I EG+LV +VG VGSGKSSL+SA+LGEM K  G+V  K  VAYVPQQAW QN +L+DNILFG+    S Y KV+EACAL+ DL+ILP GD TEIGEKG+NLSGGQKQR+S+AR+VY N SVYL DDPLSAVDAHVGKHIFEKV    GLL   TR+LVTHGL++L +AD I VM DG ++E G+Y ELL   G FA+F+RTY           L         +    + L++Q      +       +K EA     ++ +  +++               +L + + A  G VKL VF  Y++      ++ +I L +C +L++L S N  LS W++   +NN+Q    R+  LG+YG L  +Q I +   S+S++ G  LAS+ LH  ML +++R+P SFF+ TPSG ++NR  K+ DT+D  IP+ +++++ S   V+ S  +I IA+P   + + PL   YFF+Q+FY+ +SRQ++R++S+ +SP+Y+HF E+++GTS IRA+    +F  + +   D +Q  +F  I  NRW+   LE +GN ++  + +FAV  R+ +  G+ GLS+SYAL +T SL  +VR S ++E+N+VA+ER+KEY + E EA W +     P  WP  G IE   F +RYR  L+LA+ +++  +  GEK+GIVGRTGAGKSSL L LFR+IE AEG I+ID ++I  LGLH+LRS++TIIPQDPVLFSG+LR+NLDPF+ Y+D E+W +LE+A+LK+F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +GQ+ E ++P  L+A +K +F+ MAKD+GL
Sbjct:    7 CSLDGSD-PLWDWNRTWQTYYPDLTPCFQNTVLVWIPCLYLWLFAPLYI-LYLKSHDRGYICMTHLNRAKTVIGFTLWLICWADVFYSFWERSHGATVAPVYLVSPTMLGVTMLLATFLIQYERMKGVQSSGVMLNFWLITIVCATITFRSKIMHALNDPASVGVFRYTTFYIYYTLLLISLILACLSDQPPLFSEVVKDSNP-----------------------CPESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKRPVDKTLYSPKRSTRGEKKDGQPVE--ESEILLAKALQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAPTWHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFLSHEELDDDNVERPAISGTPDSIRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVDGEITEMGSYTELLGRQGAFAEFLRTYTNTEQEEGEESLGDAVPRKGLENGGPAALLRQSQISLNATGAGKTTQKTEANDDAAATKTKSAEA--------------SRLTEADKANTGRVKLSVFWEYMKAIGLPLSIFSIFLFFCHHLSSLGS-NYWLSLWTDDPVVNNTQ--PKREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNNLSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIA-KKGIFYKMAKDSGL 1517          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 692/1553 (44.56%), Postives = 975/1553 (62.78%), Query Frame = 2
Query:  104 CSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSA--------VFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP--ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAI-LCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            CS    D  LW  N  W T  PDLT CFQ T+L WIP ++L +   + I + L+     Y      N  K+++   L+ I   D+F S  ++  G        + P +          VF LL  ++ +   +KGV SSG++  +W + ++   I   S+ +  +  PA+   FR+ T  I + ++ IS I  C +D   +   + K S+                        CPE  ASFLSKITF W T L+ +G+++PL   DL+ L  ED  + +VP + R W++E  +V R + K  Y    ST   +    P E  ES        + T +P     L  T    F  S L K+I+D   F+ P IL   I F+ + +   WHG+FY   +F+ +  +T I Q++  +C VTG+R +TAI+  +Y+KAL ++ A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLWQ LG + +AG+ +++ M+P+NAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWEL+ + KV  IRE E  VL+K  +L A ++  W C P LVAL +F  YVL D NNIL  QKAFVS++LFNIL FP++MLP  I   +Q  VS +R+  FL+ EELD DNVE    +  P  I I +G FSW +++ P L+ IN+ I EG+LV +VG VGSGKSSL+SA+LGEM K  G+V  K  VAYVPQQAW QN +L+DNILFG+    S Y KV+EACAL+ DL+ILP GD TEIGEKG+NLSGGQKQR+S+AR+VY N SVYL DDPLSAVDAHVGKHIFEKV    GLL   TR+LVTHGL++L +AD I VM DG ++E G+Y ELL   G FA+F+RTY       ++E  + E  L  ++  + LS  +     K ++                             +L + + A  G VKL VF  Y++      ++ +I L +C +L++L S N  LS W++   +NN+Q    R+  LG+YG L  +Q I +   S+S++ G  LAS+ LH  ML +++R+P SFF+ TPSG ++NR  K+ DT+D  IP+ +++++ S   V+ S  +I IA+P   + + PL   YFF+Q+FY+ +SRQ++R++S+ +SP+Y+HF E+++GTS IRA+    +F  + +   D +Q  +F  I  NRW+   LE +GN ++  + +FAV  R+ +  G+ GLS+SYAL +T SL  +VR S ++E+N+VA+ER+KEY + E EA W +     P  WP  G IE   F +RYR  L+LA+ +++  +  GEK+GIVGRTGAGKSSL L LFR+IE AEG I+ID ++I  LGLH+LRS++TIIPQDPVLFSG+LR+NLDPF+ Y+D E+W +LE+A+LK+F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +GQ+ E ++P  L+A +K +F+ MAKD+GL
Sbjct:    7 CSLDGSD-PLWDWNRTWQTYYPDLTPCFQNTVLVWIPCLYLWLFAPLYI-LYLKSHDRGYICMTHLNRAKTVIGFTLWLICWADVFYSFWERSHGATVAPVYLVSPTMLGHGLLMFMYVFQLLATFLIQYERMKGVQSSGVMLNFWLITIVCATITFRSKIMHALNDPASVGVFRYTTFYIYYTLLLISLILACLSDQPPLFSEVVKDSNP-----------------------CPESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKRPVDKTLYSPKRSTRGEKKDGQPVE--ESEILLAKALQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAPTWHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFLSHEELDDDNVERPAISGTPDSIRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVDGEITEMGSYTELLGRQGAFAEFLRTY------TNTEQEEGEESLGGEQTSEGLSSNDDAAATKTKSAEA-------------------------SRLTEADKANTGRVKLSVFWEYMKAIGLPLSIFSIFLFFCHHLSSLGS-NYWLSLWTDDPVVNNTQ--PKREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNNLSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIA-KKGIFYKMAKDSGL 1497          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc6a (ATP-binding cassette, sub-family C (CFTR/MRP), member 6a [Source:ZFIN;Acc:ZDB-GENE-050517-18])

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 637/1545 (41.23%), Postives = 951/1545 (61.55%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKF---NIIKSILVCGLFF--IYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSR-SIRVKTP-ANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPW-FLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNV--EVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRK--KLSITE--SFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            LW  N  W T  P+L+ CFQ T+L W P ++L +              +Y   RG+    ++  + L+ G F      ++ F    ++ + +   +   L PI+ ++  +L + V     ++G  SS  LF +W L ++ + I L+++  + V+   + D  R++     F +       +CFAD   + + + K++                         CP   ASFLSKI F W + LI++G+R PL  +DL+ L+EED+ + I+  ++ EW  +     R  ++QQ   + STS+     LP +      RK  I K+    +  LR L  +    F    L  +++D   F  P +L   + F+ + +  +W G+FY   +FL+S  ++  N Q+ + C   G+R KTA++ ++Y+K+L ++ ++R+  TVGEIVNL+S D  K  DF  +F+ +W++PI + + ++FLWQ LGP+ +AG+  +I + P+N  I  K  KLQ  QM+  DGR+KL++EIL+GIKILK +AWE +  E+V   REKE   L+K+  L + +  ++  +  L+A   FG YVL D  N+L  QK FVS++L NIL  P+S LP A+  T+Q LVS KR+  FL  +EL PDNV  E   S+   +   NG FSW ++  P L+ I++++  GSLV +VG VGSGKSSL+SA+LGE  K SGTV  K  +AYVPQQAW QN SLQDNILFG+    S Y +VLEACAL+ DL  LPAGD TEIGEKG+NLSGGQKQR+SLAR+VY+   VYL DDPLSAVDAHVG+HIF KV    G+L   TR+LVTHG+++L +AD I V+ DG +SE G+Y+ELL  +G FADFI T+       +SE  +  S+ +++  RK  +LS+T+   F R+  + +     + S   +       +    ++  KL   + A+IG VKLE++I Y +       +  +  Y    AA +S N  LS W++   IN +Q     D  LG+YG L F Q I I   +++++ G  +AS+ LH  +L +++ +P SFF++TPSG +LNR  K+ID +D  IP+ +++ L+   ++    II+ +A+P+  + ++P+ F Y FIQ FY+ TS QL+R++S+ +SPIY+H  E++ G S IRA+    +F        D +Q  +F      RW+   LE +GN ++L + + +V  + T+  G+ GL+VS++L +T  L+ +VR+  D+E+N+V++ER+KEY +   EA W I     P  WPQ G IEF ++ ++YR GL+LAL+ ++  +   EK+GIVGRTGAGKSSLAL +FR++E A+G I ID I+I  +GLHDLRS++TIIPQDPVLFSG+LR+NLDPFN YSD E+W ALE+A+LK+F ++    L    SE GENLS+GQRQLVCLARALL+KT +LVLDEATAA+D+ETD LIQ++IR+ F+ C VLTIAHRLNTIMDY +V+V+ +G + E+++P  L+A ++  F+ M ++AGL
Sbjct:   13 LWDWNQTWYTHRPELSNCFQNTVLVWAPCIYLWVLSPFYC------LHLYCHGRGRLPLSSLCNAKLLLGFFLASFGFVEFFYILLERRLEIHQHLVFLLSPIMRSLTVVLAVCVIHWERVRGCRSSVFLFFFWLLGVLCSIIPLHAKVQLAVEQGLSPDIVRYLAFFSYFALQLAQLFLSCFADQAPLGKAVHKNA-------------------------CPVQDASFLSKILFWWFSGLIFKGYRSPLQAEDLWSLREEDTSERIISDLEEEWTAK-----RTKLQQQENHM-STSAALGSRLPDQ--AQLLRK--IQKEQSSGFCLLRTLARSFGPYFLTGTLCLIVHDVFMFSVPQVLSLLLGFMKDEDTPLWKGYFYATLMFLLSCLQSVFNHQYTYTCFTVGMRVKTAVMGLVYRKSLVMNSSARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEVTLCLFFLWQHLGPSALAGIATVIFIFPLNGFIARKRSKLQEIQMKYMDGRVKLMNEILNGIKILKFYAWEKAFLEQVLGYREKELKTLKKSQILYSVSLASFNSSSFLIAFAMFGVYVLIDDKNVLDAQKIFVSMALINILKTPLSQLPFAMSTTMQALVSLKRLGKFLCQDELKPDNVARESFKSDVDGVVFDNGTFSWSKDGPPCLKRISVKVPCGSLVAVVGHVGSGKSSLLSAMLGETEKRSGTVSVKGSIAYVPQQAWIQNASLQDNILFGREKKESWYQRVLEACALLPDLDNLPAGDATEIGEKGLNLSGGQKQRVSLARAVYRKGDVYLLDDPLSAVDAHVGQHIFNKVIGPKGILRDKTRVLVTHGMSFLPQADLILVLVDGEISERGSYQELLNRNGAFADFIHTF------ANSERKECFSEALQRGSRKSVRLSVTDYMPFSRDLSQEQLIGGDTNSIAIEPLPDSDEDHIPEDLG-KLTKVDKARIGRVKLEMYIEYFRTIGLPLIISIVFLYAFQQAASLSNNYWLSLWADQPVINGTQ--LNTDLKLGVYGALGFAQGISIFGTTVAISLGCIIASRHLHLDLLNNVLHSPMSFFESTPSGNLLNRFAKEIDAIDNMIPDGLKMMLSYFFKLTEVCIIVLMATPFAAVIILPMVFLYGFIQSFYVATSCQLRRLESVSRSPIYTHLNETVQGASVIRAFNEQSRFIMGANHKVDHNQTAYFPRFIATRWLGVNLEFLGNGIVLAASILSVMAKGTLSPGMVGLAVSHSLQVTGFLSWIVRSWTDVENNIVSVERVKEYADTPKEAAWSIEGSSLPPSWPQTGTIEFQDYGLQYRKGLELALKGISVHIHEREKIGIVGRTGAGKSSLALGIFRILEAAKGEIYIDGINIAEIGLHDLRSRITIIPQDPVLFSGSLRMNLDPFNAYSDEEVWNALELAHLKNFVSELPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKVLVLDEATAALDLETDTLIQSTIRSQFEDCAVLTIAHRLNTIMDYTKVIVMDKGHVVEMDSPSNLIA-KRGQFYYMCREAGL 1506          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc6b.2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110208-2])

HSP 1 Score: 1087.02 bits (2810), Expect = 0.000e+0
Identity = 649/1565 (41.47%), Postives = 935/1565 (59.74%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCG----------LFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPAN-------DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRK---IIKQQYL--KLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIV--NGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            LCS    D  LW  NV W T +PDLT CFQ+TIL W P  +L I CA   P        YY+ R    I  S L C           + F+  + L    S  I  L   +   L PI+ ++  +LV+ +  L  ++G  SS  LF++W L ++ + + L     R    AN       D  RF      F +     I +CFAD                       P+ L     V+ P CP   ASFLSK+ F W  RL+ +G+R PL  +DL+ L+EED+ ++I+  +++EW ++  ++ +K   + + Q L  KL S     ++ L  E                     R L    S  F    L  VI D   F  P +L   + ++ + +  +W G+ + F +FL+S  ++  N Q+M+ C   G+R KTA++ ++Y+K+L ++ A+RK  TVGEIVNL+S D  K  DF  +F+ LW++PI I + ++FLWQ LGP+T+AG+  +I + P+N  I     KLQ  QM+ KD RIKL++EILSGIKILK +AWE +  E+V   REKE   L+K+  L + +  ++  +  L+A   FG YVL D  ++L  QK FVS++L NIL  P+S LP A+  T+Q +VS KR+  FL+ +EL  D+V+    N    S+V  NG FSW ++  P LR IN++++ GSLV +VG VGSGKSSL+SA+LGEM K SG +     V YVPQQAW QN +L+DNILFG     S Y KVLEACAL+ DL+ILPA D TEIGEKG+NLSGGQKQR+SLAR+VY+NS +YL DDPLSAVDAHVG+HIFEKV   +G L   TR+LVTHGL++L +AD I VM DG           +K  G +A+ +       + ++    + +     +  RK +S   S      +       S S  +          +  +   +L   + A  G VKLE+++ Y +     F +  I  Y     A ++ N  LS W++   IN +Q     D  LG+YG L F Q I I   +++++ G  +AS+ LH  +L +++ +P SFF++TPSG +LNR  K+ID +D  IP+ ++I L    +++   II+ +A+P+  + ++PL+  Y FIQ FY+ TS QL+R++S+ +SPIY+HF E++ G S IRA+    +F  +     D +Q  +F     +RW+   LE +GN+++L + + +V  R T+  G  GL+VS++L +T  L+ +VR+  D+E+N+V++ER+KEY E   EAPW   +   PS+WP++G I F  + ++YR GLD AL+ ++ +V   EK+GIVGRTGAGKSSLAL +FR++E A+G I ID I+I  +GLH+LRS++TIIPQDPVLFSG+LRINLDPF+ Y+D E+W +LE+A+LK+F +     L    SE GENLS+GQRQL+CLARALL+KT ILVLDEATAAVD++TD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+V+ +G I EI++P  L++ +   F+ M ++AGL
Sbjct:    4 LCSLSGLD-PLWDWNVTWYTEHPDLTKCFQHTILVWFPCFYLWI-CA---PFYCLYLKFYYNGR----ISISSLCCAKMGLALCLASIGFLETVYLLVERSRDIEHL---MVFLLSPIIRSLTMILVMLMIHLERLRGFRSSVFLFLFWMLSVVCSLVPL-----RANIQANIKEGFSADPMRFAAFFTFFSLQLAQLILSCFADQR---------------------PDTLKP-VYVKNP-CPVEDASFLSKLLFWWYGRLVVKGYRSPLKAEDLWSLREEDTSEKIICDLEKEWAKQWAKLQQKKSSLNEAQTLGFKLSSCVKQLFRKLFKEQCTGFV-------------LFRTLAKIFSPYFLTGTLFLVIQDALMFSIPQVLSLLLGYVRDEDAPLWKGYLFAFSLFLLSCLQSLFNHQYMYTCLTVGMRVKTAVMGLVYRKSLVINSAARKTCTVGEIVNLVSADTQKLVDFVMYFNALWLAPIEIALCLFFLWQHLGPSTLAGITTVILIFPLNGFIAKMRSKLQEVQMKHKDERIKLMNEILSGIKILKFYAWEKAFRERVLGYREKELNALKKSQILYSVSIASFNSSTLLIAFAMFGVYVLIDDKHVLDAQKIFVSMALINILKAPLSQLPIAMSTTMQVVVSLKRLGTFLDQDELKLDSVQRVPYNPNIESVVINNGTFSWSKDSTPCLRRINVKVQRGSLVAVVGHVGSGKSSLLSAMLGEMEKKSGHITITGSVGYVPQQAWIQNATLKDNILFGCEKKDSLYQKVLEACALLPDLEILPARDATEIGEKGLNLSGGQKQRVSLARAVYRNSDIYLLDDPLSAVDAHVGQHIFEKVIGPNGSLKNKTRVLVTHGLSFLPQADLILVMADGE----------IKEMGSYAELLSRKNAFAELKAFSVSERKESATLKGTRKSVSFL-SIKDFSTDLIRGDLGSASIQTMEAISDPKLNQDRDEVGRLTQADKAHTGRVKLEMYVEYFRTIGLAFIIPIIFLYAFQQVASLAYNYWLSLWADDPVINGTQ--VNTDLKLGVYGALGFAQGIAIFGTTVAISLGGIIASRQLHLDLLNNVLHSPMSFFESTPSGNLLNRFSKEIDAIDCMIPHGLKIMLGYVFKLLEVCIIVLMATPFAGVIILPLTLLYAFIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQPRFILQANCRVDLNQTSYFPRFVASRWLAVNLEFLGNLLVLAAAILSVMGRATLSPGTVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVKEYAETAKEAPWTFEDSPLPSDWPRSGSIGFQAYGLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLKTFVSDLPDKLNHECSEGGENLSLGQRQLICLARALLRKTKILVLDEATAAVDLKTDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGNITEIDSPSNLIS-QHGQFYRMCREAGL 1501          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 643/1573 (40.88%), Postives = 956/1573 (60.78%), Query Frame = 2
Query:  179 LCFQYTILNWIPLMFLIIGCAINIPILLRKKS------IYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYV-----NRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR--VKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDT--------------------------PKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLS--------------ITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKK---LVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGT--INNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            +C + T+L W+PL FL I    +     +K +      +YY  +    ++    V  L      D F  +SD+     P V  +  P+L AV  ++V+       +RL  +     SG LF++W LQ +V A+  +   +R  +    +D  RF    I + +  I+ + +  AD            +  + ET+                  PE KA+FLS+ITF+W   ++++GF++PL  +D++ L + DS   I         +  + V  K +K+    L+   S + +++ +E    N     +S+D                           P+ W +  ++ +       S L K++ D  +F  P +L   I F  N + Y W G+ Y   + LV+  ++ + QQ+   C + G++ +TAI++ +YKKAL +S  SRKE T GEIVNLMS DA +F D   F HLLW  P+ I +++ FLW ELGP+ ++GL++++ M+PIN  + +K ++ Q Q M+ KD R+K+++++L+GIKILK +AWE S E +V+ IREKE  V+RK  +L++ ++  + C P LV+L +F  +V   P+NIL  +KAF SISLFNIL FP++MLP  I   +Q  VS KR+  FL+G++LD   V  ++S    +S+ NG ++W  +  P+L+ ++L+I+ G LV +VG VGSGK+SL+SA+LGE+  I G +     VAYVPQQAW QN +L+DNILFG S+   +Y  V++ACAL  DL +LP  DQTEIGEKGINLSGGQKQR+SLAR+VY ++ VYL DDPLSAVD+HVGKH+FEKV   +GLL   TRILVTHG+++L   D+I V+  G VSE G+Y+ L  + G F++F+ TY + + ++ ++     ++    E  + L               ++ +  RE     S+R+S  +G  K +   +   + +  +KK   L+++E+ + G VK  V++ Y+    + +   + + Y     A++  N+ LS W++      N +     RD  +G++G L   Q   +   ++ LA G   AS+TLH  +L +I++ P  FFDTTPSGRI+NR  KDI TVD  IP + R W+     V+ ++ +IC+A+P F   ++P++  Y+F+Q+FY+ TSRQL+R+DS+ +SPIYSHF E++ G S IRAY   D+F    E+  D++    +  I  NRW+   LE +GN+V+  + +FAV  RD++ SGL GLS+SYAL +T +L  +VR + ++E+N+VA+ER++EY EI++EAPW +  V+PP +WP  G I F ++ VRYRP L+L L  +   +Q  EK+GIVGRTGAGKSSL   LFR++E A+G I IDDIDI  LGLHDLRS+LTIIPQDPVLFSG LR+NLDPF  +SD EIW  LE+A+LK +      GLE  +SE GENLS+GQRQL+CLARALL+K+ IL+LDEATAAVD+ETD+LIQ++IR  F  CTVLTIAHRLNTI+D  RVMVL  G+I E ++P +LL+ +   F SMA+DAG+
Sbjct:   28 VCVERTVLVWLPLAFLWICSPFHFRSFCQKSAKAPASALYYCKQVVAGLLLLTAVAELAVTLGED-FGPSSDEDAQKNPAVL-YTNPVLFAVSWIVVMLCQESMRHRLMCV----DSGSLFMFWLLQ-VVCAVFQFQTLLREALSQGISDVPRFCLFYISYGLQIIALVLSAIAD--------VSPEAKKVAETN------------------PEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFIC--------QTFEDVMAKELKKARNNLQKKKSKKRKTVDAEG--QNGLAKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSWLVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAFTQNKDSYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDTTTVTHNSSITAAVSMTNGTYAWERDTEPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALEPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVLVHGVVSEIGSYESLRASKGAFSEFLETYGKDESNKDNDKKAAAAQTPVYEEIETLPEGLETQADGSPEDIVSSTLKRENSLRHSQRHSKRNGSVKVRKNSSLRAQKDPEDKKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWYVGFSFVFYFIQNVAVIGQNLWLSDWTDDSIEYFNQTYPNHIRDTRIGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEDTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDSLNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPW-VTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLS-KPGHFSSMAEDAGI 1555          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1207.97 bits (3124), Expect = 0.000e+0
Identity = 678/1543 (43.94%), Postives = 964/1543 (62.48%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK---PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNV--EVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK------KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             W SN+ W T NPD T CFQ T+L WIP ++L   C       LRK    Y      N  K+ +   L+     DLF S  ++   +       + P +  +  LL  ++ +   IKGV SSG++  +W + L+   II  S+ +    P +                       F+   + +  L             L    +ND        CPE  ASFLS+ITF W +R++ +GF++PL   DL+ L +ED   E+VP++ + W +E ++   K +    LK+  +   + + L S+       +  I K  PK   P  L+ L  T    FF S   K  +D   F  P +L   I F+G+ +   WHG+ Y F +F  +  +T I  ++  +C VTG+R KTA++ ++Y+KAL ++ ++R+  T+GEIVNLMSVDA +F D   + +++W +P+ +I+  Y LWQ LGP+ +AG+ +++ ++P+NAVI  K KK Q  QM+ KD RIKL++EIL+GIK+LKL+AWEL+ +EKV  IR+ E  VL+K+ +L A  +  W C P LVAL +F  YVL D  N+L  +KAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EEL+P+++  E   S++  I++ +  FSW  N+ P L+DIN+ I EGSLV +VG VG GKSSL+SA+LGEM K  G V  K  V YV QQAW QN SL+DN+LFG+    S Y KV+EACAL+ DL+ILP GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YL DDPLSAVDAHVGKHIF+KV    G+L   TRILVTHG++YL + D I VM DG ++E G+Y++LL  DG FA+F+RTY   + ++             QE       +E    E G  ++ RN      + S++    + KT ++N       KL + + AK G VKL VF  Y++        L+I  + C+++A+L S N  LS W++   +N +Q        L +YG L F+Q I +   S +++ G  LAS+ LH  +L +++R P SFF+ TPSG ++NR  K+IDT+D TIP  +++++ S   VI + +II  A+P   + + PL   YFF+Q+FY+ TSRQL+R++S+ +SP+YSHF E+++G+S IRA+    +F    +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R T+  GL GLSVSYAL +TT L  +VR S ++E+N+VA+ER+KEY +++ EA W + E  P + WP  GKIEF  + +RYR  LDLAL+N+N T+Q GEK+GIVGRTGAGKSSL L LFR+ E A G I ID  ++  +GLHDLR ++TIIPQDPVLFSG LR+NLDPF+ Y+D +IW +LE+A+LK F A     L    +E GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IR  F+ CTV+TIAHRLNTIMDY +V+VL +GQ+ E ++P  LL  ++ +F +MAKD+GL
Sbjct:   13 FWDSNLTWYTENPDFTKCFQNTVLIWIPCIYLWF-CLPFYFAYLRKNDQGYIQMSHLNKAKTAIGFILWLACWADLFYSFWERSQSIYRAPVYVVSPTVLGITMLLATFLIQYERIKGVQSSGVMLNFWIVALLCAIIIFRSKVLHALKPVSH------------------FHGWFSFGKLHRPPLP------------LFSERVNDPNP-----CPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVP---LKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTYANAEQNK------------DQEEAPSPVPSEEKRLENGILRNERNLQRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLAS-NYWLSLWTDDKVVNGTQQNTTMR--LSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLL-QQQGIFFNMAKDSGL 1500          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1204.89 bits (3116), Expect = 0.000e+0
Identity = 696/1585 (43.91%), Postives = 966/1585 (60.95%), Query Frame = 2
Query:   83 VVSFKILCSNKSPDWL-----------LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILL--RKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHR-KIIKQQYLKLESTSSHRYQS--LPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPI------SIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTY-------------LXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            VVSF +L  + +P              L  SN+   T NPD+T CFQ T+L WIP ++L +     +  L   R+  I  S   K   +  +L   L+ +   DLF S    +    PP   F+ P++  +  +    + +   ++GV SSG+L I+W L  +   I   S+ +    +    DKFRF T  + F ++ I  + +CF ++      +                         E   CPE  A FLS++TF W T++   G+++PL   DL+ L E+D+   +V  + +EW +E   + +    K+    L  T    Y+S  L  +N           K   +P FL+VLL T    F      K+  D  +F+ P +L   I FI N +   W GF     +FL S+ +T I  Q    C VTG+R ++AI  IIY+K+L ++ ++++  TVGE+VNLMSVDA +FQD   F ++LW +P+ I + +YFLWQ LGP+ +AG+ +++ ++PINA I  K +  Q +QM+ KD RIKL++EIL+GIK+LKL+AWE S  +KV  IR KE  +L+KA +LNA ++ AW   P LVAL +F  YV  D  NIL  +KAFVS+SLFNIL FP++MLP  I    Q  VS KRI +FL  +ELD + V    + DK +      +  + N++        +  INL +  GSLV +VG VG GKSSL+SA+LGEM K  G V  +  VAYVPQQAW QN +L+DNILFG++     Y KVLEACAL+ DL++LP GDQTEIGEKGINLSGGQKQR+SLAR+V+ N+ VYL DDPLSAVDAHV KHIF+ V   DGLL   TR+LVTHG+++L + D I V+ DG V+E G+Y+ELLK +G F++F+R Y             L  ++  S+     +++ +  E RKK  I +      GE     ++      K  S     +      +KL+  E  + G VK+ VF  Y++      ++     Y    AA +  N+ LS W+    IN +Q        +G+Y  L   Q + ++  S SLA     A++ LH+ +L + +  P SF+DTTP GRI+NR  KDI  +D  IP T+ ++L +    +S++I+I  ++P F + +IPL+  Y F+Q+FY+ TSRQL+R++S+ +SPIYSHF E+I G S IRAY   + F    +   D++Q  ++  I  NRW+   +E +GN V+L + +FAV  R+ +  GL GLSVSYAL +T SL  MVR + D+E+N+VA+ER+KEY E E+EAPW I + KPP +WP  G++E SN+SVRYR GLDL L+NLN  V  GEK+GIVGRTGAGKSS+ L LFR++EPAEG +KID+++I+ +GL DLRS+LTIIPQDPVLFSG LR+NLDPFN YSD EIW ALE++NLK F A     LE+  SE GENLSVGQRQLVCLARALL+KT IL+LDEATAA+D+ETD+LIQ +IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I E +TP  L+A  K +F+ MAKDAGLA
Sbjct:    7 VVSFSLLHYSAAPRCYPRLFYLELRHNLSDSNLTLYTDNPDVTPCFQNTVLAWIPCVYLWVALPFYLLYLKYNRRGYIVLSMLSKAKTVFGVL---LWCVCWADLFYSFHGLVQNQSPPPVYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATVCAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRD-----------------------EINPCPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLMQVSYSKKPEAVLNHTDEKAYESDVLIVDN-----------KKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAV----TKDKTLPGKDEGNCSDLNYTLHFKPFCFIHSINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITILLAEETLSTHTDLADNEPVANEARKKF-IRQISILSDGEPSHAMSTRRRFTEKKPSENLVAK--QPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQ--NTQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIA-LKGIFYGMAKDAGLA 1544          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 691/1560 (44.29%), Postives = 956/1560 (61.28%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILL--RKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRE---LDRVHRKIIKQQYLKLESTSSHRYQS--LPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNV-EVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGT----------YKELLKNDGPFADFIRT----------YLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
             W SN+   T NPD+T CFQ T+L WIP ++L +     +  L   R+  I  S   K   +  +L   L+ +   DLF S    +    PP   F+ P++  +  +    + +   ++GV SSG+L I+W L  +   I   S+ +    +    DKFRF T  + F ++ I  + +CF ++      +                         E   CPE  A FLS++TF W T++   G+++PL   DL+ L E+D+   +V  + +EW +E   L ++     K+    L  T    Y+S  L  +N           K   +P FL+VLL T    F      K+  D  +F+ P +L   I FI N +   W GF     +FL S+ +T I  Q    C VTG+R ++AI  IIY+K+L ++ ++++  TVGE+VNLMSVDA +FQD   F ++LW +P+ I + +YFLWQ LGP+ +AG+ +++ ++PINA I  K +  Q +QM+ KD RIKL++EIL+GIK+LKL+AWE S  +KV  IR KE  +L+KA +LNA ++ AW   P LVAL +F  YV  D  NIL  +KAFVS+SLFNIL FP++MLP  I    Q  VS KRI +FL  +ELD + V +  T     I++ NG FSW +N   IL++INL +  GSLV +VG VG GKSSL+SA+LGEM K  G V  +  VAYVPQQAW QN +L+DNILFG++     Y KVLEACAL+ DL++LP GDQTEIGEKGINLSGGQKQR+SLAR+V+ N+ VYL DDPLSAVDAHV KHIF+ V   DGLL   TR+LVTHG+++L + D I V+ DG V+E G+          + E L+N   F D +             L  ++  S+     +++ +  E RKK  I +      GE     ++      K  S     ++     +KL+  E  + G VK+ VF  Y++      ++     Y    AA +  N+ LS W+    IN +Q        +G+Y  L   Q + ++  S SLA     A++ LH+ +L + +  P SF+DTTP GRI+NR  KDI  +D  IP T+ ++L +    +S++I+I  ++P F + +IPL+  Y F+Q+FY+ TSRQL+R++S+ +SPIYSHF E+I G S IRAY   + F    +   D++Q  ++  I  NRW+   +E +GN V+L + +FAV  R+ +  GL GLSVSYAL +T SL  MVR + D+E+N+VA+ER+KEY E E+EAPW I + KPP +WP  G++E SN+SVRYR GLDL L+NLN  V  GEK+GIVGRTGAGKSS+ L LFR++EPAEG +KID+++I+ +GL DLRS+LTIIPQDPVLFSG LR+NLDPFN YSD EIW ALE++NLK F A     LE+  SE GENLSVGQRQLVCLARALL+KT IL+LDEATAA+D+ETD+LIQ +IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I E +TP  L+A  K +F+ MAKDAG
Sbjct:   14 FWDSNLTLYTDNPDVTPCFQNTVLAWIPCVYLWVALPFYLLYLKYNRRGYIVLSMLSKAKTVFGVL---LWCVCWADLFYSFHGLVQNQSPPPVYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATVCAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRD-----------------------EINPCPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLAQMQVSYSKKPEAVLNHTDEKAYESDVLIVDN-----------KKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYA-FDDEVEEEDITIPDEEEVLLAEETLSTHTDLADNEPVANEARKKF-IRQISILSDGEPSHAMSTRRRFTEKKPSENLVAKQPPT--EKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQ--NTQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIA-LKGIFYGMAKDAG 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1185.24 bits (3065), Expect = 0.000e+0
Identity = 672/1539 (43.66%), Postives = 956/1539 (62.12%), Query Frame = 2
Query:  140 SNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK---PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDN-VEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK------KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            SN+ W T NPD T CFQ T+L WIP ++L   C       LRK    Y      N  K+ +   L+     DLF S  ++   +       + P +  +  LL  ++ +   IKGV SSG++  +W    IV  ++LY            +F+  +              NC+           + S N   E+                       ASFLS+ITF W +R++ +GF++PL   DL+ L +ED   E+VP++ + W +E ++   K +    LK+  +   + + L S+       +  I K  PK   P  L+ L  T    FF S   K  +D   F  P +L   I F+G+ +   WHG+ Y F +F  +  +T I  ++  +C VTG+R KTA++ ++Y+KAL ++ ++R+  T+GEIVNLMSVDA +F D   + +++W +P+ +I+  Y LWQ LGP+ +AG+ +++ ++P+NAVI  K KK Q  QM+ KD RIKL++EIL+GIK+LKL+AWEL+ +EKV  IR+ E  VL+K+ +L A  +  W C P LVAL +F  YVL D  N+L  +KAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EEL+P++ +      +  I++ +  FSW  N+ P L+DIN+ I EGSLV +VG VG GKSSL+SA+LGEM K  G V  K  V YV QQAW QN SL+DN+LFG+    S Y KV+EACAL+ DL+ILP GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YL DDPLSAVDAHVGKHIF+KV    G+L   TRILVTHG++YL + D I VM DG ++E G+Y++LL  DG FA+F+RTY   + ++             QE       +E    E G  ++ RN      + S++    + KT ++N       KL + + AK G VKL VF  Y++        L+I  + C+++A+L S N  LS W++   +N +Q        L +YG L F+Q I +   S +++ G  LAS+ LH  +L +++R P SFF+ TPSG ++NR  K+IDT+D TIP  +++++ S   VI + +II  A+P   + + PL   YFF+Q+FY+ TSRQL+R++S+ +SP+YSHF E+++G+S IRA+    +F    +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R T+  GL GLSVSYAL +TT L  +VR S ++E+N+VA+ER+KEY +++ EA W + E  P + WP  GKIEF  + +RYR  LDLAL+N+N T+Q GEK+GIVGRTGAGKSSL L LFR+ E A G I ID  ++  +GLHDLR ++TIIPQDPVLFSG LR+NLDPF+ Y+D +IW +LE+A+LK F A     L    +E GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IR  F+ CTV+TIAHRLNTIMDY +V+VL +GQ+ E ++P  LL  ++ +F +MAKD+GL
Sbjct:   17 SNLTWYTENPDFTKCFQNTVLIWIPCIYLWF-CLPFYFAYLRKNDQGYIQMSHLNKAKTAIGFILWLACWADLFYSFWERSQSIYRAPVYVVSPTVLGITMLLATFLIQYERIKGVQSSGVMLNFW----IVALLLLY------------RFQLYSGY------------NCY-----------RQSCNPCPES----------------------SASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVP---LKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPDWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKTEGSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTYANAEQNK------------DQEEAPSPVPSEEKRLENGILRNERNLQRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLAS-NYWLSLWTDDKVVNGTQQNTTMR--LSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLL-QQQGIFFNMAKDSGL 1474          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1183.32 bits (3060), Expect = 0.000e+0
Identity = 690/1578 (43.73%), Postives = 957/1578 (60.65%), Query Frame = 2
Query:  104 CSNKSPDWLLWS---SNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILL--RKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADS----NVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRE---LDRVHRKIIKQQYLKLESTSSHRYQS--LPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNV-EVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGT----------YKELLKNDGPFADFIRT----------YLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            C + S   LL S   SN+   T NPD+T CFQ T+L WIP ++L +     +  L   R+  I  S   K   +  +L   L+ +   DLF S    +    PP   F+ P++  +  +    + +   ++GV SSG+L I+W L  +   I   S+ +    +    DKFRF T  + F ++ I  + +CF ++    + ++  + + S     E HLL    L                              +   +++PL   DL+ L E+D+   +V  + +EW +E   L ++     K+    L  T    Y+S  L  +N           K   +P FL+VLL T    F      K+  D  +F+ P +L   I FI N +   W GF     +FL S+ +T I  Q    C VTG+R ++AI  IIY+K+L ++ ++++  TVGE+VNLMSVDA +FQD   F ++LW +P+ I + +YFLWQ LGP+ +AG+ +++ ++PINA I  K +  Q +QM+ KD RIKL++EIL+GIK+LKL+AWE S  +KV  IR KE  +L+KA +LNA ++ AW   P LVAL +F  YV  D  NIL  +KAFVS+SLFNIL FP++MLP  I    Q  VS KRI +FL  +ELD + V +  T     I++ NG FSW +N   IL++INL +  GSLV +VG VG GKSSL+SA+LGEM K  G V  +  VAYVPQQAW QN +L+DNILFG++     Y KVLEACAL+ DL++LP GDQTEIGEKGINLSGGQKQR+SLAR+V+ N+ VYL DDPLSAVDAHV KHIF+ V   DGLL   TR+LVTHG+++L + D I V+ DG V+E G+          + E L+N   F D +             L  ++  S+     +++ +  E RKK  I +      GE     ++      K  S     ++     +KL+  E  + G VK+ VF  Y++      ++     Y    AA +  N+ LS W+    IN +Q        +G+Y  L   Q + ++  S SLA     A++ LH+ +L + +  P SF+DTTP GRI+NR  KDI  +D  IP T+ ++L +    +S++I+I  ++P F + +IPL+  Y F+Q+FY+ TSRQL+R++S+ +SPIYSHF E+I G S IRAY   + F    +   D++Q  ++  I  NRW+   +E +GN V+L + +FAV  R+ +  GL GLSVSYAL +T SL  MVR + D+E+N+VA+ER+KEY E E+EAPW I + KPP +WP  G++E SN+SVRYR GLDL L+NLN  V  GEK+GIVGRTGAGKSS+ L LFR++EPAEG +KID+++I+ +GL DLRS+LTIIPQDPVLFSG LR+NLDPFN YSD EIW ALE++NLK F A     LE+  SE GENLSVGQRQLVCLARALL+KT IL+LDEATAA+D+ETD+LIQ +IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I E +TP  L+A  K +F+ MAKDAGLA
Sbjct:    5 CGSGSKKLLLRSGRDSNLTLYTDNPDVTPCFQNTVLAWIPCVYLWVALPFYLLYLKYNRRGYIVLSMLSKAKTVFGVL---LWCVCWADLFYSFHGLVQNQSPPPVYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATVCAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRDEIVRISPYFKKEVHLLAHTRLA-----------------------------LLHSYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLAQMQVSYSKKPEAVLNHTDEKAYESDVLIVDN-----------KKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYA-FDDEVEEEDITIPDEEEVLLAEETLSTHTDLADNEPVANEARKKF-IRQISILSDGEPSHAMSTRRRFTEKKPSENLVAKQPPT--EKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQ--NTQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIA-LKGIFYGMAKDAGLA 1532          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:MGI Symbol;Acc:MGI:102676])

HSP 1 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 691/1556 (44.41%), Postives = 989/1556 (63.56%), Query Frame = 2
Query:   86 VSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVG-LQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE---VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQE-LRKKLSITESFGR--EKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++ +  CS    D  LW  NV W T NPD T CFQ T+L W+P  +L   C       L +    Y      N  K+ L   L+ I   DLF S  ++  G L+ PV   + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ I    K    D FR  T  + F +V +  + +CF+D +                   L    ++D        CPE  ASFLS+ITF W T ++  G+R+PL   DL+ L +ED+ +E+VP++   W +E D+  ++ ++  Y   +  S  +  S    N E             +P   +VL  T    F  S L K ++D   F  P IL   INF+ +     W G+FY   +F+ +  +T    Q+  +C V+G+R KTA++  +Y+KAL ++ A+RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLW  LGP+ +AG+ ++I M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV +IR++E  VL+K+ +L A  +  W CTP LVAL +F  +V  D  NIL  +KAFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E   + +     I++ N  F+W   E P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +  + Y  V+EACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY NS +YLFDDPLSAVDAHVGKHIFEKV    GLL   TRILVTHG++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + D +SED        + + +   + +T++ G+  ++  + S  +S  +    S   +  +        KL++ + A+ G V+L V+  Y++        L+I  + C++++AL S N  LS W++   + N    A R++ L +YG L   Q   I   S++++ G   AS+ LH  +L +++R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI ++III +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L IT  L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WP +G++EF ++ +RYR  LDL L+++N T++ GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID ++I  +GLH+LR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W+ALE+A+LK F +     L    +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+++E   P +LL  ++ +F+SMAKDAGL
Sbjct:    1 MALRSFCSADGSD-PLWDWNVTWHTSNPDFTKCFQNTVLTWVPCFYLW-SCFPLYFFYLSRHDRGYIQMTHLNKTKTALGFFLWIICWADLFYSFWERSQGVLRAPVL-LVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFTLVLVQLVLSCFSDCSP------------------LFSETVHDRNP-----CPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPDWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALAS-NYWLSLWTDDPPVVNGTQ-ANRNFRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELL-QQRGIFYSMAKDAGL 1527          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 674/1565 (43.07%), Postives = 961/1565 (61.41%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPAN--DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK---PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVST-SNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXK----LIKQELRKKLSITES----------FGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKK---LVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            LC +       W SN+   T  PDLT CFQ ++L W+P ++L       +   LR   + Y      + +K+ L   L+ +  +DLF S    I G  P    F+ P++  +  LL   + +   ++GV SSG+L I+W L +I   I   S+ +         D FRF T  I F +VF + I +CF +                 +  L  P NL+ +       CPE  A F S+++F W TRL   G+R+PL   DL+ L EED   ++V  +   W ++ ++  R           S ++     +P E+         + K  PK   P FLR L+ T +     S    +I +   F+ P +L   I FI +     W GF     +FL S  +T I  Q+     V  +R +TAII +IY+KAL ++ + ++E TVGE+VNLMSVDA +F D   F +LLW +P+ +I+ +YFLWQ LGP+ +AG+ +++ ++P+N  +  K+K  Q +QM+ KD RIKL+SEIL+GIK+LKL+AWE S  E+VK IR+ E  +LRK  +L A ++  W CTP LV L + G YV  D +N+L  +KAFVS+SLFNIL  P++MLP  I    Q  VS KRI  FLN  ELDP  VE  T S    I+I NG F+W ++  P L  +N++I +G+LV +VG VG GKSSL+SA+LGEM K+ G V  K  VAYVPQQAW QN +LQ+N+LFG+ M   +Y + LE CAL+ DL +LP GDQTEIGEKGINLSGGQ+QR+SLAR+VY +++++L DDPLSAVD+HV KHIF++V   +G+L+  TR+LVTHG+++L + D I V+  G VSE G Y  LL++DG FA+F+R Y   +D E  E   + +     L++  L     +T++          F RE     S        + K  +    +E      K+   L+ EE+A+ G VKL V+  Y +       +   L Y    AA +  N+ LS+WS     +  Q+  +    LG+Y  L   Q + +++ + ++  G   A++ LH  +L + IR+P SFFDTTPSGRILNR  KDI  +D  +  T+ + L S    IS+I++I  ++P F++ ++PL+  Y F+Q+FY+ TSRQL+R++SI +SPI+SHF E++ GTS IRAY     F    +   D +Q   +  I+ NRW+  ++E +GN V+L + +FAV  R+++  GL GLSVSYAL +T +L  M+R   D+ESN++A+ER+KEY++ ++EAPW +   + P  WP  G +EF N+SVRYRPGL+L L+N+   VQ GEK+GIVGRTGAGKSS+ L LFR++E AEG I ID +++  +GLHDLRS+LTIIPQDP+LFSG LR+NLDPF  YS+ +IW ALE+++L +F +    GL+F  +E G+NLSVGQRQLVCLARALL+K+ +LVLDEATAA+D+ETD+LIQ +IRT F+ CTVLTIAHRLNTIMDY+RV+VL +G + E ++P  L+A    +F+ MAKDAGLA
Sbjct:    4 LCGSGELGSKFWDSNLSIYTNTPDLTPCFQNSLLAWVPCIYLWAALPCYL-FYLRHHQLGYIVLSWLSRLKTALGVLLWCVSWVDLFYSFHGLIHGSSPAPVFFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTTFYIYFALVFCALILSCFKE-----------------KPPLFSPENLDTNP------CPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQKQQNQASR-----------SQTATAEPKIPGED-------AVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEAALQNANEEVLLLEDTLSTHTDLTDNEPAIYEVRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAEEHGQQNKTSVR--LGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGMAKDAGLA 1523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 1185.63 bits (3066), Expect = 0.000e+0
Identity = 674/1564 (43.09%), Postives = 961/1564 (61.45%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPAN--DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK---PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVST-SNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXK---LIKQELRKKLSITES----------FGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKK---LVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            LC +       W SN+   T  PDLT CFQ ++L W+P ++L       +   LR   + Y      + +K+ L   L+ +  +DLF S    I G  P    F+ P++  +  LL   + +   ++GV SSG+L I+W L +I   I   S+ +         D FRF T  I F +VF + I +CF +                 +  L  P NL+ +       CPE  A F S+++F W TRL   G+R+PL   DL+ L EED   ++V  +   W ++ ++  R           S ++     +P E+         + K  PK   P FLR L+ T +     S    +I +   F+ P +L   I FI +     W GF     +FL S  +T I  Q+     V  +R +TAII +IY+KAL ++ + ++E TVGE+VNLMSVDA +F D   F +LLW +P+ +I+ +YFLWQ LGP+ +AG+ +++ ++P+N  +  K+K  Q +QM+ KD RIKL+SEIL+GIK+LKL+AWE S  E+VK IR+ E  +LRK  +L A ++  W CTP LV L + G YV  D +N+L  +KAFVS+SLFNIL  P++MLP  I    Q  VS KRI  FLN  ELDP  VE  T S    I+I NG F+W ++  P L  +N++I +G+LV +VG VG GKSSL+SA+LGEM K+ G V  K  VAYVPQQAW QN +LQ+N+LFG+ M   +Y + LE CAL+ DL +LP GDQTEIGEKGINLSGGQ+QR+SLAR+VY +++++L DDPLSAVD+HV KHIF++V   +G+L+  TR+LVTHG+++L + D I V+  G VSE G Y  LL++DG FA+F+R Y   +D E  E     ++   L++  L     +T++          F RE     S        + K  +    +E      K+   L+ EE+A+ G VKL V+  Y +       +   L Y    AA +  N+ LS+WS     +  Q+  +    LG+Y  L   Q + +++ + ++  G   A++ LH  +L + IR+P SFFDTTPSGRILNR  KDI  +D  +  T+ + L S    IS+I++I  ++P F++ ++PL+  Y F+Q+FY+ TSRQL+R++SI +SPI+SHF E++ GTS IRAY     F    +   D +Q   +  I+ NRW+  ++E +GN V+L + +FAV  R+++  GL GLSVSYAL +T +L  M+R   D+ESN++A+ER+KEY++ ++EAPW +   + P  WP  G +EF N+SVRYRPGL+L L+N+   VQ GEK+GIVGRTGAGKSS+ L LFR++E AEG I ID +++  +GLHDLRS+LTIIPQDP+LFSG LR+NLDPF  YS+ +IW ALE+++L +F +    GL+F  +E G+NLSVGQRQLVCLARALL+K+ +LVLDEATAA+D+ETD+LIQ +IRT F+ CTVLTIAHRLNTIMDY+RV+VL +G + E ++P  L+A    +F+ MAKDAGLA
Sbjct:    4 LCGSGELGSKFWDSNLSIYTNTPDLTPCFQNSLLAWVPCIYLWAALPCYL-FYLRHHQLGYIVLSWLSRLKTALGVLLWCVSWVDLFYSFHGLIHGSSPAPVFFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTTFYIYFALVFCALILSCFKE-----------------KPPLFSPENLDTNP------CPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQKQQNQASR-----------SQTATAEPKIPGED-------AVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEALQNANEEVLLLEDTLSTHTDLTDNEPAIYEVRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAEEHGQQNKTSVR--LGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGMAKDAGLA 1522          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc4 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [Source:MGI Symbol;Acc:MGI:2443111])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 463/1343 (34.48%), Postives = 729/1343 (54.28%), Query Frame = 2
Query:  770 PVCPELK------ASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNE----YIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSML-PGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGEN-EAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGG-VKLEVFIYYIQCG-SYLFAMLAILCYCSYLAALVSGNIVLSSWS-EAGTINNSQDLAAR-------DYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQ----MVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            PV  E+K      A+  S++ F W   L   G ++ L  DD++ +  ED  K +   + R W++EL R                                       KD+ KP   + ++      +   G+  +I + +  +QP  LG  I +   ++      +   + Y   + + ++    ++  + +     G+R + A+  +IY+KAL+LS ++  + T G+IVNL+S D +KF     F H LW  P+  I     LW E+G + +AGL +L+ +LP+ + IG     L+++     D RI+ ++E+++G++I+K++AWE S  + +  +R+KE   +  + +L      ++F    ++   +F +YVL    N +T    FV+++L+  +   +++  P AI    + +VS +RI +FL  +EL      V +     + + +    W +  ++P L+ ++     G L+ +VG VG+GKSSL+SA+LGE+   SG V     +AYV QQ W  + +++ NILFGK     +Y KV++ACAL +DL++L  GD T IG++G  LSGGQK R++LAR+VYQ++ +YL DDPLSAVDA VGKH+F+        L +   ILVTH L YL  A  I ++KDG + + GTY E LK+   F   ++                     K+    + S        +    S  +      S+        E  +  N + V  E ++  G +  + +  Y   G S+ F +  +L         V  +  LS W+ + G +NN+++            ++LGIY GL     +F + +SL + Y +  AS+TLHN M  SI++AP  FFD  P GRILNR  KDI  +D  +P T   ++ +   V+S I +     P+ ++ L+PLS  +  ++++++ TSR ++R++S  +SP++SH   S+ G  +IRAYK  +    +C+EL D  Q      WFL ++ +RW    L+ I  I +++    ++ +  T+ +G  GL++SYAL +       VR S ++E+ ++++ER+ EYT++E EAPW+  + +PP  WP  G I F N +  Y     L L++L   ++  EK+GIVGRTGAGKSSL  ALFRL EP EG I ID I  T +GLHDLR K++IIPQ+PVLF+G +R NLDPFN ++D E+W ALE   LK         ++  ++E+G N SVGQRQLVCLARA+LK   IL++DEATA VD  TDELIQ  IR  F  CTVLTIAHRLNTI+D D++MVL  G++KE + P  LL + +SLF+ M +  G
Sbjct:    3 PVHTEVKPNPLQDANLCSRVFFWWLNPLFKTGHKRRLEEDDMFSVLPEDRSKHLGEELQRYWDKELLRA-------------------------------------KKDSRKPSLTKAIIKCYWKSYLILGIFTLIEEGTRVVQPLFLGKIIEYFEKYDPDDSVALHTAYGYAAVLSMCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNSAMGKTTTGQIVNLLSNDVNKFDQVTIFLHFLWAGPLQAIAVTVLLWVEIGISCLAGLAVLVILLPLQSCIGKLFSSLRSKTAAFTDARIRTMNEVITGMRIIKMYAWEKSFADLIANLRKKEISKILGSSYLRGMNMASFFIANKVILFVTFTSYVLL--GNEITASHVFVAMTLYGAVRLTVTLFFPSAIERGSEAIVSIRRIKNFLLLDELPQRKAHVPSDGKAIVHVQDFTAFWDKALDSPTLQGLSFIARPGELLAVVGPVGAGKSSLLSAVLGELPPASGLVSVHGRIAYVSQQPWVFSGTVRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGATLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVGKHLFQLCICQA--LHEKITILVTHQLQYLKAASHILILKDGEMVQKGTYTEFLKSGVDFGSLLK---------------------KENEEAEPSTAPGTPTLRKRTFSEASIWSQQSSRPSLKDGAPEGQDAENTQAVQPEESRSEGRIGFKAYKNYFSAGASWFFIIFLVLLNMVGQVFYVLQDWWLSHWANKQGALNNTRNANGNITETLDLSWYLGIYAGLTAVTVLFGIARSLLVFYILVNASQTLHNRMFESILKAPVLFFDRNPIGRILNRFSKDIGHMDDLLPLTFLDFIQTLLLVVSVIAVAAAVIPWILIPLVPLSVVFLVLRRYFLETSRDVKRLESTTRSPVFSHLSSSLQGLWTIRAYKAEE----RCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAIFVIVVAFGSLVLAKTLNAGQVGLALSYALTLMGMFQWSVRQSAEVENMMISVERVIEYTDLEKEAPWECKK-RPPPGWPHEGVIVFDNVNFTYSLDGPLVLKHLTALIKSREKVGIVGRTGAGKSSLISALFRLSEP-EGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWRALEEVQLKEAIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILKNNRILIIDEATANVDPRTDELIQQKIREKFAQCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNPESLFYKMVQQLG 1277          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc9 (ATP-binding cassette, sub-family C (CFTR/MRP), member 9 [Source:MGI Symbol;Acc:MGI:1352630])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 404/1169 (34.56%), Postives = 632/1169 (54.06%), Query Frame = 2
Query: 1406 ERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDN------------------------------------------VEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISG-----TVKRKEP------------VAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLL-----SKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESE---APWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAK 4711
            E T+G+I NL++++ ++   F F    LW  P+ II+ +  L+  LG + + G  +++ + PI   I +K+ + Q   +     R+K  +EIL GIK+LKL+AWE    + V+  R KE   L+      + +       P    L +F  +  A  NN L P +AF S+SLF+IL  P+ +L   + F ++ ++S +++N FL  +E+  D+                                          +  + + D  I + NG FSWG   A  L +I++ I  G L MIVG VG GKSSL+ AILGEM  + G      V   EP            VAY  Q+ W  N ++++NI FG      +Y  V +AC+L  D+ +LP GDQTEIGE+GINLSGGQ+QRI +AR++YQN+++   DDP SA+D H+  H+ +     +G+L      K T +LVTH L YL  AD I  MKDG+V   GT K++   D    +  +T + +                 QEL K +   ++    K   ++  +       + +  +  EE+    N   V     K+     +   +Y+  G +    L I       + +V+ +  L++W+   +IN+    A + +++  +  L        L+ SL++ +    A+K LH+ +L  II  P  FFDTTP G ILNR   D + +D  IP T+     S    +S+I +I  A+P F++AL PL   ++FIQK++   S+ LQ +D   + P+  HF E+  G ++IRA++   +F  +  ELTD + + +  + + NRW++   + +G  ++L + + ++       SGL GL + YAL IT  L  +VRN  D+E  + A++++  +  +ESE      D  +V  P  WPQ G+I+  +  VRY   L   L+++   ++ G+K+GI GRTG+GKSSL+LA FR+++  +G I ID IDI+ L LH LRS+L+II QDP+LFSG++R NLDP    +D  +W ALEIA LK+       GL+ T++E GEN SVGQRQL CLARA ++K++IL++DEATA++DM T+ ++Q  + TAF   TV+TIAHR++TI+  D V+V+++G I E +TP+ LLA E  +F S  +
Sbjct:  405 EMTLGQINNLVAIETNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEAQKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSIFMNAAIPIAAVLATFVTHAYASGNN-LKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAIISVQKLNEFLLSDEIGEDSWRAGEGTLPFESCKKHTGVQSKPINRKQPGRYHLDSYEQARRLRPAETEDIAIKVTNGYFSWGSGLA-TLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVYWNNVNESEPSFEATRSRSRYSVAYAAQKPWLLNATVEENITFGSPFNRQRYKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSDHLMQ-----EGILKFLQDDKRTVVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQTKDVELYEHWKTLMNRQ---------------DQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEEEDEEDNMSTVMRLRTKM---PWKTCWWYLTSGGFFLLFLMIFSKLLKHSVIVAIDYWLATWTSEYSINHPGK-ADQTFYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGPIRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALAPLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLELTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSN--SGLVGLGLLYALTITNYLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQV--PEHWPQEGEIKIHDLCVRYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDATVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVR 1543          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|O35379|MRP1_MOUSE (Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1)

HSP 1 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 691/1556 (44.41%), Postives = 989/1556 (63.56%), Query Frame = 2
Query:   86 VSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVG-LQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE---VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQE-LRKKLSITESFGR--EKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++ +  CS    D  LW  NV W T NPD T CFQ T+L W+P  +L   C       L +    Y      N  K+ L   L+ I   DLF S  ++  G L+ PV   + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ I    K    D FR  T  + F +V +  + +CF+D +                   L    ++D        CPE  ASFLS+ITF W T ++  G+R+PL   DL+ L +ED+ +E+VP++   W +E D+  ++ ++  Y   +  S  +  S    N E             +P   +VL  T    F  S L K ++D   F  P IL   INF+ +     W G+FY   +F+ +  +T    Q+  +C V+G+R KTA++  +Y+KAL ++ A+RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLW  LGP+ +AG+ ++I M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV +IR++E  VL+K+ +L A  +  W CTP LVAL +F  +V  D  NIL  +KAFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E   + +     I++ N  F+W   E P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +  + Y  V+EACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY NS +YLFDDPLSAVDAHVGKHIFEKV    GLL   TRILVTHG++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + D +SED        + + +   + +T++ G+  ++  + S  +S  +    S   +  +        KL++ + A+ G V+L V+  Y++        L+I  + C++++AL S N  LS W++   + N    A R++ L +YG L   Q   I   S++++ G   AS+ LH  +L +++R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI ++III +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L IT  L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WP +G++EF ++ +RYR  LDL L+++N T++ GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID ++I  +GLH+LR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W+ALE+A+LK F +     L    +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+++E   P +LL  ++ +F+SMAKDAGL
Sbjct:    1 MALRSFCSADGSD-PLWDWNVTWHTSNPDFTKCFQNTVLTWVPCFYLW-SCFPLYFFYLSRHDRGYIQMTHLNKTKTALGFFLWIICWADLFYSFWERSQGVLRAPVL-LVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFTLVLVQLVLSCFSDCSP------------------LFSETVHDRNP-----CPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPDWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALAS-NYWLSLWTDDPPVVNGTQ-ANRNFRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELL-QQRGIFYSMAKDAGL 1527          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q864R9|MRP1_MACFA (Multidrug resistance-associated protein 1 OS=Macaca fascicularis OX=9541 GN=ABCC1 PE=1 SV=1)

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 695/1565 (44.41%), Postives = 992/1565 (63.39%), Query Frame = 2
Query:   86 VSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK----PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXX-----XXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK---KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++ +  CS    D  LW  NV W T NPD T CFQ T+L W+P  +L   C     + L +    Y      N  K+ L   L+ +   DLF S  ++  G+       + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ +    +    D FR +T  + F +V I  + +CF+D    +  L   + +D        PN            CPE  ASFLS+ITF W T LI RG+R+PL   DL+ L +ED+ +++VP++ + W +E  +  ++ +K  Y     +S    Q   S  +++N     +   +P+    P   +VL  T    F  S   K I+D   F  P IL   INF+ +     W G+FY   +F+ +  +T +  Q+  +C V+G+R KTA+I  +Y+KAL ++ A+RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW+ LGP  +AG+ +++ M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L A  +  W CTP LVAL +F  YV  D NN+L  QKAFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E     D      I++ N  F+W  ++ P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SLQ+NILFG  +    Y  V++ACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YLFDDPLSAVDAHVGKHIFE V    G+L   TRILVTH ++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + ++              K  KQ +   + +T+S G++     S  +S    +S+  +     +K     +   KL++ + A+ G VKL V+  Y++      + L+I  + C+++AAL S N  LS W++   +N +Q+       L +YG L  +Q I +   S++++ G  LAS+ LH  +L SI+R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI + I+I +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L +TT L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WPQ G++EF N+ +RYR  LD  LR++N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W +LE+A+LK F +     L+   +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I+E   P  LL  ++ LF++MA+DAGL
Sbjct:    1 MALRGFCSADGSD-PLWDWNVTWYTSNPDFTKCFQNTVLVWVPCFYLW-ACFPFYFLYLSRHDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIMTALKEDVQVDLFRDMTFYVYFSLVLIQLVLSCFSD----RSPLFSETIHD--------PNP-----------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVY-----SSKDPAQPKDSSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPDWQGYFYTALLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNVLDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGDTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVALKGSVAYVPQQAWIQNDSLQENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDNGVTGVSGPGKEAKQ-MENGMLVTDSAGKQLQRQLSSSSSYSGDVSRQHNSTAELQKDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALAS-NYWLSLWTDDPIVNGTQE--HTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYNMARDAGL 1530          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q5F364|MRP1_CHICK (Multidrug resistance-associated protein 1 OS=Gallus gallus OX=9031 GN=ABCC1 PE=2 SV=1)

HSP 1 Score: 1229.16 bits (3179), Expect = 0.000e+0
Identity = 692/1566 (44.19%), Postives = 986/1566 (62.96%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSR---SIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNI----SKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVS--TSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXX--------------XXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQC-GSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            LCS  + +   W  N+ W T NPD T CFQ T+L W+P ++L + C     + LR     Y      N  K+ L   L+ +   DLF S  ++   +       + P +  +  LL  ++ +   +KGV SSG++ I+W + L+   +I  S+   ++   T   D FR++T    F+++ +  I +CF                   E   L    +ND K      CPE  ASFLS+ITF W T L+ +G R+PL   DL+ L +ED+ +EIVP + + W +E  +  R+ +   Y      SS + Q     N E       +    S+ + +    +VL  T    F  S L K  +D   F  P IL   INF+ N +   W G+FY   +F+ +  +T I  Q+  +C VTG+R KTAI+ +IY+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW+ LGP+ +AG+ ++I ++PINAV+  K K  Q  QM+ KD RIKL++EIL+GIK+LKL+AWEL+  EKV  IR+KE  VL+K+ +L A  +  W C P LVAL +F  YV  + NNIL  QKAFVS++LFNIL FP+++LP  I   ++  VS KR+  FL+ EELDPD++     T+ +  I + N  FSW + + P L  IN  + EGSL+ +VG VG GKSSL+SA+LGEM K  G V  K  +AYVPQQAW QN +L+DNI+FG+ M  S+Y +V+EACAL+ DL+ILP GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+  YLFDDPLSAVDAHVGKHIFEKV    G+L   TR+LVTH + YL + D I VM DG +SE G+Y+ELLK DG FA+F+RTY   +    S D                  +    + + ++LS + ++ RE G+++ + +++      ++            + KL + + AK G VK  V+  Y++  G Y+  +   L  C+++A+L S N  LS W++   +N +Q     +  LG+YG L  +Q I +   S++++ G   AS+ LH  +L +++R+P SFF+ TPSG +++R  K+IDT+D TIP  +++++ S   VI + III +A+P   + + PL   Y  +Q+FY+ TSRQL+R++S+ +SP+YSHF E+++G S IRA++   +F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R+ +  GL GLSVSY+L IT  L  +VR + D+E+N+VA+ER+KEY E+E EA W I E  P S WPQ GK+EF  F +RYR  LDL L+N+N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDP+LFSG+LR+NLDPF+ +SD +IW +LE+A+LK+F +     L    SE GENLSVGQRQLVCLARALL+K+ ILVLDEATAAVD+ETD LIQ++I++ F+ CTVLTIAHRLNTIMDY RV+VL +G++ E ++P  LL   K LF+SMAKD+GLA
Sbjct:    6 LCSADASE-PFWDWNLTWHTENPDFTQCFQNTVLVWVPCIYLWV-CFPAYFLYLRSHDRGYIQMSILNKAKTALGLILWIVCWADLFYSFWERSQNIFRAPFFLISPTVLGITMLLATFLIQHERLKGVQSSGVMMIFWLISLLCATVIFRSKIMLALNTDTEV-DAFRYVTFCTYFILLLVQLILSCFP------------------EKPPLFSEAVNDPKP-----CPEFSASFLSRITFWWITGLMIQGHRRPLEAKDLWSLNKEDTSEEIVPGLAKNWAKEWAKTKRQPLNMLY------SSKKQQKSSDSNGEVMEEAEALIIKPSQRSSEASLSKVLYKTFGPYFLMSFLFKAAHDLLMFTGPEILKLLINFVNNKSAPNWQGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMGTFTWVCAPFLVALSTFAVYVKVNKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITNAEGSIVVKNATFSWSKTDPPSLNSINFTVPEGSLIAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSIAYVPQQAWIQNATLEDNIIFGREMNESRYKRVIEACALLPDLEILPMGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADTYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMTDGEISEMGSYQELLKQDGAFAEFLRTYANAEQSMESSDASSPSGKEGKPVENGVLVNDATGKLMHRQLSNSSTYSRETGKSQHQSSTAELQKPLAEKN----------SWKLTEADTAKTGRVKATVYWEYMKAIGLYISFLSVFLFMCNHIASLAS-NYWLSLWTDDPVVNGTQQYT--NVRLGVYGALGISQGIAVFGYSMAVSIGGIFASRHLHLDLLHNVLRSPMSFFERTPSGNLVSRFSKEIDTIDSTIPPIIKMFMGSTFNVIGACIIILLATPIAAVVIPPLGLVYLLVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEFVGNCIVLFAALFAVIARNKLSPGLIGLSVSYSLQITAYLNWLVRMTSDLETNIVAVERVKEYAEMEKEAEWSIEETAPASTWPQEGKVEFRGFGLRYREDLDLVLKNINITINGGEKVGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPILFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECSEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDNLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECDSPDNLL-QAKGLFYSMAKDSGLA 1525          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q8CG09|MRP1_RAT (Multidrug resistance-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Abcc1 PE=1 SV=2)

HSP 1 Score: 1223.38 bits (3164), Expect = 0.000e+0
Identity = 691/1563 (44.21%), Postives = 993/1563 (63.53%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRV--KTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXX--XXKLIKQE--LRKKLSITESFGR--EKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWS-EAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            M + SF   CS+   D  LW  NV W T NPD T CFQ T+L W+P  +L   C     + L +    Y      N  K+ L   L+ I   DLF S  ++  G+       + P L  +  LL  ++ +    KGV SSGI+  +W + L+    IL S+ I    K    D FR     + F +VFI  + +CF+DS+ +     +             PN            CPE  ASFLS+ITF W T ++ +G+R+PL   DL+ L +ED+ +E+VP++   W +E  +  ++ ++  Y   +  +  +  S    N E        S     P   +VL  T    F  S L K ++D   F  P IL   INF+ +     W G+ Y   +F+ +  +T    Q+  +C VTG+R KTA++  +Y+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ + + +YFLW  LGP+ +AG+ ++I M+P NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L A  +  W CTP LVAL +F  +V  D  NIL  +KAFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E  +  D      I++ N  F+W  +E P L  I   I +G+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG+ +    Y  V+EACAL+ DL+ILP+GD TEIGEKG+NLSGGQKQR+SLAR+VY NS +YL DDPLSAVDAHVGKHIFEKV    GLL   TRILVTHG++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + D +SED  +   S L K+   +   + +T++ G+  ++  + S  +S ++    S + +  +        KL++ + A+ G VKL V+  Y++      + L+I  + C++++AL S N  LS W+ +   +N +Q+   R++ L +YG L   Q + +   S++++ G   AS+ LH  +L++++R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI ++III +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L IT  L  +VR S ++E+N+VA+ER+KEY+E E EA W I E  PPS WP +G++EF ++ +RYR  LDL L+++N T++ GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLH+LR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W+ALE+A+LK F +     L    +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+  TVLTIAHRLNTIMDY RV+VL +G+I+E   P +LL  ++ +F+SMAKDAGL
Sbjct:    1 MALSSF---CSSDGSD-PLWDWNVTWHTSNPDFTKCFQNTVLTWVPCFYLW-SCFPLYFLYLSRHDRGYIQMTHLNKAKTALGFFLWIICWADLFYSFWERSQGMLLAPVLLVSPTLLGITMLLATFLIQFERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAQVDMFRDSAFYLYFTLVFIQLVLSCFSDSSPLFSETVRD------------PNP-----------CPESSASFLSRITFWWITGMMVQGYRQPLKSSDLWSLNKEDTSEEVVPVLVNNWKKECVKSRKQPVRIVYAPPKDPTKPKGSSQLDVNEEVEALIVKSSHKDRDPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPEILELIINFVNDREAPDWQGYLYTALLFVSACLQTLALHQYFHICFVTGMRIKTAVVGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVTLALYFLWLNLGPSVLAGVAVMILMVPFNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMNIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDEKNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERWSIKDGGGMNSITVKNATFTWARDEPPTLNGITFAIPDGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGRPLQEHCYKAVMEACALLPDLEILPSGDLTEIGEKGVNLSGGQKQRVSLARAVYCNSDIYLLDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAEFVRTYANTEQDLASEDDSKNGVSGLGKESKPVENGILVTDAVGKPLQRHLSNSSSHSVVTNQQHSSTAELQKSGVKEETWKLMEADKAQTGQVKLSVYWNYMKAIGLCISFLSIFLFLCNHVSALAS-NYWLSLWTDDRPAVNGTQE--NRNFRLSVYGALGILQGVAVFGYSMAVSIGGIFASRRLHLDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEASWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDSTVLTIAHRLNTIMDYTRVIVLDKGEIRECGAPSELL-QQRGVFYSMAKDAGL 1531          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|P33527|MRP1_HUMAN (Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3)

HSP 1 Score: 1221.45 bits (3159), Expect = 0.000e+0
Identity = 696/1565 (44.47%), Postives = 997/1565 (63.71%), Query Frame = 2
Query:   86 VSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPK----PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSND----KPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXX-----XKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK---KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCY-CSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            ++ +  CS    D  LW  NV W+T NPD T CFQ T+L W+P  +L   C     + L +    Y      N  K+ L   L+ +   DLF S  ++  G+       + P L  +  LL  ++ +L   KGV SSGI+  +W + L+    IL S+ +  +K  A  D FR IT  + F ++ I  + +CF+D    +  L   + +D        PN            CPE  ASFLS+ITF W T LI RG+R+PL   DL+ L +ED+ +++VP++ + W +E  +  ++ +K  Y     +S    Q   S  +++N     +   +P+    P   +VL  T    F  S   K I+D   F  P IL   I F+ +     W G+FY   +F+ +  +T +  Q+  +C V+G+R KTA+I  +Y+KAL ++ ++RK  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +Y LW  LGP+ +AG+ +++ M+P+NAV+  K K  Q   M+ KD RIKL++EIL+GIK+LKL+AWEL+ ++KV  IR++E  VL+K+ +L+A  +  W CTP LVAL +F  YV  D NNIL  Q AFVS++LFNIL FP+++LP  I   +Q  VS KR+  FL+ EEL+PD++E     D      I++ N  F+W  ++ P L  I   I EG+LV +VG VG GKSSL+SA+L EM K+ G V  K  VAYVPQQAW QN SL++NILFG  +    Y  V++ACAL+ DL+ILP+GD+TEIGEKG+NLSGGQKQR+SLAR+VY N+ +YLFDDPLSAVDAHVGKHIFE V    G+L   TRILVTH ++YL + D I VM  G +SE G+Y+ELL  DG FA+F+RTY   + ++ +E+          K  KQ +   + +T+S G++     S  +S    +S+  +     +K     +   KL++ + A+ G VKL V+  Y++      + L+I  + C++++AL S N  LS W++   +N +Q+       L +YG L  +Q I +   S++++ G  LAS+ LH  +L SI+R+P SFF+ TPSG ++NR  K++DTVD  IP  +++++ S   VI + I+I +A+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+YSHF E+++G S IRA++  ++F  + +   D++Q  ++  I  NRW+   LE +GN ++L + +FAV  R ++ +GL GLSVSY+L +TT L  +VR S ++E+N+VA+ER+KEY+E E EAPW I E  PPS WPQ G++EF N+ +RYR  LD  LR++N T+  GEK+GIVGRTGAGKSSL L LFR+ E AEG I ID I+I  +GLHDLR K+TIIPQDPVLFSG+LR+NLDPF+ YSD E+W +LE+A+LK F +     L+   +E GENLSVGQRQLVCLARALL+KT ILVLDEATAAVD+ETD+LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G+I+E   P  LL  ++ LF+SMAKDAGL
Sbjct:    1 MALRGFCSADGSD-PLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLW-ACFPFYFLYLSRHDRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSD----RSPLFSETIHD--------PNP-----------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVY-----SSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQ-MENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALAS-NYWLSLWTDDPIVNGTQE--HTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAKDAGL 1530          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A267GTI5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016190g1 PE=4 SV=1)

HSP 1 Score: 1386.32 bits (3587), Expect = 0.000e+0
Identity = 765/1574 (48.60%), Postives = 1068/1574 (67.85%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYS--RSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQ---TLTKSSSNDMDETHLLLPNNLNDDKTVEY---------PVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVS----TSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLS------ITESFG-REKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            +  + ++ LC + S DW  WS ++  +T +PDLTLCFQYT+L+W+P +FL+   A ++  L R +S        FN+ K +L+  +  +  +D F++ +D   GL  P   ++ PIL  +  LLV+++    Y KGVHSSG+LF++W L+L+ + +IL S  R   ++ P  D FR +T         + F+A  F D   + Q   +  +S +   DET  LL  N   +K   Y           CPEL +SFLS+I+F W T +I RG+++ LT DDL+ L + D+C  IVP++ + W +E  +  +    +   ++ S         P     +    +     T KP FLRVL     + +F +G+ K+ YD  NF QP +L   I FI N + Y W G+F    +FLV++ +TFI QQ+      TG+R +TA+I+ +Y+KAL+LS ++RK +TVGEIVNLMSVDA K QD P F H LW +PI I + +YFLW +LGP+ +AGL +++ ++P+N +I S+I+KLQ  QM+ KD RIK+++E+L+GIK+LKL+AWE   ++ V+  R++E  +L  A +LNA +++ WFC P LVAL +F  YVL+ P NIL   KAFVS++LFNI+NFP+S+LPGAI + +  LVS  RI  FLN +E+DPD V+ S     S++ P+ +  G+F WG +E  +L+D+NL+I  G LV IVG+VG+GK+SL+SA+LGE+ K SG+V     V YVPQQAWCQN +L+DNI FGK+   + + +V+ ACAL  D+KILP G +TEIGEKGINLSGGQKQRISLAR+VY ++ +Y  DDPLSAVD+HVGKHIFE+V    GLLS  TR+LVTHG+++L K D I V+KDG+VSE GTY ELL+++G FA+FI+ YL  ++++  E+ DEE++ ++ ELR+ +S      ++++ G R + ++      S      S ++     K     ++L+ EE ++ G VKL VF  Y++   +     ++L Y  ++A  V  N+ LS WS+   IN +QD A RD  LG+YG +   QAIF+L+Q++ +A G + ASK LH+ +L +I++ P SFFD TP GRI+NR GKDIDTVDV+IP T+RIWL +   V+ +IIII I +  FIL  IPL   Y+F Q+FY+CTSRQL+RIDS+R+SPIYSHFQE+I+G S IRA+     F  K + L D +QM W+  I  NRW+Q  LE IGN VIL + VFAV  R +I +GLAGL+VSYAL +T+SL  +VR +CD+E+ +VA+ERIKEY E+ +EAPW     +P S WP +G++EF N+SVRYRPGLDL LR++   VQ GEK+GIVGRTGAGKSSL LALFR++EPA G I+ID +DI  LGLHDLRSKLTIIPQDPVLFSG+LR NLDP   +SD E+W ++E+A+LK F A    GLEF  SE GEN+SVGQRQLVCLARALL+KT ILVLDEATAA+D+ETD+LIQ +IR  FK+C+VLTIAHRLNTI+DYD+++VL +G +KE + PK LL + +++F+ M +DAGL
Sbjct:   13 LGAIYWESLCGSASLDWAFWSDDLTVNTNDPDLTLCFQYTMLHWLPAVFLLCVSAFHLRDLRRMQSKPGRGVSLFNLAKCVLLLPMMLLMVMDFFRAVTDASSGLVTPAVMYVYPILMLLVLLLVLFITYYEYRKGVHSSGLLFLFWLLELLCSIVILRSKIRYESMQLPNADAFRLVTWSTFVAFAAVQFVAQLFVDRGALAQHGGSRGRSYNETTDETRSLLQRN-EPEKMRPYMKRFVKHNLEPCPELSSSFLSQISFYWLTGMIIRGYKRALTGDDLWALLDRDTCGYIVPLLQKFWKQEQAKAGKSHQFKYTNQMTSNGLPVAGGRPDGYQNAEHVASRPDTATYKPSFLRVLGKVFGWPYFIAGIWKLAYDLINFAQPQLLSLLILFIQNGDPYEWRGYFLAVALFLVALFKTFIFQQYYHGTYTTGMRLRTAVIAAVYRKALRLSSSARKNKTVGEIVNLMSVDAQKLQDAPAFLHQLWGAPIIIALALYFLWLQLGPSVLAGLFVMVLLIPVNGIIASRIRKLQISQMKWKDQRIKVMNEVLNGIKVLKLYAWEAFFDKGVREKRDQELKLLLAAAYLNAASAITWFCAPFLVALATFAVYVLSSPENILDANKAFVSLTLFNIMNFPLSILPGAITYLVTSLVSVGRITSFLNADEVDPDAVDTSGHANDSHEFPVQVHKGDFKWGPDEPLVLKDVNLKIPNGKLVAIVGSVGAGKTSLVSALLGELVKTSGSVSVTGTVGYVPQQAWCQNATLRDNITFGKAFQKTTFERVISACALKPDIKILPGGLETEIGEKGINLSGGQKQRISLARAVYSDTDLYFLDDPLSAVDSHVGKHIFEQVLGPSGLLSNKTRLLVTHGISFLPKMDLIVVLKDGSVSEVGTYSELLQHNGGFAEFIQQYL--EEEDDEEEGDEETQSLRAELRRTISYLSGSEMSDAEGLRSRRQSHFSGAPSRRRSKVSVTLDDEANKVAADGRQLIQEESSETGSVKLSVFKSYVRSFGFGNFAFSVLTYALFIACQVGQNLWLSEWSQDEAINGTQDTALRDLRLGVYGAIGGGQAIFVLLQNIGIALGTYWASKVLHDDILDNIMKTPLSFFDITPIGRIINRFGKDIDTVDVSIPLTLRIWLMTFGGVVGTIIIIGITTKEFILLFIPLLVLYYFAQRFYVCTSRQLKRIDSVRRSPIYSHFQETIVGASCIRAFGKQQDFVDKSDYLVDWNQMAWYPSIVSNRWLQISLEGIGNFVILFTAVFAVASRYSINAGLAGLAVSYALQVTSSLNYVVRMTCDLETYIVAVERIKEYVEVPTEAPWYNNAARPRSGWPDSGRVEFKNYSVRYRPGLDLVLRDICAAVQPGEKVGIVGRTGAGKSSLTLALFRILEPAGGRIEIDGVDIASLGLHDLRSKLTIIPQDPVLFSGSLRYNLDPAEEHSDAEVWKSIELAHLKEFVAAQPAGLEFVCSEGGENMSVGQRQLVCLARALLRKTKILVLDEATAAIDLETDDLIQQTIRREFKACSVLTIAHRLNTIIDYDKILVLDKGLVKEFDAPKVLLDNPRTIFYGMVRDAGL 1583          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8GQF2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1313.52 bits (3398), Expect = 0.000e+0
Identity = 733/1522 (48.16%), Postives = 1008/1522 (66.23%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYS--RSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQ---TLTKSSSNDMDETHLLLPNNLNDDKTVEY---------PVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVS----TSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYL------XXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCT 4570
            +  + ++ LC + S DW  WS ++  +T +PDLTLCFQYT+L+W+P +FL+   A ++  L R +S        FN+ K +L+  +  +  +D F++ +D   GL  P   ++ PIL  +  LLV+++    Y KGVHSSG+LF++W L+L+ + +IL S  R   ++ P  D FR +T         + F+A  F D   + Q   +  +S +   DET  LL  N   +K   Y           CPEL +SFLS+I+F W T +I RG+++ LT DDL+ L + D+C  IVP++ + W +E  +  +    +   ++ S         P     +    +     T KP FLRVL     + +F +G+ K+ YD  NF QP +L   I FI N + Y W G+F    +FLV++ +TFI QQ+      TG+R +TA+I+ +Y+KAL+LS ++RK +TVGEIVNLMSVDA K QD P F H LW +PI I + +YFLW +LGP+ +AGL +++ ++P+N +I S+I+KLQ  QM+ KD RIK+++E+L+GIK+LKL+AWE   ++ V+  R++E  +L  A +LNA +++ WFC P LVAL +F  YVL+ P NIL   KAFVS++LFNI+NFP+S+LPGAI + +  LVS  RI  FLN +E+DPD V+ S     S++ P+ +  G+F WG +E  +L+D+NL+I  G LV IVG+VG+GK+SL+SA+LGE+ K SG+V     V YVPQQAWCQN +L+DNI FGK+   + + +V+ ACAL  D+KILP G +TEIGEKGINLSGGQKQRISLAR+VY ++ +Y  DDPLSAVD+HVGKHIFE+V    GLLS  TR+LVTHG+++L K D I V+KDG+VSE GTY ELL+++G FA+FI+ YL      E+ D+E+S              R K+S+T      K  A                            ++L+ EE ++ G VKL VF  Y++   +     ++L Y  ++A  V  N+ LS WS+   IN +QD A RD  LG+YG +   QAIF+L+Q++ +A G + ASK LH+ +L +I++ P SFFD TP GRI+NR GKDIDTVDV+IP T+RIWL +   V+ +IIII I +  FIL  IPL   Y+F Q+FY+CTSRQL+RIDS+R+SPIYSHFQE+I+G S IRA+     F  K + L D +QM W+  I  NRW+Q  LE IGN VIL + VFAV  R +I +GLAGL+VSYAL +T+SL  +VR +CD+E+ +VA+ERIKEY E+ +EAPW     +P S WP +G++EF N+SVRYRPGLDL LR++   VQ GEK+GIVGRTGAGKSSL LALFR++EPA G I+ID +DI  LGLHDLRSKLTIIPQDPVLFSG+LR NLDP   +SD E+W ++E+A+LK F A    GLEF  SE GEN+SVGQRQLVCLARALL+KT ILVLDEATAA+D+ETD+LIQ +IR  FK+C+
Sbjct:   13 LGAIYWESLCGSASLDWAFWSDDLTVNTNDPDLTLCFQYTMLHWLPAVFLLCVSAFHLRDLRRMQSKPGRGVSLFNLAKCVLLLPMMLLMVMDFFRAVTDASSGLVTPAVMYVYPILMLLVLLLVLFITYYEYRKGVHSSGLLFLFWLLELLCSIVILRSKIRYESMQLPNADAFRLVTWSTFVAFAAVQFVAQLFVDRGALAQHGGSRGRSYNETTDETRSLLQRN-EPEKMRPYMKRFVKHNLEPCPELSSSFLSQISFYWLTGMIIRGYKRALTGDDLWALLDRDTCGYIVPLLQKFWKQEQAKAGKSHQFKYTNQMTSNGLPVAGGRPDGYQNAEHVASRPDTATYKPSFLRVLGKVFGWPYFIAGIWKLAYDLINFAQPQLLSLLILFIQNGDPYEWRGYFLAVALFLVALFKTFIFQQYYHGTYTTGMRLRTAVIAAVYRKALRLSSSARKNKTVGEIVNLMSVDAQKLQDAPAFLHQLWGAPIIIALALYFLWLQLGPSVLAGLFVMVLLIPVNGIIASRIRKLQISQMKWKDQRIKVMNEVLNGIKVLKLYAWEAFFDKGVREKRDQELKLLLAAAYLNAASAITWFCAPFLVALATFAVYVLSSPENILDANKAFVSLTLFNIMNFPLSILPGAITYLVTSLVSVGRITSFLNADEVDPDAVDTSGHANDSHEFPVQVHKGDFKWGPDEPLVLKDVNLKIPNGKLVAIVGSVGAGKTSLVSALLGELVKTSGSVSVTGTVGYVPQQAWCQNATLRDNITFGKAFQKTTFERVISACALKPDIKILPGGLETEIGEKGINLSGGQKQRISLARAVYSDTDLYFLDDPLSAVDSHVGKHIFEQVLGPSGLLSNKTRLLVTHGISFLPKMDLIVVLKDGSVSEVGTYSELLQHNGGFAEFIQQYLEEEDDEEEGDEETSGHGSASFSGAPSRRRSKVSVTLDDEANKVAAD--------------------------GRQLIQEESSETGSVKLSVFKSYVRSFGFGNFAFSVLTYALFIACQVGQNLWLSEWSQDEAINGTQDTALRDLRLGVYGAIGGGQAIFVLLQNIGIALGTYWASKVLHDDILDNIMKTPLSFFDITPIGRIINRFGKDIDTVDVSIPLTLRIWLMTFGGVVGTIIIIGITTKEFILLFIPLLVLYYFAQRFYVCTSRQLKRIDSVRRSPIYSHFQETIVGASCIRAFGKQQDFVDKSDYLVDWNQMAWYPSIVSNRWLQISLEGIGNFVILFTAVFAVASRYSINAGLAGLAVSYALQVTSSLNYVVRMTCDLETYIVAVERIKEYVEVPTEAPWYNNAARPRSGWPDSGRVEFKNYSVRYRPGLDLVLRDICAAVQPGEKVGIVGRTGAGKSSLTLALFRILEPAGGRIEIDGVDIASLGLHDLRSKLTIIPQDPVLFSGSLRYNLDPAEEHSDAEVWKSIELAHLKEFVAAQPAGLEFVCSEGGENMSVGQRQLVCLARALLRKTKILVLDEATAAIDLETDDLIQQTIRREFKACS 1507          

HSP 2 Score: 76.6406 bits (187), Expect = 5.630e-10
Identity = 65/266 (24.44%), Postives = 116/266 (43.61%), Query Frame = 2
Query: 3896 SNVVAIERIKEY---TEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLL 4675
            +++V++ RI  +    E++ +A           E+P    ++      ++ P   L L+++N  +  G+ + IVG  GAGK+SL  AL   +    G++ +                +  +PQ     +  LR N+     +        +    LK        GLE  I E G NLS GQ+Q + LARA+   T++  LD+  +AVD    + I   +        + T L + H ++ +   D ++VL+ G + E+ T  +LL
Sbjct:  660 TSLVSVGRITSFLNADEVDPDAVDTSGHANDSHEFP----VQVHKGDFKWGPDEPLVLKDVNLKIPNGKLVAIVGSVGAGKTSLVSALLGELVKTSGSVSVT-------------GTVGYVPQQAWCQNATLRDNITFGKAFQKTTFERVISACALKPDIKILPGGLETEIGEKGINLSGGQKQRISLARAVYSDTDLYFLDDPLSAVDSHVGKHIFEQVLGPSGLLSNKTRLLVTHGISFLPKMDLIVVLKDGSVSEVGTYSELL 908          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8HV06 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1311.21 bits (3392), Expect = 0.000e+0
Identity = 732/1522 (48.09%), Postives = 1007/1522 (66.16%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYS--RSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQ---TLTKSSSNDMDETHLLLPNNLNDDKTVEY---------PVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVS----TSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYL------XXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCT 4570
            +  + ++ LC + S DW  WS ++  +T +PDLTLCFQYT+L+W+P +FL+   A ++  L R +S        FN+ K +L+  +  +  +D F++ +D   GL  P   ++ PIL  +  LLV+++    Y KGVHSSG+LF++W L+L+ + +IL S  R   ++ P  D FR +T         + F+A  F D   + Q   +  +S +   DET  LL  N   +K   Y           CPEL +SFLS+I+F W T +I RG+++ LT DDL+ L + D+C  IVP++ + W +E  +  +    +   ++ S         P     +    +     T KP FLRVL     + +F +G+ K+ YD  NF QP +L   I FI N + Y W G+F    +FLV++ +TFI QQ+      TG+R +TA+I+ +Y+KAL+LS ++RK +TVGEIVNLMSVDA K QD P F H LW +PI I + +YFLW +LGP+ +AGL +++ ++P+N +I S+I+KLQ  QM+ KD RIK+++E+L+GIK+LKL+AWE   ++ V+  R++E  +L  A +LNA +++ WFC P LVAL +F  YVL+ P NIL   KAFVS++LFNI+NFP+S+LPGAI + +  LVS  RI  FLN +E+DPD V+ S     S++ P+ +  G+F WG +E  +L+D+NL+I  G LV IVG+VG+GK+SL+SA+LGE+ K SG+V     V YVPQQAWCQN +L+DNI FGK+   + + +V+ ACAL  D+KILP G +TEIGEKGINLSGGQKQRISLAR+VY ++ +Y  DDPLSAVD+HVGKHIFE+V    GLLS  TR+LVTHG+++L K D I V+KDG+VSE GTY ELL+++G FA+FI+ YL      E+ D+E+S              R K+S+T      K  A                            ++L+ EE ++ G VKL VF  Y++   +     ++L Y  ++A  V  N+ LS WS+   IN +QD A RD  LG+YG +   QAIF+L+Q++ +A G + ASK LH+ +L +I++ P SFFD TP GRI+NR GKDIDTVDV+IP T+RIWL +   V+ +IIII I +  FIL  IPL   Y+F Q+FY+CTSRQL+RIDS+R+SPIYSHFQE+I+G S IRA+     F  K + L D +QM W+  I  NRW+Q  LE IGN VIL + VFAV  R +I +GLAGL+VSYAL +T+SL  +VR +CD+E+ +VA+ERIKEY E+ +EAPW     +P   WP +G++EF N+SVRYRPGLDL LR++   VQ GEK+GIVGRTGAGKSSL LALFR++EPA G I+ID +DI  LGLHDLRSKLTIIPQDPVLFSG+LR NLDP   +SD E+W ++E+A+LK F A    GLEF  SE GEN+SVGQRQLVCLARALL+KT ILVLDEATAA+D+ETD+LIQ +IR  FK+C+
Sbjct:   13 LGAIYWESLCGSASLDWAFWSDDLTVNTNDPDLTLCFQYTMLHWLPAVFLLCVSAFHLWDLRRMQSKPGRGVSLFNLAKCVLLLPMMLLMVMDFFRAVTDASSGLVTPAVMYVYPILMLLVLLLVLFITYYEYRKGVHSSGLLFLFWLLELLCSIVILRSKIRYESMQLPNTDGFRLVTWSTFVAFAAVQFVAQLFVDRGALAQHGGSRGRSYNETTDETRSLLQRN-EPEKMRPYMKRFVKHNLEPCPELSSSFLSQISFYWLTGMIIRGYKRALTGDDLWALLDRDTCGYIVPLLQKFWKQEQAKAGKSHQFKYTNQMTSNGLPVAGGRPDGYQNAEHVASRPDTATYKPSFLRVLGKVFGWPYFIAGIWKLAYDLINFAQPQLLSLLILFIQNGDPYEWRGYFLAVALFLVALFKTFIFQQYYHGTYTTGMRLRTAVIAAVYRKALRLSSSARKNKTVGEIVNLMSVDAQKLQDAPAFLHQLWGAPIIIALALYFLWLQLGPSVLAGLFVMVLLIPVNGIIASRIRKLQISQMKWKDQRIKVMNEVLNGIKVLKLYAWEAFFDKGVREKRDQELKLLLAAAYLNAASAITWFCAPFLVALATFAVYVLSSPENILDANKAFVSLTLFNIMNFPLSILPGAITYLVTSLVSVGRITSFLNADEVDPDAVDTSGHANDSHEFPVQVHKGDFKWGPDEPLVLKDVNLKIPNGKLVAIVGSVGAGKTSLVSALLGELVKTSGSVSVTGTVGYVPQQAWCQNATLRDNITFGKAFQKTTFERVISACALKPDIKILPGGLETEIGEKGINLSGGQKQRISLARAVYSDTDLYFLDDPLSAVDSHVGKHIFEQVLGPSGLLSNKTRLLVTHGISFLPKMDLIVVLKDGSVSEVGTYSELLQHNGGFAEFIQQYLEEEDDEEEGDEETSGHGSASFSGAPSRRRSKVSVTLDDEANKVAAD--------------------------GRQLIQEESSETGSVKLSVFKSYVRSFGFGNFAFSVLTYALFIACQVGQNLWLSEWSQDEAINGTQDTALRDLRLGVYGAIGGGQAIFVLLQNIGIALGTYWASKVLHDDILDNIMKTPLSFFDITPIGRIINRFGKDIDTVDVSIPLTLRIWLMTFGGVVGTIIIIGITTKEFILLFIPLLVLYYFAQRFYVCTSRQLKRIDSVRRSPIYSHFQETIVGASCIRAFGKQQDFVDKSDYLVDWNQMAWYPSIVSNRWLQISLEGIGNFVILFTAVFAVASRYSINAGLAGLAVSYALQVTSSLNYVVRMTCDLETYIVAVERIKEYVEVPTEAPWYNNAARPRPGWPDSGRVEFKNYSVRYRPGLDLVLRDICAAVQPGEKVGIVGRTGAGKSSLTLALFRILEPAGGRIEIDGVDIASLGLHDLRSKLTIIPQDPVLFSGSLRYNLDPAEEHSDAEVWKSIELAHLKEFVAAQPAGLEFVCSEGGENMSVGQRQLVCLARALLRKTKILVLDEATAAIDLETDDLIQQTIRREFKACS 1507          

HSP 2 Score: 76.6406 bits (187), Expect = 5.726e-10
Identity = 65/266 (24.44%), Postives = 116/266 (43.61%), Query Frame = 2
Query: 3896 SNVVAIERIKEY---TEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLL 4675
            +++V++ RI  +    E++ +A           E+P    ++      ++ P   L L+++N  +  G+ + IVG  GAGK+SL  AL   +    G++ +                +  +PQ     +  LR N+     +        +    LK        GLE  I E G NLS GQ+Q + LARA+   T++  LD+  +AVD    + I   +        + T L + H ++ +   D ++VL+ G + E+ T  +LL
Sbjct:  660 TSLVSVGRITSFLNADEVDPDAVDTSGHANDSHEFP----VQVHKGDFKWGPDEPLVLKDVNLKIPNGKLVAIVGSVGAGKTSLVSALLGELVKTSGSVSVT-------------GTVGYVPQQAWCQNATLRDNITFGKAFQKTTFERVISACALKPDIKILPGGLETEIGEKGINLSGGQKQRISLARAVYSDTDLYFLDDPLSAVDSHVGKHIFEQVLGPSGLLSNKTRLLVTHGISFLPKMDLIVVLKDGSVSEVGTYSELL 908          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1S3J175 (multidrug resistance-associated protein 1 OS=Lingula unguis OX=7574 GN=LOC106169324 PE=4 SV=1)

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 718/1561 (46.00%), Postives = 1010/1561 (64.70%), Query Frame = 2
Query:  104 CSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIY-YSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDK-FRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKT--------NISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSI---------TESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFI--RDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            C N S     WS ++  +T NPD+T CFQ T+  W+      +     IP+L  K +++     GK N+ K IL   L     LDL KS S+ I   Q P A F+ P + A    +  +V    + KG  SS +LFI+WS+ L++  + L S+ I+V+    D  FR +T  + +  + + FI + +AD+  + ++ T       ++  +L+        +    + PE+++SFLS+I + W T+L+ +G+++ L   D+Y L  EDSC  I+P    EW +E  +++   ++       S + + YQS    N   + + T         I+    +P  L  LL T    +  + LL++++D   F+ P +L   I F+   +   W G+     +FLVSM R+ +NQ +M +C   G+RA+TAII+ +Y+K+LKLS A+RK+ TVGEIVNLMSVDA K Q+ P F HL+W S I IIV +  LW+ LG AT+AGLV++I ++P+NA  G++I+  Q  QM +KD R+K+++E+L+ IKILKL+AWE S + KV  IR+ E + LR     NAFTS+ WFC P L+AL SF  +VL+DPNN+L P  AFVS+SLF I+N  +S +P +I++ +Q  VS  R+N FL  EELD   V+ ++S +  IS+ +G FSW  +E   L+ IN+EI  GSLV +VG VGSGKSSL++A+LG+M +ISG +  K  VAYVPQQAW QN+++++NILFGK    S Y K L  CAL +DLKILPAGDQTEIGEKG+NLSGGQKQR+SLAR+VYQ+  VYL DDPLSAVD+HVGKHIF+ V   +GLL   TRIL T+G+++L K D I V+  G +SE GTY+ELL ++G FA+FI+ YL + + ES  + +E+   ++ +LR+++S+          +   R++    SR+ S  +    S    T  ++   + ++L++EE A+ G VK    + YI+       ++  + Y  +++ L+  NI L+ WS    +N +Q L   D  LG+YGGL   Q  +I++Q   +A+G  +AS T+H   L  I+RAP SFFDTTP GRI+NR  KD++TVD+ +P+TV I L + ++VI+ + ++  ++P F + L+PL   YF  QK Y+ ++RQ  RID+ ++SPIYSHF E++IG SSIRAY+  ++F    +++ D +QM W+  I  NRW    +E  G  VIL + +FAV      +I  G AG+S+S +L +T  L  +VR SCD E  VVAIERI+EY+ +E EAPWDI   +PP EWPQ G+++F  +SVRYRPGLDL L+N+ F V+ GEK+GIVGRTGAGKSSL LALFR+IE A G+I ID + I  +GLH LRSK+TIIPQ+P LFSG LR NLDPF LYSD ++W ALE A+LK F A     L+  ISE GENLSVGQRQLVCLARALL+KT ILVLDEATAAVDMETD+LIQ++IR+ FK CTV+TIAHRLNTIMDYDRV+VL +G IKE   P  LL D++S F+ MAKDAGL
Sbjct:   10 CGNGSRYTAFWSWSLTVNTSNPDVTQCFQDTVFVWVSCGIFWLFALFFIPVLSSKPTVHRMRDAGKLNLAKMILSILLCLTSILDLLKSFSE-IPTHQTPPAAFVAPAIYAFTFGMSSFVITYEFKKGEVSSAMLFIFWSILLLLGGVSLRSKIIQVQIQDLDSMFRVVTFCVHYTCIVLEFILHLWADAKALPES-TPDWGELSEKQPILIKAKPPTKSSGNREISPEIRSSFLSRILYWWITKLVIKGYKQALVFADMYGLLPEDSCDVILPKFLGEWRKEKVKMNNSAVRFSASHDCSGTPNGYQSHQMGNGIPSAKTTLTDTLHVETIASTQGQPSLLMALLRTFGPYYAMAALLRLLFDAVTFVNPMLLSLMITFVETGDPLTWRGYLLAVVMFLVSMIRSLLNQNYMRICLRVGLRARTAIIATVYRKSLKLSSAARKKSTVGEIVNLMSVDAQKMQESPIFLHLIWSSAIAIIVALVLLWEYLGVATLAGLVVIILLIPLNAYAGTQIRAHQVTQMSLKDQRLKVLNEVLNAIKILKLYAWEESFQSKVTGIRDTELVSLRNVQIANAFTSIIWFCAPLLMALASFATFVLSDPNNVLDPNTAFVSLSLFTIVNSYVSAVPISIMYLVQAGVSIGRLNRFLKEEELDTSVVDRTSSANGTISVTDGTFSWDRDEPTTLQHINIEIPPGSLVAVVGQVGSGKSSLLNALLGDMERISGKINVKGSVAYVPQQAWIQNKTVKENILFGKQWNQSFYKKCLRTCALEQDLKILPAGDQTEIGEKGVNLSGGQKQRVSLARAVYQDCDVYLMDDPLSAVDSHVGKHIFDHVIGPEGLLQGKTRILTTNGISFLPKVDAIIVLTKGVISEIGTYQELLSHNGAFAEFIKNYLNEKESESESEEEED---MRSQLRRQISVLSGSESGSEQDHHVRKRKRQISRQTSKQTSRQTSFGESTHAQEVMKIGEQLIEEEYAERGTVKYTHMLSYIRASGLRAILMVTIGYIGFVSCLIGANIWLNLWSNDQVVNGTQQLT--DLRLGVYGGLGAGQLSYIVVQYFGIAFGCVIASGTIHKSFLERIMRAPMSFFDTTPLGRIMNRFSKDMETVDLNLPHTVEIILAASAQVIAVVAVVMYSTPIFAVVLLPLGVLYFMTQKLYLSSARQFIRIDATKRSPIYSHFGETLIGASSIRAYQQQERFMQLTDKMIDDNQMAWYGYIMSNRWCGVLMETYGCFVILFAAIFAVLATGSGSITGGDAGMSISLSLNVTQMLNYLVRASCDFEIQVVAIERIQEYSAVEVEAPWDIDHRRPPPEWPQKGEVQFDQYSVRYRPGLDLVLKNVTFQVEPGEKVGIVGRTGAGKSSLTLALFRIIESAAGSITIDGVKIADIGLHQLRSKITIIPQEPELFSGTLRSNLDPFGLYSDQDVWNALEHAHLKGFVATLPARLQHEISEAGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDMETDDLIQSTIRSEFKECTVVTIAHRLNTIMDYDRVLVLDKGTIKEFQPPSVLLQDKRSTFYGMAKDAGL 1563          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1B6EGY9 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.30404 PE=4 SV=1)

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 715/1574 (45.43%), Postives = 1006/1574 (63.91%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKK------SIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLI--VNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYP----VCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLP-SENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENE--APILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXX-XXXXXXXXXXXXKLIKQ--ELRKKL-----SITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTI--NNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            M        C +K      W +NV W+T NPDLT+CF+ TIL WIP +FL +   + +  +L  K      ++  + +  FN++  +   G F    + +  +    +V +  P  +F+       FSL++I +     ++G+ +SG+ F++W L +I  V     + +    +T +   + +++ ++ F  V I FI N FADS                           + +  EYP    +CPE+ ASF SK+TFSW   L   GF++PL  ++L+ LK ED+  E+VP+ ++ W+  +             K  +   H+   L  S +++     T  +    +   L  L       F F   LK++ D  +F+ P IL   I FI    E +W G+ Y   + L +  +T    Q+ F  ++ G+R +TA+IS IY+KAL++S ++RKE TVGEIVNLM+VDA +F D   + +++W +P+ I + ++FLWQ LGP+ +AGL ++I ++P+N VI SK K LQ +QM+ KD R+KL++EILSGIK+LKL+AWE S E++V  IR KE  VL++A +LNA TS  W C P +V+L +F  YVL D NN+L  QKAFVS+SLFNIL FP+SMLP  I   +Q  VS KRIN F+N EELDP++V    S   P+ + NG FSWG+++  A ILR+IN+ +++G+LV +VGTVGSGKSSL+SA LGEM +I+G V  K  VAYVPQQAW QN ++++NI+FGKS   + Y+++++ CAL +DL +LPAGD+TEIGEKGINLSGGQKQR+SLAR+VY +S VY  DDPLSAVD+HVGKHIFE V    G+L K TR+LVTH + +L + D I VMKDG VSE+GTYKELL   G F+DF+  +L++  ++  SE  D + +LI+   ELRKK      + + S  +    ++S   +S++    S S +           KL++ E A+ GGVK +V++YY++    L  +  I     Y    +  N+ LS WS   +I  N +QD + RD +LG+Y G    Q + IL+ +L+L  G+  A++ LH  +L +I+R P  FFD TP GRILNR  KD++ VD T+P+ +R WL+    V++++++I   +P F++ +IP+   YFF+Q+FY+ TSRQL+R++SI +SPIYSHF ESI G SSIRAY V  KF T+ E+  D +Q+  +  +  NRW+   LE +GN++I  S +FAV  RDT  +GL GLSVSYAL IT +L  +VR + D+E+N+VA+ERIKEY E   EAPW+     PP +WP  G+++F ++ VRYR GLDL L+ +NF V  GEK+GIVGRTGAGKSSL L+LFR++E A G I ID IDI+ LGLH LRS+LTIIPQDPVLFSG LR+NLDPF    D +IW ALE ++LK+F      GL+  +SE GENLSVGQRQL+CL RALL+KT +L+LDEATAAVD+ETD+LIQ +IRT FK CTVLTIAHRLNTIMD DRV+VL +G I E ++P  LL +  S+F SMAKDA L
Sbjct:    1 MAADGLDYFCGSK-----FWDANVTWNTENPDLTICFEKTILVWIPCVFLWVFSPLEVYYILHSKYRDISWNLLNACKVFFNLVIIVHCIGDFVFAVVQMMSNQMVHLVDIYSPAIKFVS------FSLVLI-LTVFNKVRGIRASGLQFLFWFLLVISGVPQFRTFLQQFLNETISEPIYEWVSYMVYFCAVCIMFILNFFADS---------------------------EPRFSEYPTVERLCPEVSASFPSKLTFSWFDSLALLGFKQPLEANNLWHLKYEDTSTEVVPLFEKYWSESVR------------KAANVPQHKASFLKRSGSVDIIGNSTGNTPTKHQASILPALCKAFGPTFLFGSFLKLMQDLLSFVSPQILSLLIAFI-KGKESMWRGYLYAIVLLLAASCQTIFLAQYFFRMSIVGLRIRTALISAIYRKALRMSNSARKESTVGEIVNLMAVDAQRFMDLTAYLNMIWSAPLQIALALFFLWQTLGPSVLAGLAVMIVLIPVNGVIASKAKGLQIRQMKNKDERVKLMNEILSGIKVLKLYAWEPSFEQQVLRIRNKEMKVLKQAAYLNAATSFIWACAPFMVSLVTFAVYVLVDENNVLDAQKAFVSLSLFNILRFPLSMLPMLISNMVQTSVSVKRINKFMNSEELDPNSVTHDHSEKDPLVMENGTFSWGDSQEDAVILRNINIRVKQGALVAVVGTVGSGKSSLVSAFLGEMDRITGRVNTKGSVAYVPQQAWIQNATMKENIIFGKSFDQNSYNRIVKGCALQQDLDMLPAGDKTEIGEKGINLSGGQKQRVSLARAVYNDSDVYFLDDPLSAVDSHVGKHIFENVIGPKGILKKKTRVLVTHSITFLPEVDLILVMKDGTVSESGTYKELLAKKGAFSDFLIQHLQEVDEETESELDDLKQQLIESNTELRKKFERQKSTESGSLRQRSNHSESGSVASLNRRRSSSSSEEKVPIEKKPGDKLIEAEKAETGGVKKQVYLYYLKSVGGLLTIATIALNIVYQVFSIGSNVWLSEWSSDTSIIVNGTQDTSKRDMYLGVYAGFGLGQVVTILVATLTLYLGLLSAARLLHYAVLINILRTPMEFFDVTPVGRILNRFSKDVEAVDQTLPDVIRGWLSCFMSVVATMVVISSITPIFLVVIIPIGIIYFFVQRFYVATSRQLKRLESISRSPIYSHFGESIQGASSIRAYGVQSKFITESEQKVDFNQVCLYPSLISNRWLAVRLETVGNLIIFFSSLFAVLSRDTTNAGLVGLSVSYALQITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAPWE-KSPGPPDDWPNKGQVDFLDYQVRYREGLDLVLKGINFRVNGGEKVGIVGRTGAGKSSLTLSLFRILEAANGQILIDGIDISSLGLHALRSRLTIIPQDPVLFSGTLRMNLDPFGKEKDEDIWRALEHSHLKNFVKGLSAGLQHQVSEGGENLSVGQRQLICLGRALLRKTKVLILDEATAAVDLETDDLIQRTIRTEFKDCTVLTIAHRLNTIMDSDRVVVLDKGAIVEYDSPPNLLKNRSSIFFSMAKDANL 1521          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1219.53 bits (3154), Expect = 0.000e+0
Identity = 677/1545 (43.82%), Postives = 970/1545 (62.78%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE--VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             CS    D   W  N  W T NPDLT CFQ T+L  +P  +L +       + L+     Y      N  K++    L+ I   D+F S  ++  G+       + P +  +  LL   + +   IKGV SSGI+  +W +  +   +   S+ ++ V  P   + FR+ T  I + ++ IS I +C +D   +     K S+                        CPE  ASFLS+I+F W T L+ +G+++PL   DL+ L  ED    +VP + R W+ E  +  R   K  Y     + + +    P E  ES        + +  P     L  T    F  S + K+I+D   F+ P IL   I F+ + +   WHG+FY   +F+ +  +T I Q++  +C VTG+R +TAI+  +Y+KAL ++ A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLWQ LGP+ +AG+ +++ M+P+NAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWEL+ ++KV TIRE E  VL+KA +L A ++  W C P LVAL +F  YVL D +N+L  QKAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EELD ++V+    T +   I I +G FSW + + P L+ IN+ I EG+LV +VG VGSGKSSL+SA+LGEM K  G V  K  VAYVPQQAW QN +L++NI+FG+    S Y KVLEACAL+ DL+ILP GD TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIFEKV    G+L   TR+LVTHGL++L +AD I VM DG ++E G+Y ELL   G FADF+RTY   + D   +    +    K++L++  +    F R+   + +   ++        +    ++  +    KL + + A  G VKL VF  Y++      + ++IL + ++  + +  N  LS W++   IN +Q   +R+  LG+YG L  +Q I +   S+S++ G  LAS+ LH  ML +++R+P SFF+ TPSG ++NR  K+ DT+D  IP+ +++++ S   V+ S  +I IA+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+Y+HF E+++GTS IRA+    +F  + +   D +Q  +F  I  NRW+   LE +GN ++  + +FAV  R  +  G+ GLS+SYAL +T SL  +VR S ++E+N+VA+ER+KEY + E EA W + +   P+ WP  G IE  NF +RYR  L+LA+ ++   ++ GEK+GIVGRTGAGKSSL L LFR+IE A+G I ID ++I  LGLHDLRS++TIIPQDPVLFSG+LR+NLDPF+ YSD ++W ALE+A+LK+F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G++ E ++P  L+A +K +F+ MAKD+GL
Sbjct:    6 FCSVDGSD-PFWDWNRTWHTHNPDLTQCFQNTLLVVVPCFYLWLFAPFYF-LYLKSHDRGYICMTHLNKAKTVTGFLLWIICWADVFYSFWERGHGVASAPVYLVSPTILGITMLLATLLIQYERIKGVQSSGIMLNFWLVATVCATVTFRSKILQAVNEPETVNVFRYSTFYIYYALLLISLILSCLSDQPPLFSQAVKDSNP-----------------------CPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVE--ESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFLRTYANAEQDGEPDGMTGK----KEKLQRNTTFVHFFPRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVINGTQ--PSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIA-KKGIFYKMAKDSGL 1516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1211.82 bits (3134), Expect = 0.000e+0
Identity = 680/1550 (43.87%), Postives = 969/1550 (62.52%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE--VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFG-----REKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             CS    D   W  N  W T NPDLT CFQ T+L  +P  +L +       + L+     Y      N  K++    L+ I   D+F S  ++  G+       + P +  +  LL   + +   IKGV SSGI+  +W +  +   +   S+ ++ V  P   + FR+ T  I + ++ IS I +C +D   +     K S+                        CPE  ASFLS+I+F W T L+ +G+++PL   DL+ L  ED    +VP + R W+ E  +  R   K  Y     + + +    P E  ES        + +  P     L  T    F  S + K+I+D   F+ P IL   I F+ + +   WHG+FY   +F+ +  +T I Q++  +C VTG+R +TAI+  +Y+KAL ++ A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLWQ LGP+ +AG+ +++ M+P+NAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWEL+ ++KV TIRE E  VL+KA +L A ++  W C P LVAL +F  YVL D +N+L  QKAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EELD ++V+    T +   I I +G FSW + + P L+ IN+ I EG+LV +VG VGSGKSSL+SA+LGEM K  G V  K  VAYVPQQAW QN +L++NI+FG+    S Y KVLEACAL+ DL+ILP GD TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIFEKV    G+L   TR+LVTHGL++L +AD I VM DG ++E G+Y ELL   G FADF+RTY       ++E   E   +     RK L   E+ G     R+   + +   ++        +    ++  +    KL + + A  G VKL VF  Y++      + ++IL + ++  + +  N  LS W++   IN +Q   +R+  LG+YG L  +Q I +   S+S++ G  LAS+ LH  ML +++R+P SFF+ TPSG ++NR  K+ DT+D  IP+ +++++ S   V+ S  +I IA+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+Y+HF E+++GTS IRA+    +F  + +   D +Q  +F  I  NRW+   LE +GN ++  + +FAV  R  +  G+ GLS+SYAL +T SL  +VR S ++E+N+VA+ER+KEY + E EA W + +   P+ WP  G IE  NF +RYR  L+LA+ ++   ++ GEK+GIVGRTGAGKSSL L LFR+IE A+G I ID ++I  LGLHDLRS++TIIPQDPVLFSG+LR+NLDPF+ YSD ++W ALE+A+LK+F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G++ E ++P  L+A +K +F+ MAKD+GL
Sbjct:    6 FCSVDGSD-PFWDWNRTWHTHNPDLTQCFQNTLLVVVPCFYLWLFAPFYF-LYLKSHDRGYICMTHLNKAKTVTGFLLWIICWADVFYSFWERGHGVASAPVYLVSPTILGITMLLATLLIQYERIKGVQSSGIMLNFWLVATVCATVTFRSKILQAVNEPETVNVFRYSTFYIYYALLLISLILSCLSDQPPLFSQAVKDSNP-----------------------CPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVE--ESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFLRTY------ANAEQDGEPDGMTDGAPRKTL---ENGGPAAVLRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVINGTQ--PSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIA-KKGIFYKMAKDSGL 1516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1205.66 bits (3118), Expect = 0.000e+0
Identity = 684/1555 (43.99%), Postives = 971/1555 (62.44%), Query Frame = 2
Query:  101 LCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIR-VKTPAN-DKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE--VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVN--KKLVDEEVAKI--------GGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             CS    D   W  N  W T NPDLT CFQ T+L  +P  +L +       + L+     Y      N  K++    L+ I   D+F S  ++  G+       + P +  +  LL   + +   IKGV SSGI+  +W +  +   +   S+ ++ V  P   + FR+ T  I + ++ IS I +C +D   +     K S+                        CPE  ASFLS+I+F W T L+ +G+++PL   DL+ L  ED    +VP + R W+ E  +  R   K  Y     + + +    P E  ES        + +  P     L  T    F  S + K+I+D   F+ P IL   I F+ + +   WHG+FY   +F+ +  +T I Q++  +C VTG+R +TAI+  +Y+KAL ++ A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +I+ +YFLWQ LGP+ +AG+ +++ M+P+NAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWEL+ ++KV TIRE E  VL+KA +L A ++  W C P LVAL +F  YVL D +N+L  QKAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EELD ++V+    T +   I I +G FSW + + P L+ IN+ I EG+LV +VG VGSGKSSL+SA+LGEM K  G V  K  VAYVPQQAW QN +L++NI+FG+    S Y KVLEACAL+ DL+ILP GD TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIFEKV    G+L   TR+LVTHGL++L +AD I VM DG ++E G+Y ELL   G FADF+RTY   + D   +   EE    ++E  +          E G   +    S S L+   + K  ++  +N    KK    + AK+        G VKL VF  Y++      + ++IL + ++  + +  N  LS W++   IN +Q   +R+  LG+YG L  +Q I +   S+S++ G  LAS+ LH  ML +++R+P SFF+ TPSG ++NR  K+ DT+D  IP+ +++++ S   V+ S  +I IA+P   + + PL   YFF+Q+FY+ +SRQL+R++S+ +SP+Y+HF E+++GTS IRA+    +F  + +   D +Q  +F  I  NRW+   LE +GN ++  + +FAV  R  +  G+ GLS+SYAL +T SL  +VR S ++E+N+VA+ER+KEY + E EA W + +   P+ WP  G IE  NF +RYR  L+LA+ ++   ++ GEK+GIVGRTGAGKSSL L LFR+IE A+G I ID ++I  LGLHDLRS++TIIPQDPVLFSG+LR+NLDPF+ YSD ++W ALE+A+LK+F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+VL +G++ E ++P  L+A +K +F+ MAKD+GL
Sbjct:    6 FCSVDGSD-PFWDWNRTWHTHNPDLTQCFQNTLLVVVPCFYLWLFAPFYF-LYLKSHDRGYICMTHLNKAKTVTGFLLWIICWADVFYSFWERGHGVASAPVYLVSPTILGITMLLATLLIQYERIKGVQSSGIMLNFWLVATVCATVTFRSKILQAVNEPETVNVFRYSTFYIYYALLLISLILSCLSDQPPLFSQAVKDSNP-----------------------CPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVE--ESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFLRTYANAEQDGEPDGMTEEGGEQEEESGQSEDGAPRKTLENGGPAAVLRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVINGTQ--PSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIA-KKGIFYKMAKDSGL 1530          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc6b.2 (multidrug resistance-associated protein 1-like [Source:NCBI gene;Acc:103043664])

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 632/1539 (41.07%), Postives = 937/1539 (60.88%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYS--RSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVS--TSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXX---XXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            LW+ N+ W TPNPDLT CFQ+T+L W P  +L + CA    + L        +     + K++L   L F   L+L      +   L   +   L P++ ++  +L + V  L  +KG  SS  LF++W+L ++ + + L +  +++  ++ + D  R       F +     I +CFAD            S+D+    +  P             CP   ASFLSKI F W + L+ +G+R PL  +DL+ L++ED+ ++I+  ++REW  +  ++ ++        L    + + Q L     E ++              LR L  T    F    L  +I+D   F  P +L   ++F+G+ +  +W G+ + F +FL+S  ++  N Q+M+ C   G+R KTA++ ++Y+KAL +S A+R+  TVGEIVNL+S D  K  DF  +F+ +W++PI I + ++FLWQ LGP+ +AG+  +I + P+N +I     KLQ  QM+  DGRIKL++EILSGIKILK +AWE + EE+V   REKE   L+K+  L + +  ++  +  L+A   FG YVL D  N+L  QK FVS++L NIL  P+S LP A+  T+Q +VS KR+  FL  +EL  D+V  +  + +   ++I +G FSW  +  P LR I++++  G LV +VG VGSGKSSL+SA+LGE  K SG V  K  VAYVPQQAW QN +L++NI+FG+    S Y  VLEACAL+ DL ILPA D TEIGEKG+NLSGGQKQR+SLAR+VY+N+ +YL DDPLSAVDA VG+HIF++V    G+L   TR+LVTHGL +L +AD I VM DG ++E G+Y ELL     FADF++T+   +      +       S+L   +    LS  +    + G A  +   ++S   + +  +           KL + + A  G VKLE+++ Y +       +  +  Y    AA +  N  L  W++   IN +Q  A  D  L ++G L   Q + I   +++++ G  +AS+ LH  +L +++ +P +FF++TPSG +LNR  K++D +D  IP+  ++ L    +++   II+ IA+P+  L ++PL+ FY  IQ FY+ TS QL+R++S+ +SPIY+HF E++ G S IRA+    +F  +     D +Q  +F      RW+   LE +GN+++L + + +V  +DT+  G+ GL+VS++L +T  L+ +VR   D+E+N+V++ER+KEY E   EAPW I     PS WPQ G IEF  + ++YR GLD AL+ +   VQ  EK+GIVGRTGAGKSSLAL +FR++E A+G I ID ++I  +GL DLRS++TIIPQDP+LFSG+LR+NLDPF+ YSD ++W ALE+A+LK+F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+V+  G I E+++P  L+A ++  F+ M ++AGLA
Sbjct:   13 LWNWNLTWFTPNPDLTECFQHTVLVWFPCFYLWL-CAPFYFLYLGFHDYGRISVSSLCVTKTVLGLSLAFFSLLELVYLLVSRSGELNNHMVFLLSPVIRSLTMVLTVCVIHLERMKGCRSSLFLFVFWTLAVVCSLVPLRANIQAVVGESCSRDSVRSAAFFTCFSLQLAQLILSCFADQR----------SDDLKWVDVKNP-------------CPVEDASFLSKILFWWFSGLVVKGYRSPLKAEDLWSLRKEDTSEKIIGDLEREWTTQCAKLQQQERGDSVTALGCRITEQTQLLHKLRQEQSSGFL----------LLRTLAKTFGPFFLTGTLCLIIHDAFMFSIPQVLSLLLSFVGDKDVPLWKGYLFAFTMFLLSCLQSLFNHQYMYSCFTVGMRVKTAVMGLVYRKALVISSAARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEIGLCLFFLWQRLGPSALAGITTVILIFPLNGLIAKMRSKLQEVQMKYMDGRIKLMTEILSGIKILKFYAWEKAFEERVLGYREKELKALKKSQILYSISIASFNSSTFLIAFAMFGVYVLIDEKNVLDAQKVFVSMALINILKTPLSQLPFAMSTTMQAIVSLKRLGKFLCQDELKLDSVVRAPFSPDGDSVTIEDGTFSWSRDGPPCLRRISVKVPRGCLVAVVGLVGSGKSSLLSAMLGETEKKSGNVTVKGSVAYVPQQAWIQNATLRENIVFGQEKKESWYQTVLEACALVRDLNILPARDATEIGEKGLNLSGGQKQRVSLARAVYRNADIYLLDDPLSAVDAQVGQHIFDRVIGPKGILKNKTRVLVTHGLNFLPQADLILVMGDGEITETGSYIELLNRRNAFADFVQTFAGNERKEIPTNKGTRKSVSRLSVADFSIDLSQEQLISGDMGGANIQTMEALSDSEQEQDQEEL--------GKLTEADKAHTGRVKLEMYVEYFRTIGLALIVPIVFLYAFQQAASLGYNYWLRLWADDPVINGTQ--ADADVKLAVFGALGIAQGVAIFGTTVAISLGGIIASRHLHMDLLSNVLHSPMAFFESTPSGNLLNRFSKEVDAIDCMIPDGFKMMLGYVFKLMEVCIIVLIATPFAGLVILPLTLFYVLIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQPRFILQANGRVDHNQTSYFPRFVATRWLAVNLEFLGNLLVLAAAILSVTGKDTLSPGIVGLAVSHSLQVTGILSWIVRAWTDVENNIVSVERVKEYAETPKEAPWTIENRSLPSAWPQTGSIEFQQYGLQYRRGLDWALKEITLNVQEREKVGIVGRTGAGKSSLALGIFRILEAAKGDIYIDGVNIAQIGLQDLRSRITIIPQDPILFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDNGYITEMDSPTNLIA-QRGQFYCMCREAGLA 1506          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc6a (multidrug resistance-associated protein 1-like [Source:NCBI gene;Acc:103039294])

HSP 1 Score: 1106.28 bits (2860), Expect = 0.000e+0
Identity = 645/1559 (41.37%), Postives = 959/1559 (61.51%), Query Frame = 2
Query:  104 CSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNI---IKSILVCGLFFIYC--LDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSR-SIRVKTP-ANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKF---FFSG-LLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIV--NGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRK---KLSITES--FGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            CS+   D  LW  N  W T  P+L+ CFQ+T+L W P ++L I C+   P       +Y   RG+  +     + L+ G F      ++ F    ++   +   +   L PI+ ++  +L + + +   ++G  SS +LF+YW L +I + + L ++  + V+   + D   ++     F +       +CFAD     +   K++                         CP   ASFLSK+ F W   L+ +G+R PL  +DL+ L+EED+  +I+  ++ EW  E     R  ++QQ   L S+ +     L S   +       + K+    +    LL T++  F   F SG L  +++D   F  P +L   + F+   +  +W G+FY   +FL+S  ++  N Q+M+ C   G+R KTA++ ++Y+K+L ++ A+R+  TVGEIVNL+S D  K  DF  +F+ +W++PI I + ++FLWQ LGP+ +AG+  +I + P+N  I  K  KLQ  QM+  DGRIKL++EIL+GIKILK +AWE +  EKV   REKE   LRK+  L + +  ++  +  L+A   FG YVL D  N+L  QK FVS++L NIL  P+S LP A+  T+Q +VS KR+  FL  EE+ PDNV          S+V  NG FSW ++    L+ I++ +  G LV +VG VGSGKSSL+SA+LGE  + SG V  K  VAYVPQQAW QN +LQDNILFG+    + Y +VLEACAL+ DL+ILPAGD TEIGEKG+NLSGGQKQR+SLAR+VY+ + +YL DDPLSAVDAHVG+HIF+KV    G+L   TR+LVTHG ++L +AD I V+ DG ++E+G+Y+ELL  +G FADFIRT+   +  ESS         +++  R+   +LS+T+   F R+  + +     + S   +S      +E+      KL + + A+IG VKLE++I Y +       +  +  Y    AA ++ N  LS W++   IN +Q     D  LG+YG L F Q + I   +++++ G  +AS+ LH  +L++++ +P SFF++TPSG +LNR  K+ID +D  IP+ +++ L+   +++   II+ +A+P+    + PL+  Y F+Q FY+ TS QL+R++S+ +SPIY+HF E++ G S IRA+    +F  +     D +Q  +F      RW+   LE +GN V+L + + +V  ++T+  G+ GL+VS++L +T  L+ +VR+  D+E+N+V++ER+KEY E   EA W       P  WPQ G IEF ++ ++YR GL+ AL+ ++  +QR EK+GIVGRTGAGKSSLAL +FR++E A+G I ID  DI  LGLHDLRS++TIIPQDPVLFSG+LR+NLDPF+ YSD E+W ALE+++L++F +     L +  SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IR+ F+ CTVLTIAHRLNTIMDY +V+V+ +G I E++TP  L+A ++  F+ M ++AGLA
Sbjct:    5 CSHNGLD-PLWDWNQTWYTHTPELSDCFQHTVLVWAPCIYLWI-CS---PFYCLH--LYCHGRGRLPLSLLCSAKLLLGFFLASFGFVEFFYILLERNQEIHRHLVFLLSPIVRSLTVVLAVCIIQWERVRGCRSSVVLFLYWLLGVICSLVPLRAKIQLAVEQGFSPDIVHYLAFFAYFALQLAQLFLSCFADQAPPGKVALKNA-------------------------CPVQDASFLSKLLFWWFRGLVVKGYRTPLQAEDLWSLREEDTSDKIISDLEEEWMAE-----RTKLQQQETYLSSSVA-----LGSRLPDQAQLLRKLQKEQSSGF---CLLRTLARNFGPCFLSGTLCLIVHDAFMFAIPQVLSLLLGFMREEDAPLWKGYFYASLMFLLSCLQSLFNHQYMYSCFTVGMRVKTAVMGLVYRKSLVINSAARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEIALCLFFLWQHLGPSALAGIATVILIFPLNGFIAKKRSKLQEIQMKFMDGRIKLMNEILNGIKILKFYAWEKAYLEKVLGYREKELWALRKSQILYSISIASFNSSTFLIAFAMFGVYVLIDDKNVLDAQKIFVSMALINILKTPLSQLPFAMSTTMQAVVSLKRLGKFLCQEEIKPDNVSRDPYKQDEDSVVVENGTFSWSKDGPLCLKRISVRVPCGGLVAVVGHVGSGKSSLLSAMLGETERRSGNVSIKGSVAYVPQQAWIQNATLQDNILFGREKKKTWYQRVLEACALLPDLEILPAGDATEIGEKGLNLSGGQKQRVSLARAVYRKADIYLLDDPLSAVDAHVGQHIFDKVIGPKGVLRDKTRVLVTHGTSFLPQADLILVLVDGEITESGSYQELLNRNGAFADFIRTFASSERKESS---------VQRGSRRSCARLSVTDYMLFSRDLSQEQLIGGDTNSVAMQSLEADIEQEQIPEDLGKLTEVDKARIGRVKLEMYIEYFRTIGLALIVPILFLYAFQQAASLAYNYWLSMWADEPVINGTQ--LNTDMKLGVYGALGFAQGMAIFGTTVAISIGGIIASRQLHLDLLKNVLHSPMSFFESTPSGNLLNRFAKEIDAIDCMIPDGLKMMLSYFFKLMEVCIIVLLATPFAAAIIFPLALLYAFVQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFSEQSRFILQANRRVDVNQTSYFPRFVATRWLAVNLEFLGNGVVLAAAILSVMGKETLSPGIVGLAVSHSLQVTAILSWIVRSWTDVENNIVSVERVKEYEETPKEAAWTSEGNSLPPTWPQVGTIEFQDYGLQYRKGLEFALKGISLHIQRREKIGIVGRTGAGKSSLALGIFRILEAAKGKIYIDGFDIAQLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDAYSDEEVWGALELSHLRNFVSGLPEKLNYECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDTLIQSTIRSQFEDCTVLTIAHRLNTIMDYTKVIVMDKGHIAEMDTPANLIA-QRGQFYRMCREAGLA 1506          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 1060.83 bits (2742), Expect = 0.000e+0
Identity = 616/1554 (39.64%), Postives = 925/1554 (59.52%), Query Frame = 2
Query:  167 PDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYC-LDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRS-----IRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSN--DKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVM------KDGNVSE----AGTYKELLK----------------NDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWF-LIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            PD+  CFQ T+L W+P  FL +  A+     LR     Y      +  K++L C + ++ C   LF S  ++  G   P   F+ P++     LL   + ++    GVHSS +LF+     L++   I  +RS     +R+     D FR    ++  V+V + FI  C A+    K+ L  + S+D        PN           +CPE+ ASF+S++TF W TR+   G+R+ L + DL+ L+ +DSC  +VP +   W +E  R+ ++    Q    E+   H      +E  +S    T       +P  +R +      ++    + K++ D  +F  P +L + I F+G+++   WHG+     +FL ++A + +  Q      VTGIR ++A+  ++Y+KAL ++ A+R     GE+  LMSVD     D     + +W +P+ I + MYFLWQ LGP+ +AG+ +++ ++P NA I   I+ LQ Q ++ +D R++ +SE LSG++I+K++AWE    + +  +RE E  VL +A + +  ++  W C+P LVAL SFG YVL D +++L  ++AFVS++LFN+L +P++ LP  +       VS +R+ +FL+ EELDP  V+ S S+  +  +SI  G F+W  +E PIL DI+L +  G L+ +VGTVGSGKSSL++A+LGE+ K+ G+V  K  VAYV QQAW QN SL+DN+LFG+ +  + Y +VL+ACAL +DL  LPAGD TEIGEKGINLSGGQ+QR+SLAR++Y  +SV+L DDPLSAVDAHVGKHIFE+V    GLL+  TR+LVTHGL++L   D+I V+      + G+ SE       + ELL+                +DGP           D+  S+     + + +  E R+ L      G ++           +     K               L+  E  + G +KL V ++Y++      + LA+L +C+    ++  N+ LS W+    +N +Q      Y LG+Y  L   Q++  L+  L +  G   A+ +LH  +L + + +P SF+D TP GRI+NR  KD+  +D  +P T  ++L +    I +I+II I++P F++A IPL   YFF+Q+FY+ TSRQL+R++S  +SP++SHF ES+ G +++RA++  ++F    +   D  Q   +  I+S  R    +LE +G  V+L + +FAV  RD++ +G  GLSVSYA+ +T  ++ MVR S ++ESN+VA+ER+KEY+E   EA W++   +PP++WP  G +EF ++S RYR GLDL LRN++  ++ GEK+GIVGRTGAGKSSL L L R++E A G I ID +DI+ +GLHDLRS++TIIPQDPVLF G+LR NLDPF  +SD E+W ALE A+L         G++   +E GEN SVGQRQL CLARALL++T +LVLDEATAAVD+ETD LIQ +IRT F +CTVLTIAHRL+T++D  RVMVL  GQI E ++P  LL+ + S FH MA+DAG+
Sbjct:    8 PDVPACFQATVLVWVPCTFLWLA-ALPYFAWLRHHRQGYIACSVLSRAKTVL-CAILWLLCWAKLFFSLWERSQGQSLPPIFFISPLILGATMLLAAVLGQVERWSGVHSSALLFV--FWLLVLVGAITGTRSSVLHAVRLGM-LEDPFRDTVFLMYSVLVLVQFILVCLAE----KRPLFSTDSDD--------PN-----------LCPEVGASFISRLTFCWFTRMAVNGYRRGLKMSDLWSLRHKDSCSFVVPHLQAVWRKEQARIAQRSAVSQSTPAETRKLH-----TTEKSQSGGAGTEGGATGQEPSLIRAMALAFGPRYLVGSVYKLLQDILSFASPLLLSHLIRFVGDNSRPTWHGYALAGLMFLCAIATSMLAHQHFHAGFVTGIRLRSALTGLLYRKALMITQAARLSCAGGELTTLMSVDVQHMADITNNLNFVWSAPLHICLAMYFLWQHLGPSVLAGVAVMLLLIPFNAFIALNIRTLQAQIIKKRDERVRTLSEALSGVRIIKMYAWEGRFRDVILRVREHELAVLGRAAYFSMLSAFTWLCSPFLVALASFGVYVLVDEHHVLDAERAFVSLALFNLLRYPLNQLPQLMSELAMASVSLRRLRNFLSLEELDPHAVDRSPSHLRESCVSIEGGTFTWSWDEPPILHDISLAVPRGCLLAVVGTVGSGKSSLMAALLGELNKLGGSVAVKGQVAYVAQQAWIQN-SLRDNVLFGRPLDETWYREVLQACALEQDLLALPAGDNTEIGEKGINLSGGQRQRVSLARAIYSKASVFLLDDPLSAVDAHVGKHIFERVIGPSGLLAGQTRVLVTHGLSFLPHVDRIVVLTAGRVSESGSYSELMLSGEAFSELLRIHGQGDGAGEDSPASQDDGPHVIIDLRSPGPDEVLSTCSNIADMEPVMTEPRRML--MRQLGSQEASGSGTTQGVSTETRGHKE--------TQPGSTLMQPESMETGHMKLSVVLHYLRAVGAPLSTLALLLFCANYTTMLGTNVWLSEWAGEPVVNGTQRNTG--YRLGVYSALGAVQSVLSLVMVLMVFKGCLRAAGSLHLALLDNKLHSPISFYDVTPLGRIINRFSKDVFMIDEVLPPTFLMFLGALCNSIFTILIIVISTPVFVVAAIPLVVIYFFVQRFYVATSRQLKRLESTVRSPVFSHFGESVAGAATLRAFRQEERFVIAGDRAVDALQRTSYPSIVSQRRVGAVWLEFLGACVVLFAAMFAVLSRDSLKAGTVGLSVSYAMQVTVVMSWMVRMSSEVESNIVAVERVKEYSETPPEADWEVESCRPPADWPSQGHVEFRDYSTRYREGLDLVLRNISCDIKGGEKVGIVGRTGAGKSSLTLCLLRMVEAASGAIAIDGVDISRIGLHDLRSRITIIPQDPVLFGGSLRDNLDPFGHHSDAEVWEALEFAHLGETARALPGGIQHECAEGGENFSVGQRQLACLARALLRRTRVLVLDEATAAVDVETDALIQGTIRTHFHACTVLTIAHRLHTVLDCTRVMVLSSGQIVEFDSPDVLLSRKDSAFHKMARDAGI 1515          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ABCC8 (ATP binding cassette subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:59])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 420/1281 (32.79%), Postives = 675/1281 (52.69%), Query Frame = 2
Query: 1142 GLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFL-VSMARTFINQQFMFMCAVTGI--RAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYV-LADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEEL--DPDNVEVST-------------------------------------------SNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTV--------------------------KRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTR--ILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXK--LIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQD---------LAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVF--IRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKP-PSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAK 4711
            G++  + +    ++P +    + FI +  E++ + +     +F  + + RT +   + +    TGI  RA    +       L  S  SR + T   I N+++VD+++   F F    LW  P+ IIV +  L+  LG + + G  ++  + P+   I +K+ + Q   +     RIK  SE++ GIK+LKL+AWE      V+  R KE   L       A ++      P    + +F  YV L+ P+  L+P  AF S++LF+IL  P+ +L   + F ++ L+S +++  FL   E+  +P+ ++V                                             S D  I +  G F+W  +E  +L DIN+ I  G L M+VG +G GKSSL+SA LGEM  +SG+V                          +R+  VAY  Q+ W  N ++Q+NI FG      +Y  V+  C+L  D+ ILP GD+T+IGEKGINLS GQ+QRIS+AR++YQ+++V   DDP +A+D H+  H+        GLL   TR  +LVTH L YL  AD I  MKDG V   GT K++  +D    +  +  + + D+E  ++   ES+  L ++ LR+ +   E   +   E                      ++ N +N +  D     + G+ L  +  Y+    +   +L +L       ++ + +  L+ W+       +Q+         L  +     I+  L     +  LI SL++ +    A++ LH  +L  I+RAP  FFDTTP G ILNR   D+  +D  IP++    + S    +S++ +I   +P F++AL+PL+  ++FIQK +   S+ LQ +D   K P+  H  E++ G ++IRA++   +F  +  EL D + + +  + + NRW++  ++ IG  ++L + + ++       + SGL GL ++YAL+++  L  +VRN  DIE  + AI+R+    ++E E     PE+   P +WP  G+I+ +  S RY   L  AL+NL+  +Q G+K+GI GRTG+GKSSL+LALFR+++  +G+I IDD+DI+ + L  LRS+L+II QDPVLFSG++R NLDP    +D  +W ALEIA LK        GL+ T+ E GEN S+GQRQL CLARA +++T IL++DEATAA+DM T++++Q  + TAF   TV+ IAHR+  I+D D V+VL QG ++E ++P  LLA+  ++F S+ K
Sbjct:  321 GIVHHLNNDEQQLKPQVRALGVYFISS-REFLANAYVLSVLLFFSLVLQRTLLQASY-YKAIETGIKFRAAVQTMIYDKILHLSTSSVSRGKMTSRYISNVVTVDSNQLMWFLFLCPNLWALPVQIIVGVSLLYSLLGVSALIGAAVIALLAPLQYCIATKLARAQKLTLEHSSSRIKQTSELVHGIKLLKLYAWEQVFCSTVEETRSKELRSLSTFAIYTALSTFMNAAIPITAVMATFVTYVHLSSPDITLSPAVAFASLALFHILVTPLFLLSTVVRFAVKALISMQKLTEFLATSEIGDEPNTLDVEPRPKKSSNADVVQMMAVNRKQPQKPVWDDFEPPQDWRQFEFTDGSEDFAIKVTGGVFTWASSEPSLLTDINICIPHGQLTMVVGQIGCGKSSLLSATLGEMHLVSGSVYWNSSPRQQSVNTKNNRQERRASTFCRRRGSVAYAAQKPWILNSNVQENITFGSPFNEERYKAVINTCSLQPDIDILPQGDRTQIGEKGINLSAGQRQRISVARALYQHTNVVFLDDPFTALDIHLSDHLMHSGIL--GLLHNDTRTVVLVTHKLQYLTHADWIIAMKDGTVQREGTLKDIQTSDPELYEMWKELMNKQDEELQKETIIESRTALERKNLRRAMYSKEVLVKTSFE----------------------DEENGINSEHFDSMSHLLPGLPLGEWRSYLAASGWPLLLLIVLSQLCKHVSMAAPDFWLAMWTSRALNVTAQNHNCTSSSVCLCLQSLLASIFAVLCCLAVVMCLISSLAVEWVGLKAARGLHKRLLGRIVRAPLRFFDTTPLGSILNRFSADLHMIDQLIPSSTESLVRSSLFSLSAVSVIAYVTPIFLVALVPLALVHYFIQKHFRIASKDLQELDENTKLPLLLHIMETVDGIATIRAFRHESQFRQRIFELIDANNVPFLFLSAANRWLEVRMDYIGASIVLATAMASITRSFYSGLDSGLVGLGLTYALLVSIYLNWVVRNLADIEVQLQAIKRVNNLMKVEIEDDERSPELHAVPEDWPHRGEIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPGGLDATVREGGENFSLGQRQLFCLARAFVRQTAILIMDEATAALDMATEKILQKVVMTAFADRTVVMIAHRVANILDADVVLVLNQGLLEENDSPANLLANPDTIFSSLVK 1575          

HSP 2 Score: 74.7146 bits (182), Expect = 1.592e-13
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 2
Query: 1985 LVSAKRINHFLNGE-ELDPDNVEV-STSNDKP----ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKE-PVAYVPQQAWCQNRS--LQDNILFGKSMVY----------SKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN-DGPFADFIRT 2749
            L + KR+N+ +  E E D  + E+ +   D P    I I   +  +  +  P L++++  I+ G  V I G  GSGKSSL  A+   +    G++   +  ++ +P        S  LQD +LF  S+ +          S     LE   L   +K LP G    + E G N S GQ+Q   LAR+  + +++ + D+  +A+D    K I +KV  +    +  T +++ H +A +  AD + V+  G + E  +   LL N D  F+  +++
Sbjct: 1305 LQAIKRVNNLMKVEIEDDERSPELHAVPEDWPHRGEIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPGGLDATVREGGENFSLGQRQLFCLARAFVRQTAILIMDEATAALDMATEK-ILQKVVMTA--FADRTVVMIAHRVANILDADVVLVLNQGLLEENDSPANLLANPDTIFSSLVKS 1576          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007076.1 (pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 gene:ENSPMAG00000006379.1 transcript:ENSPMAT00000007076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 399.823 bits (1026), Expect = 1.588e-124
Identity = 219/509 (43.03%), Postives = 323/509 (63.46%), Query Frame = 2
Query: 3170 YFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIG--SGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKS 4690
            ++L +YG LA    +F L+++   AYG   A+K +H  +L  +++AP SFFD TP+GRI+NR   D+ TVD ++P  + I++     ++ +I+++C   P+  L L+PL+  Y+ +QK+Y  TSR+L+R+ S+  SPIYSHF ES+ G + I+A++ TD+FT + E   + +Q   F  ++   W+   L+++G ++++     AV      G   GL GL+++YAL I   L+ +V +    E+ +V++ER++EY  I SE     P    P +WPQ G + F    + YRPGL  AL  ++F +   EK+GIVGRTG+GKS+L   LFR+++   G I ID+ DI+ L L  LRS L IIPQDP LFS  +R NLDP   Y D E+W  LE  +LKSF      GL+  ++E G + S GQRQL+CLARA+L K  IL +DEATA+VD +TD L+Q +IR+ F + TVLTIAHR NTI+D DRV+VLQ G++ E  +P  LL D +S
Sbjct:   20 FYLSVYGALAAGNTVFTLLRAFLFAYGGVCAAKNIHVTLLHKVLQAPVSFFDATPTGRIMNRFSSDLFTVDDSLPFIMNIFMAQLFGLVGAIVVMCYGLPWMALVLLPLAGVYYCVQKYYRFTSRELKRLGSVTLSPIYSHFAESLSGLAIIKAFRATDRFTRENEARLELNQRCQFAAVAVMHWLDVRLQMMGVVIVVSLAALAVLEHHLRGVDPGLVGLAIAYALGINGRLSGLVSSFTQTETQMVSVERVQEYRGIASEEAHRHPTHVSP-DWPQGGALTFDKVFLTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLDQG-GLQAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDTDVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQDPRS 526          

HSP 2 Score: 61.6178 bits (148), Expect = 1.220e-9
Identity = 54/219 (24.66%), Postives = 101/219 (46.12%), Query Frame = 2
Query: 2126 LRDINLEIEEGSLVMIVGTVGSGKSSLISAIL-------GEMFKISGTVKR------KEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTR--------ILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN 2719
            L  I+  I     V IVG  GSGKS+L S +        G ++  +  + +      +  +A +PQ  +  + ++++N+    S    +  +VLE C L +   +   G Q E+ E+G + S GQ+Q + LAR++   + +   D+  ++VD             +D LL KT R        + + H    +  +D++ V++ G V E  +  +LL++
Sbjct:  317 LNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHL-KSFVLDQGGLQAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQ-----------DTDVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQD 523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006454.1 (pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:ENSPMAG00000005809.1 transcript:ENSPMAT00000006454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 392.119 bits (1006), Expect = 2.974e-122
Identity = 212/488 (43.44%), Postives = 311/488 (63.73%), Query Frame = 2
Query: 3248 GMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTE-IESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAG-KSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSM 4705
            G   AS  LH+ +   ++R+  + FDTTP+GR+LNR  +D+D VDV +P    +++ +   V+  + +I    P+F+LA+IPL   +  I K      R+L+R+D+I  SP  SH   S+ G  +I AY  +D+F  + +EL D +Q   FL     RW+   L++I   +I  + +  V +   I +  AGL++SYA+ +T +    +R + + E+   ++ERI+ Y E +E EAP  +PE    +EWPQ+G + F +  +RYR GL L L+ +   ++  E +GIVGRTG+G KSSL + LFRL+E   G+I ID + I  +GL DLRS+L+IIPQ+PVLF G +R NLDP  LY+D +IW ALE  ++K    Q    LE  + ENGEN SVG+RQL+C+ARA+L+ + IL+LDEATAA+D ETD LIQ +IR AF  CT+LTIAHRLNT++  DR+MV+ QGQ+ E ++P  LL +  S F +M
Sbjct:    3 GTLRASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVDVRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFIRELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDTNQACLFLFSCAVRWLAVRLDIISVALITTTALMMVLMHGQIPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHYIEALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFGDCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLENRASRFAAM 490          

HSP 2 Score: 72.7886 bits (177), Expect = 3.202e-13
Identity = 69/287 (24.04%), Postives = 126/287 (43.90%), Query Frame = 2
Query: 1952 LPGAIVFTIQ-------GLVSAKRINHFLNG-EELDPDNV-EVSTSNDKP----ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTV--------------KRKEPVAYVPQQAWCQNRSLQDNI----LFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN 2719
            L G   FTI+          S +RI H++   EE  PD+V E   + + P    +S  +    + E    +L+ +   I+    V IVG  GSG  S +   L  + ++ G                  +  ++ +PQ+      +++ N+    L+    ++    + LE   + +++  LP   +TE+ E G N S G++Q + +AR++ ++S + L D+  +A+D      I E +  + G     T + + H L  +   D+I VM  G V E  +   LL+N
Sbjct:  203 LTGTFQFTIRLASETEARFTSVERIQHYIEALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIW----EALERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFG---DCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLEN 482          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001536.1 (pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 gene:ENSPMAG00000001392.1 transcript:ENSPMAT00000001536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.8 bits (987), Expect = 2.731e-119
Identity = 215/514 (41.83%), Postives = 334/514 (64.98%), Query Frame = 2
Query: 3182 IYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVF--IRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWD--IPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAK 4711
            ++G L  +      I SL++ +     ++ +HN ML+ I+ AP  +FDTTP G ILNR   D + +D  IP T+   + S    +S++ II   +P F++AL+PL+  Y+FIQK++   SR LQ +D   + P++SHF E++ G ++IRA++   +F  +  ELTD + + +  + + NRW++  L+ IG  ++L++ V ++     +T+ S   GL ++YALM++  L  +VRN  DIE  + AI+R+    +IE+E+ +D  + + + P  WPQ+G+I+    SVRY   L   L+++N  +Q  +K+GI GRTG+GKSSL+LA FR+++  EG I ID+IDI  + LH LRS+L+II QDP+LFSG++R NLDP     DG +W AL+IA LK        GL+  ++ENGEN SVGQRQL CLARA ++KT+I ++DEATA++DM T+ ++Q  + TAF + TV+ IAHR++TI+  D VMVL++G + E +TP  LLA + S+F S  +
Sbjct:    5 VFGLLCCSGIALCFITSLTVEWTGLKTARNVHNNMLKRIVLAPMRYFDTTPLGHILNRFSADTNIMDQQIPTTLESLMRSALLCLSALGIIAYVTPIFLIALVPLAIAYYFIQKYFRVASRDLQELDDSTQLPLFSHFSETVEGITTIRAFRHEVRFRQRLLELTDANNISYLFLSAANRWLEVRLDYIGACIVLIASVASITDSWNNTLSSARVGLCLTYALMVSNYLNWVVRNLADIEVQMGAIKRVNNLLQIETES-YDGLLSQAQVPDNWPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDMATESILQKVVMTAFANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAHD-SMFASFVR 516          

HSP 2 Score: 87.8113 bits (216), Expect = 6.244e-18
Identity = 74/269 (27.51%), Postives = 122/269 (45.35%), Query Frame = 2
Query: 1997 KRINHFLNGEELDPDNV--EVSTSNDKP----ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKE-PVAYVPQQAWCQNRS--LQDNILFGKSMVYS----------KYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIR 2746
            KR+N+ L  E    D +  +    ++ P    I I   +  +     P+L+ +N  I+    V I G  GSGKSSL  A    +    G +      +A +P        S  LQD ILF  S+ ++             + L+   L   +K LP G    + E G N S GQ+Q   LAR+  + +S+++ D+  +++D    + I +KV  +    +  T +++ H +  +  AD + V+K G+V E  T   LL +D  FA F+R
Sbjct:  251 KRVNNLLQIETESYDGLLSQAQVPDNWPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDM-ATESILQKVVMTA--FANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAHDSMFASFVR 516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: BPT1 (ABC type transmembrane transporter of MRP/CFTR family; found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p [Source:SGD;Acc:S000003938])

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 471/1268 (37.15%), Postives = 716/1268 (56.47%), Query Frame = 2
Query: 1145 LLKVIYDQSNFIQPAILGYYINFIGNHNEYIW---HGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIR-EKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE-VSTSNDK----PISIVNGNFSW-----------GEN----EAPI-------LRDIN-LEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGT--------VKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVF-SSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLK---NDGPFADFIRTY---LXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXX---XXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQC----GSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQS-LSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDT---IGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQ------------------TDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            L +   D  + +QP  L  +I+ +       +   +G F    +F++S+   F+  QF       G+  + ++ S++Y+K+L+L+LA R E++ G+I+NLMSVD  + Q F      +  +PI IIV +  L+  LG A I GLV +  M+PINA +  K+KKL   QM+ KD RIK I+E+L+ IK +KL+AWE  +  ++  +R + E    RK   ++     AW C P +V   +FG + L   ++ L+P   F S+SLFNILN  +  +P  I   I+  VS +R+  FL  +E+D   +E +  S D+     I + N  F W           G+N    E  I       L++I+  E + G LV +VG VG+GKS+ + AILG++  +SG+        + R   VAY  Q++W  N S+++NILFG       Y   ++AC L+ DLKILP GD+T +GEKGI+LSGGQK R+SLAR+VY  + +YL DD LSAVDA V K+I E V      LL   T IL T+ ++ L  +  I+ +++G + E G Y++++    N       +  +   ++  ++   +        + + L+ K++ +E+      E++     + S  +   +++       + ++V K     E  ++G VK ++++ YI+     G  LF +  IL     LA     N  L  WSE+   N S +      F+G+Y  +    A F  ++S + L Y     SK LH  M +S+IR+P +FF+TTP GRI+NR   D+D VD  +      +  S    + ++I++    P+F++  + L   Y + Q FYI  SR+L+R+ SI  SPI S   ES+ G S I AY   ++F     E    +    F   S NRW+   L+ IG  ++L + + A+   +T   + SG+ GL +SY+L +T SL  +VR +  IE+N+V++ERI EY E+  EA    PE +P   WP  G IEF N+S +YR  LD  L N+N  ++  EK+GIVGRTGAGKS+L+LALFR++EP EG I ID IDI+ +GL DLRS L IIPQD   F G ++ NLDPFN YS+ E+  A+E A+LK    +                   D+ L+  I+ENG NLSVGQRQL+CLARALL ++ ILVLDEATA+VDMETD++IQ++IR  FK  T+LTIAHR++T++D D+++VL QG ++E ++P KLL+D+ S+F+S+ +  G
Sbjct:  297 LYETTSDLLSVVQPQFLRIFIDGLNPETSSKYPPLNGVFIALTLFVISVVSVFLTNQFYIGIFEAGLGIRGSLASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQIIVVLTSLYWLLGKAVIGGLVTMAIMMPINAFLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFS-DSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYALENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTEHRSESEVDEPLQLKVTESETEDEVVTESELELIKANSRRASLATLRPRPFVGAQLDSVKKTAQKAEKTEVGRVKTKIYLAYIKACGVLGVVLFFLFMILTRVFDLAE----NFWLKYWSESNEKNGSNERVW--MFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDI-LDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDRTILTIAHRIDTVLDSDKIIVLDQGSVREFDSPSKLLSDKTSIFYSLCEKGG 1556          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YBT1 (Transporter of the ATP-binding cassette (ABC) family; involved in bile acid transport; negative regulator of vacuole fusion; regulates release of lumenal Ca2+ stores; similar to mammalian bile transporters; YBT1 has a paralog, VMR1, that arose from the whole genome duplication [Source:SGD;Acc:S000003971])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 406/1181 (34.38%), Postives = 656/1181 (55.55%), Query Frame = 2
Query: 1415 VGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWG-ENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTV------KRKE----------PVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAY-LAKADKIFVMKDGNVSEAGTYKELLKNDGPFAD---FIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQ-----------CGSYLFAMLAILCYCSYLAALVSGNIV--------------------LSSW------SEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANL---------------------KSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            +G I+NLM++DA K  +   + H    + +  +V +  L++ LG A I G+++++ MLP+N  +   I  LQ + + + D RI+ ++E    I+I+K F+WE + E+ + TIRE E  +L     + + +S  WF TP +V   SF  Y+      +LT   AF ++SLF +L  P+  L   + F +Q  VS  R+  FLN  +    +      N    +  N   SW  +N+   L+D+N+E + G L +++G  GSGK+SL+ A+LGEM+ ++G V       R+E           +AY  Q AW  N ++++NILF      ++Y  V+EAC L  D +IL AGD TEIGEKGI LSGGQKQR+SLAR++Y N+   L DD LSAVD+H    I++   +   L+   T ILV+H +A  L  A+ + +++DG V + G   ++L+  G F +      + L + +  ++      + L      K+  ++ +      EAK  + S  +   +++            + KL+ EE  + G V L+V+ +Y++              +L A L  +    ++ A  S N++                    L  W      S A   N      +  Y+L +Y  + F QA+    +++        AS+ + N++L  ++ +   FFD TP+GRI+NR  KDI+ +D  +   ++    S    +S++I+I   +P F+   I +S  Y+F+  FY+  SR+L+R +SI +SPIY HF E+++G ++IRA+    +F  +     D++   +F +   NRW+ F +++IG++VI  +G+F +F  + + SG+AG+S++YA+  T     +VR   ++E N+ ++ER+KEY EIE E P++  +  PP +WPQ+GKIE ++ S+RY P L   ++N++F+V    K+GIVGRTGAGKS++  ALFR +EP  G IKID+IDI+ + L  LR  +TIIPQDP LFSG ++ NLDP++ +SD +I+ AL+  NL                      S      L L   ISE G NLS GQRQL+CLAR+LL+   I++LDEATA++D  +D  IQ +IR  F+  T+LTIAHRL +++DYD+++V+  G++KE + P  LL +++S F+SM + +G
Sbjct:  475 LGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQ-GEVLTTPVAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTKKYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGP-LMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQK-GLFGEDELVKSSILSRANSSANLAAKSSTSLSNLPAVKEQQVSVNNNSSHFEAKKLQKSLRTEAERTE------------DGKLIKEETKEEGVVGLDVYKWYLKIFGGWKIVSFLASLFLIAQLLYIGQSWWVRAWASHNVIAKIIPRAQRAIAFISKKASHLIDWRGSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMEIEQE-PYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHPYSLLLNKQSAFYSMCEHSG 1639          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: VMR1 (Vacuolar membrane protein; involved in multiple drug resistance and metal sensitivity; ATP-binding cassette (ABC) family member involved in drug transport; potential Cdc28p substrate; induced under respiratory conditions; VMR1 has a paralog, YBT1, that arose from the whole genome duplication [Source:SGD;Acc:S000001027])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 402/1163 (34.57%), Postives = 636/1163 (54.69%), Query Frame = 2
Query: 1415 VGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPI----LRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGT--VKRKEP--------------VAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAY-LAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK-KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILC-YCSYLAALVSGNIVLSSWSE------------------AGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPE-----VKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIAL------------EIANLKSFFAQTD---LGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            +G I+NL+S+D+ K  +   + ++   + I IIV +  L+  LG +  AG+ +++ M P+N ++ + + K Q Q ++  D RI  ++E L  I+I+K FAWE ++  ++K+IR+KE   L K   + + TS  WF TP LV   +F         ++  P  AF ++SLF +L  P+  L   + F  Q  VS KRI+ FL  ++ +  N    + +   I   N   +W EN++ +    L  +N++ + G L +I+G+ GSGKS+L+  +LGE+  ISG+  V   EP               AY  Q AW  N ++++NI+F       +Y+KV++AC L  DL+ILPAGD TEIGEKGI LSGGQKQRISLAR+VY ++   L DD LSAVD+H    I+E   +   L+   T ILVTH ++  L  A    V+++G V   GT  EL ++ G F                           +E   +LS  +S   EK   + +              +      N VN  +L++EE    G +  +V+ +Y++      A+ A+   Y +     +S +  +  W                     G  ++S++     Y+L +Y  +   QA+    +++        AS+ + N +L  ++ A   FFD TP GRI+NR  KDI+ VD  +   + + +    +  S I +I + +P F+   + +   YFF+ K+Y+  SR+L+R+DSI KSPI+ HF E+++G  +IRA+    +F  +     D++   +F +    +W  F +++IG  ++L SG F +     I SGLAG+S++YA++ T     +VR     E N+ ++ER+KEY+ IE E      E     +  PS WP++G+IE  N S+RY P L   +RN++F V    K+GIVGRTGAGKS++  ALFRL+EP  G IKID  DI+ + L  LR  +TIIPQDP+LF+G ++ N+DP++ Y + +I+ AL            E+ N +  F  T    L L   I+E G NLS G+RQL+ +AR+LL++  I++LDEAT+++D ++D LIQ  IR+ F   T+LTIAHRL +++DYDR++V+  G++KE + P +LL DE+ +F+SM +D+G
Sbjct:  445 LGTIINLISIDSFKVSELANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFPLNFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAPL-AFTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQLTISPDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGP-LMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITEL-QSKGLF---------------------------KEKYVQLSSRDSIN-EKNANRLKAPRKNDSQKIEPVTENINFDANFVNDGQLIEEEEKSNGAISPDVYKWYLKFFGGFKALTALFALYITAQILFISQSWWIRHWVNDTNVRINAPGFAMDTLPLKGMTDSSKNKHNAFYYLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSIEQENYLGHDEGRILLLNEPS-WPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKSTILTIAHRLRSVIDYDRIIVMDAGEVKEYDRPSELLKDERGIFYSMCRDSG 1575          

HSP 2 Score: 81.6481 bits (200), Expect = 8.958e-16
Identity = 125/555 (22.52%), Postives = 236/555 (42.52%), Query Frame = 2
Query: 1241 HGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQD--FPFF----FHLLWVSPITIIVTMYFLWQELGPA--TIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELS-LEEKVKTIREKECLVLRKAMFLNAFTSVAWFC-TPPLVALF---SFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTI--QGLVSAKRINHFLNGEE---LDPDN------VEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVK-------------RKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALI---EDLKILPAGDQ------------TEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKND-GPFADFIR 2746
            + F+Y+   FL+ + +  +      M  ++G+RA   I + +    L   +       VG I+N  S D         P+     F L+  + I  ++T+      + P   T+A +V ++    +     +  ++L+      K    +  SE L G+  ++ F  E   + E +  I +       +A F  + T V WF     ++  F   + G+++L +  NI         ISL   + F    L    +++     + S +R+  + + E+   L  D        E S   D  I I N +  +  N  P++R+++ +++  S + IVG  G+GKS++I+A+   +  I+G +K              +  +  +PQ       +++ N+         K  K L    LI   E  ++L + ++            TEI E G+NLS G++Q + +ARS+ +   + L D+  S++D +   H+ + +  S+   +K+T + + H L  +   D+I VM  G V E     ELLK++ G F    R
Sbjct: 1037 NAFYYLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITV------ITPRFLTVAVIVFVLYFF-VGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNN-----RAFFYLSVT-VKWFSFRVDMIGAFIVLASGSFILLNIANI---DSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSID-YDSDHLIQGIIRSE--FNKSTILTIAHRLRSVIDYDRIIVMDAGEVKEYDRPSELLKDERGIFYSMCR 1572          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 503.056 bits (1294), Expect = 4.898e-152
Identity = 282/594 (47.47%), Postives = 403/594 (67.85%), Query Frame = 2
Query: 2969 DEEVAK-----IGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSL-AYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVF--IRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSF-FAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            DE +AK      G VK  +++ Y +  +     + IL     +   V GN+ L  WSE  +   S   AAR  +L IY  L    A+  LIQ++ L  +    ASK LHN+M  S++RAP +FF+TTP GRILNR   DI  VD  +  T   +  +  +V  +I +IC  +  FI  +IPLS FY + Q++Y+ TSR+L+R+DSI +SPIYSHFQE++ G +++R Y    +F+   +   D +   ++  I+ NRW+ + LELIG+I+IL +   +VF   + T+ +G+ GLS+SYAL IT +L  +VR + ++E+N+V++ERIKEY +++SEAP  +   +PP EWP  G I+F+N+S RYRP LDL L+++N  ++  EK+GIVGRTGAGKSSL LALFR+IE +EG I ID+I I  +GL+DLR KL+IIPQD  +F G +R N+DP N Y+D  IW ALE+++LK    + ++ GL+  ++E G NLSVGQRQL+CLARA+L  + ILVLDEATAAVD+ETD+++Q +IRTAFK  T+LTIAHRLNTIMD DR++VL  G++ E ++P +LL+D KSLF+S+  +AGL
Sbjct:  920 DENIAKREHREQGKVKWNIYLEYAKACNPKSVCVFILFIVISMFLSVMGNVWLKHWSEVNSRYGSNPNAAR--YLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKSLFYSLCMEAGL 1511          

HSP 2 Score: 375.555 bits (963), Expect = 1.477e-107
Identity = 239/687 (34.79%), Postives = 360/687 (52.40%), Query Frame = 2
Query:  779 PELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEY--------------------IWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIRE-KECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE----VSTSNDKPISIVN-GNFSWGENE--APILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKN-DGPFADFIRTY 2752
            P   A+  S+ITFSW + L+  G+ K L   DLY L    S +E+   +++ W  EL                                         K    P     +  T   K   +   K I+D   F QP +L   I F+ ++N                      I  GF   F +FLV   +T +  Q+      TG+  K+A+ ++IY+K+L LS  +    + G+IVNLMSVD  K QD   + +L+W  P  II+ +Y L++ LG +   G+++L+ M+P+N+ +    KKLQ  QM+ KD R ++ISEIL+ IK LKL+AWE    EK++ +R  KE   L K     A TS  +   P LV+  +F  +V  + +  LT    F +++LFN+L+FP+ ++P  +   I+  VS  R+  F   EEL PD+V+    V    D  I+I +   F W         L++IN + ++G+L  IVG VGSGK++L+S +LG++F++ G       VAYV Q  W  N ++++NILFG       Y K ++ACAL  DL IL  GD+T +GEKGI+LSGGQK R+SLAR+VY  +  YL DDPL+AVD HV +H+ E V   +GLL   T++L T+ ++ L+ AD I ++ +G +++ GTY E+ K+ D P    +  Y
Sbjct:  211 PYDSANIFSRITFSWMSGLMKTGYEKYLVEADLYKLPRNFSSEELSQKLEKNWENEL-----------------------------------------KQKSNPSLSWAICRTFGSKMLLAAFFKAIHDVLAFTQPQLLRILIKFVTDYNSERQDDHSSLQGFENNHPQKLPIVRGFLIAFAMFLVGFTQTSVLHQYFLNVFNTGMYIKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFAVFVYTE-DRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEITKDADSPLWKLLNNY 855          

HSP 3 Score: 69.3218 bits (168), Expect = 4.254e-12
Identity = 57/215 (26.51%), Postives = 101/215 (46.98%), Query Frame = 2
Query: 2123 ILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKIS--------------GTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIED-LKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKND 2722
            +L+ IN+ I+    V IVG  G+GKSSL  A+   M + S              G    +  ++ +PQ +     ++++NI            + LE   L E  L +   G   ++ E G NLS GQ+Q + LAR++   S + + D+  +AVD    K + E + ++       T + + H L  +  +D+I V+ +G V+E  +  +LL ++
Sbjct: 1288 VLKHINIHIKPNEKVGIVGRTGAGKSSLTLALF-RMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTA---FKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDN 1498          

HSP 4 Score: 60.4622 bits (145), Expect = 2.279e-9
Identity = 99/437 (22.65%), Postives = 187/437 (42.79%), Query Frame = 2
Query: 3485 LIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIG---NIVILLSG--VFAVFI--------RDTIGSGLAGLSV-SYALMITTSLAVMVRNSCDIESNVVAIERIKEY---TEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDL-----GLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDME-TDELIQNSI--RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            ++PL+ F   IQK       +LQ+     K        E +    S++ Y     +  K EE+ +  ++     + C      Y+ +     NIV  L     FAVF+         D +   L   ++ S+ LMI      MV NS  IE++V +I R+  +    E++ ++   +P+VK   +   N   + + F  + +P   +AL+N+NF  ++G    IVG+ G+GK++L   +   +   +G                +   +  + Q P + +G ++ N+  F    D E +       +K+     DL     G +  + E G +LS GQ+  + LARA+  + +  +LD+  AAVD      LI++ +       + T +   ++++ +   D + +L  G+I +  T  ++  D  S    +  + G
Sbjct:  458 MMPLNSFLMRIQK-------KLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC------YMAVTSFQFNIVPFLVSCCTFAVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIP----MVLNSF-IEASV-SIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGDD-ATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKG-------------FATVHGSVAYVSQVPWIMNGTVKENI-LFGHRYDAEFY----EKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEITKDADSPLWKLLNNYG 856          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YOR1 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter mediates export of many different organic anions including oligomycin; homolog of human cystic fibrosis transmembrane receptor (CFTR) [Source:SGD;Acc:S000003513])

HSP 1 Score: 499.59 bits (1285), Expect = 4.973e-151
Identity = 317/895 (35.42%), Postives = 503/895 (56.20%), Query Frame = 2
Query: 2126 LRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVM-KDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVD-----EEVAKIGGVKLEVFIYYIQC--GSYLFAML---AILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEY-TEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIAL---------EIANLK--------SFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
             +D+N +I++G  +MI G +G+GKSSL++A+ G M K  G V+    +  +    W QN S++DNI+FG      KY +V+  C+L  DL ILPAGD TEIGE+GI LSGGQK RI+LARSVY+   +YLFDD LSAVD+ VGKHI ++  +  G+L+  TRIL TH L+ + +A ++ V+  DG V + GT  EL   +    + ++                     K++  ++  +    G+ K E++ +  + +   +   S         N  K + D     +E   +  + L+++  YI+   G + F  L   AIL   +   +L S ++ LS W+E    N         +++G+Y    F   IF+  Q   L     +ASK L+   ++ I+  P S+ DTTP GRILNR  KD D++D  +  ++R+  +  + ++   ++  +  P+F +A+  L   +  I   Y  + R+++R++++++S +Y++  E + G  +I+AY+  ++F  K + L +K     +L++   RW+  +L+++     L+  +  V     I +   G+ ++Y L +   L  ++R     E+++ + ER+  Y TE+  EA +  PE+ PP  WP  G+I F N    YRPGL + L+NLN  ++ GEK+GI GRTGAGKS++  AL+RL E   G I ID++DI+ LGL DLR KL IIPQDPVLF G +R NLDPFN  +D E+W AL         ++  +K        +        L+  + E G N S+G+RQL+ L RAL++++ IL+LDEAT++VD ETD  IQ  I   F  CT+L IAHRL TI++YDR++VL++G++ E +TP  L + E S+F SM   +G+
Sbjct:  604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGDL-LMCGYPWIQNASVRDNIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLT--GMLANKTRILATHQLSLIERASRVIVLGTDGQV-DIGTVDELKARNQTLINLLQ--------------FSSQNSEKEDEEQEAVVAGELGQLKYESEVKELTELKKKATEMSQTA------NSGKIVADGHTSSKEERAVNSISLKIYREYIKAAVGKWGFIALPLYAILVVGTTFCSLFS-SVWLSYWTENKFKNRPPS-----FYMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFGDCTILCIAHRLKTIVNYDRILVLEKGEVAEFDTPWTLFSQEDSIFRSMCSRSGI 1468          

HSP 2 Score: 93.2041 bits (230), Expect = 2.389e-19
Identity = 95/439 (21.64%), Postives = 180/439 (41.00%), Query Frame = 2
Query:  749 DDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGN----HNEYIWHGFFYMF--CIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNV 2047
            DD+   YP+      + +S + F W   ++  G+++ +  +DL+ +    S + +    ++      ++  +K  K            R+     E +  N +        PK   LR LL T   ++F S +  ++ + ++   P I    I F+      H+ ++  G  Y    C+ +     TF    F     +TG++AK+ +     KK    S  +R     G++ + ++ D ++ +    F   L   P  + + +  L   LGP  + G+ +      I+      I   +       D R+ ++ E+L+ IK++K + WE + E+ ++ IR KE   +RK      F        P + +L +F A    +      P   F S+SLF +L+  M  LP AI   I  ++   R+   L   E DP+ +
Sbjct:  102 DDERKIYPL---FHTNIISNMFFWWVLPILRVGYKRTIQPNDLFKMDPRMSIETLYDDFEKNMIYYFEKTRKKYRK------------RHPEATEEEVMENAK-------LPKHTVLRALLFTFKKQYFMSIVFAILANCTSGFNPMITKRLIEFVEEKAIFHSMHVNKGIGYAIGACLMMFVNGLTF--NHFFHTSQLTGVQAKSILTKAAMKKMFNASNYARHCFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAILAICIVLLIVNLGPIALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRTKEISKVRKMQLSRNFLIAMAMSLPSIASLVTFLAMYKVNKGG-RQPGNIFASLSLFQVLSLQMFFLPIAIGTGIDMIIGLGRLQSLLEAPEDDPNQM 515          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO36474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII0])

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 568/1231 (46.14%), Postives = 809/1231 (65.72%), Query Frame = 2
Query: 1088 PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE---VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFG--------------REKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVN-KKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            P  ++VL      +FF +   K+I D  +F+QP IL   I+F+   N   W G+ Y   +F  +  ++ +   +  +    GI+ KTA+  +IY KAL+L+  SR + T G++VNLMSVDA +  D   + +LLW  P+ I+V +YFL+  +G + +AG+V+++ ++P N V+    +KLQ +QM  KD RI++++EIL+G+K+LKL+AWE S   KV  IR +E   L+ AM+LNAF    + C P LV+L +F  YVL    NILT   AFV+ISLFNIL FP+++LP  I+  +Q  VS KR+  FL  +ELD  NV     S  +++ I + +G+FSW     P L +INL I +GSLV +VG VG GKS+L+SA+LGE  K++G V  K  VAYVPQQAW QN +L+DN++FG++    +YHK ++ CAL  D  ILPAGD TEIGE+GINLSGGQKQR++LAR+VY N+ VYL DDPLSAVD+HVGKHIF+KV    G L K TR+LVTHG+++L + D+I V++DG VSE GTYKELL N G FA+F++T+    +++S +   +  + + ++    L   ++ G              R +G A S      +  S +           +     ++ EE A  G VK  VF  Y +      A + IL       ALV   I L++WS     N++ D A RD +LG Y    F QA F+L+ S+ LA+G   AS+++H+ +L +I  AP SFF+TTP GR++NR  KD+  VD T+P +   +L +    I ++  I  A+P F+  +IPL   Y  IQ+ Y+ +SRQL+RI+S+ KSPIY++F E+I GTS+IRAY    +F        D++Q+ ++ ++  NRW+   LE +GN++I  + +FAV  RD+I S L G+S++YAL IT +L +MVR + ++E+N+V++ER KEY ++E+EA W + + +PP  WP  G+I+  +F +RYR  L L L+N++  +Q GEK+GIVGRTGAGKS+L LALFR++E A G I +DD+DI+ +GL DLRS LTIIPQDPVLFSG LR NLDPF+ YSD ++W  LE+++LK+F +    GL   I+E GENLSVGQRQLVCLARALL+K+ +LVLDEATAAVD+ETDELIQN+IRT F   TV TIAHRLNTIMDY R++VL +G + E ++P+ L+A ++ +F+ MA+DAGLA
Sbjct:    2 PSLMKVLFLIFWPQFFLAAFFKLIQDSMSFVQPTILRLMISFV-EGNSPSWEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQLKQMANKDSRIRIMNEILNGMKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFTFTCAPFLVSLATFAIYVLT--GNILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNVHKKMPSHISNQAIHVDDGSFSWDVTGQPTLHNINLNIPDGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQDGRVSEVGTYKELLANRGAFAEFLKTF--APEEKSGDAALKVLREVPEDEEDILVRLQAIGDEDEMFMEPEPQPIRRRGRANSVVTIGTTITSDTADTDCMTIMEEDREVDHMIGEEKAATGSVKWVVFWAYAKSIGVFIASIVILFMILSEGALVGSRIWLAAWSAD---NDTSD-ATRDMYLGGYAAFGFFQAFFVLVSSICLAFGSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIVYVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDSIESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVEDSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISKMGLQDLRSSLTIIPQDPVLFSGTLRFNLDPFDAYSDEDLWEVLEVSHLKAFASGLPEGLLHPIAEGGENLSVGQRQLVCLARALLRKSKVLVLDEATAAVDLETDELIQNTIRTEFAERTVFTIAHRLNTIMDYSRILVLDKGFMMEFDSPQNLIA-QRGIFYGMAQDAGLA 1222          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO46846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP39])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 495/1412 (35.06%), Postives = 758/1412 (53.68%), Query Frame = 2
Query:  782 ELKASFLSKITFSWPTRLIYRGFRKPL-TIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLK---------LESTSSHRYQSLPSENMESNTRKTNISKDTPKPWF------LRVLLHTISYKF---FFS-GLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEV---STSNDKPISIVNGNFSWG--------------ENEAPI----------LRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTV---KRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLA-----ARD------------------------YFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRD----TIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEY-TEIESEAPWD---------------IPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLG-LEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDA 4717
            E  A+ +SK++F W   L+ +G +  L   +DL++L                  + L  VH   ++Q++LK          E+ S  R  S  +    S++ + ++        F       R LL  + Y F   +FS G+LK+  D   F  P +L   ++F+ N  E + HG++Y   + + ++     N  F +       + + AII+ +Y K L +S  S  + + GE++N MS D  +  +F   FH  W  P  I V++Y L+Q++G A +AGL   + ++P+N  +  KI+K  T+ M  KD R+K+++EIL GI+++K +AWE + + KV T R  E   L+   +L+A+    W  TP ++++ +F  YVL    N LT  K F S++LF +L  P++  P  I   ++  VS KR+  FL  EELDPDN  +   + S    + IV+G+FSW               EN A I          L  +NL I +G L+ ++G VGSGKSSL+SA+  EM K++G V           V Q+ W Q+ ++++NILFGK     KY  V+ ACAL EDL+ LPAGD TEIGE G+NLSGGQK R+ LAR+VYQN S+YL DDPL+AVDAHV  H+++   +  GLL   T IL TH   +L+ AD + VM +G V  +          GP ++ + +                 ++++Q       I+    RE+               +              + +LV+EE   +G V+L V+  Y +   +  A   +L       +   G+  L+ W     I+++ +       + D                        ++L +Y G+A    +F L ++   AYG   A+KT+H  +L SI+ AP SFFD TP GRI+NR   D+ ++D ++P  + I+L     V++S++I C   P+  L + PL   Y+++Q +Y  TSR+L+RI ++ +SPIY+HF E++ G S+IRA + T +F T+ EE  + +Q   +  +    W+   L+ IG  V + +GV  + + +    T+  GL GL++SYAL +T S+A MV +  + E  +V++ER ++Y T I  E P                        S WP +G+I F N  + YRPGL  ALRN++  +  GEK+GIVGRTG+GKSSL L LFR++E AEG + +D ++I  L L  LRS+L IIPQDP LFSG++R N+DP+   SD ++WI LE  +L+     +DLG L+  + E G N S GQRQLVCLARA+L +  IL +DEATA+VDMETD  IQ +IR AF++ TVLTIAHR++T+MD DRV+V+ +G + E   P  L+A++ SLF+S+   +
Sbjct:    7 EDGANCISKLSFWWVRGLMNKGAKGHLQNAEDLFLLP-----------------KSLRTVH---LRQKFLKEFYCSKSPAPEAQSKRRTTSSETSGF-SDSGEIDVGFSGNDEVFEQGTIVKRTLLGGLHYAFGLQYFSLGILKLFCDCLGFSGPLLLHALVSFMENKTEPVIHGYYYAMGVLVSALLTALTNCHFTYWVHKISYKIRAAIITTVYHKTLAVSTTSLGKFSSGEVLNFMSTDTDRVVNFANSFHQFWSLPFQIAVSLYLLYQQVGLAFLAGLGFALLLIPLNRWLAIKIQKYSTEMMTQKDSRVKIMNEILYGIRVIKFYAWENNFKNKVNTFRNAELKSLKGRKYLDAWCVYFWATTPIIISILTFTTYVLM--GNQLTAAKVFTSVALFQMLITPLNAFPWVINGMMEAWVSVKRLQAFLTLEELDPDNYYIYIPAQSAGDAVQIVDGHFSWRYKPPQQEAKETKDVENLAEIETEVKSTVGLLSGLNLSIRKGQLIGVIGGVGSGKSSLLSALTAEMDKLTGQVFVAGLDGGFGLVAQEPWIQHATVKENILFGKPYDVDKYSDVINACALREDLQSLPAGDDTEIGENGVNLSGGQKARVGLARAVYQNKSIYLLDDPLAAVDAHVAAHLYKHCIT--GLLRHKTVILCTHHTKFLSGADHVIVMSNGTVMHS----------GPPSEILSS----------------ERILRQ-------ISRDVSRERS----------LDGKEGGEDGEENADEPTGDGRLVEEEAKDVGAVRLHVYGSYWRAIGHCLATSILLSLLLMQGSRTIGDWWLAYWISHSKIDHTDNATTITHHSHDSTHPEAPYAAPFLRGVNIKKNTLKFYLVVYAGIAVANTVFTLFRAFLFAYGGIKAAKTIHQRLLSSILAAPISFFDITPIGRIINRFSSDVYSIDDSLPFMLNIFLAQAYFVVASLVITCYGLPWMALLVAPLMIIYYYLQGYYRKTSRELKRIITVTESPIYAHFSETLTGLSTIRALRHTQRFRTENEERLEVNQRANYCEMVAYVWLVLRLQGIG--VAINAGVAFLAVLEHHFHTVDPGLVGLAMSYALSVTQSIADMVNSFAETEKQMVSVERAEQYITRIPVEKPGGSKVCHAHILLLSSLSDISRLLSSSWPTHGRIRFHNIVLVYRPGLPPALRNVSLEIHAGEKVGIVGRTGSGKSSLFLVLFRMVEVAEGAVILDGVNIASLPLDKLRSRLAIIPQDPFLFSGSVRDNIDPWGKCSDRDLWITLERCHLQQ--PVSDLGGLDAEVGERGRNFSAGQRQLVCLARAMLTRAKILCIDEATASVDMETDRFIQRTIREAFRTSTVLTIAHRIDTVMDSDRVLVMNKGTVTEFEKPDTLMANQNSLFYSLVHSS 1346          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO41257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4U1])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 446/1330 (33.53%), Postives = 707/1330 (53.16%), Query Frame = 2
Query:  815 FSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYIN-FIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQ--DFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSML-PGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP----ISIVNGNFSWGENEA-PILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQ------CGSYLFAMLAILCYCSYLAALVSGNIVLSSWSE-------------AGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAG 4720
            F W   L+  G ++PL   DLY L  EDS + +   +   W+ E+ R                                       ++  +P  +R L++     +   GL  +  D    +QP +LGY +  F+ +        + Y   + L  +     N  F FM  V G+R + A  ++IYKK L LS  +    T G ++NL+S DA KF       F H L + P+ + V    LW ++GPA +AG+ LL+C+ P+   +G+ +  L+ + +   D R+K+++EI++G++++K++ WE S  + +  +R+ E     +  ++    +  +F +  L+   +F  YVL     +LT  K F  +SLFN +    ++  P AI    +  VS KR    L  +E+  + +  ST   K     + +   + +W +  A P L  ++ ++  G L+ ++G VGSGKSSL++AILGE+    G+++ +  VAY  QQAW  N +L+ NILFGK     +Y+ V++ACAL +D ++L  GD+T +GE+G++LSGGQ+ RISLAR+VY +  +YL DDPLSAVDA+VG+H+F++   +   L    RILVTH L +L  AD+I V++ G   + GTY++L +ND  F   +   +E++    S+  D  ++   + + K+LS+ E   +  G       S +S  +                  L  EE  + G V  + +  Y++       G +L  + A +C    +  L+ G++ L++W+              A +   S       Y+L +Y  L F   +  LI ++S  +   +AS+ LHN M  S+I     FFD    GRILNR  KDI  +D  +P  +   L  G   +  + ++  ++P  I  ++P+   +F+ + +++ +SR+++RI+ I +SP++ HF  +++G  +IRAY V   FT +     D     W+  ++   W+   L+ +G + +L   +    ++D + +G  GL +SY++M+       V  S ++E+ + ++ER+ EYT +  E    + +V PP +WP  GKI F N S  Y   L   L N+   ++  EK+G+VGRTGAGKSSL   LFRL EP +G I ID I+I  LGL DLRSKL+IIPQDPVLFSG +R NLDPF+ + D  +W  L+   LK         L+  ++E G N SVGQRQLVCLARA+L+ + ILV+DEATA VD  TD LIQ +IR  F+ CTVLTIAHRL+TIMD DRVMVL  G++ E + P KLL    ++F  + +  G
Sbjct:    1 FRWMNSLLALGNKRPLEDSDLYGLLPEDSTEVLAHSLFNAWDVEIKRY-------------------------------------KQEKRRPSLVRALINAFGKGYAALGLFPLFADGLGILQPILLGYLVTYFVEDSPITKKEAYLYAAGVGLCGLFILLFNVPFAFMKNVYGMRVRAACTALIYKKVLHLSRTALASTTTGNLINLVSADAQKFDWVRLAPFLHYLILGPLEVGVVAVLLWYQIGPAALAGVGLLVCLAPMQVKMGNALMSLRGKAIHWMDERVKIMNEIIAGMRVIKMYTWEDSFAKLIMHLRKNELKWFLRMAYIQGAFASFFFSSAGLIYFTTFLVYVLT--GEVLTAAKVFTCVSLFNSVRIVCALFFPFAITLFNESRVSLKRFEEALLLDEMHSEGLVKSTLRPKAEECGVFVKKASATWNKEIAIPTLDGLSFDVPSGCLLGVIGAVGSGKSSLLNAILGELPLSEGSIRVQGRVAYASQQAWVYNSTLRHNILFGKEYDEHRYNDVIKACALDKDFELLSEGDETLVGERGVSLSGGQRARISLARAVYADGDIYLLDDPLSAVDANVGRHLFQECICT--YLKDKARILVTHQLQFLKDADEIMVLQQGQCIDKGTYQQLSRNDSGFLSLLAEEVEEETGNESDGDDGSTRF-GRPVSKQLSVEEVVRKRAGNVVDSCMSIMSAATTLT---------------LPPEETKQEGAVSRQTYAAYLRSFHDLGTGVFLIFLFA-MCQVRPVM-LMFGDVWLANWANREEVYSMTLASWNASSNTTSPSRPDLHYYLSVYAALVFGLFVLCLICTMSYYWFTIVASRNLHNGMFHSLIHTNMHFFDNNSIGRILNRFSKDIGVIDDFMPWMLCDVLQIGFSCLGIMCLVAASNPVSIAIVLPVICLFFYFRNYFMKSSREMKRIEGINRSPLFGHFSTTLLGIDTIRAYGVEATFTDQFNLFHDAHSRAWYAYLAGQAWLTCRLQALGVVFLLFIVLGLPALKDGLSAGTVGLILSYSIMLAKLFEPFVEESAEVENIMTSVERVVEYTSLPPEGE-KVTDVIPPPDWPDKGKITFDNMSFSYHQSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLFRLAEP-KGLIDIDGINIRKLGLKDLRSKLSIIPQDPVLFSGTMRKNLDPFSEHPDAGLWKVLDEVQLKQPVEDLPGKLDEELAEAGSNFSVGQRQLVCLARAILRHSRILVIDEATANVDPRTDALIQETIRDKFQDCTVLTIAHRLHTIMDSDRVMVLDAGRLVEFDAPYKLLKKRNTIFSGLVEQTG 1269          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO31647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB5])

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 461/1391 (33.14%), Postives = 729/1391 (52.41%), Query Frame = 2
Query:  818 SWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISY----KFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEY-IWHGFFYMFCIFLVSMAR-TFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAI---------VFTIQGLVSAKRINHFL-------------------------------NGEELDPDNVEVSTSNDK------PISIVNGNFSWGENEA---------------------PILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELL--KNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFG-----REKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAM----LAILCYCSYLAALVSGNIV---LSSWSEAGT---INNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEY-TEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDA 4717
            SW + ++Y+GFRKPL +DDL  L + ++ +     I R W+ E+D V  K  +   +      +     +                       + V+   I++    +FF +G    +     F Q   + Y + ++   N   + +G   +  + L  + R  F++  F F+   TG RA++ + S+IY+K  KL      ++++GE VNL + DA +  +           P+ II+ + +    +GP+ + G  L++ + PI   +     +L+ + +R+ D R++++SE+L+ IK++K++AW+ S  + +   R +E   L  A  L           P +  + SF  ++    N  LT  +AF  +++FN+L F +++LP  +         +  ++ L+  + ++ FL                               NG+      V+ + S  +      PI +      +  N+                      P L DI+LE+++GSL+ I G+VGSGKSSL+  IL +M K  G V     +AYV QQAW  N + +DNIL G     S+Y     AC+L +D +ILP GDQTEIGE+GINLSGGQKQRISLAR++Y +  +YL DDPLSAVDAHVG+HIF+      G L   + +  TH L YL++ D++  M +G ++E GTY +L+  K +  F +  R              +   + I Q +R+      S G     R +G                         T     +L + E  + G V+L  ++ Y++    +FA     ++ +     LA L+    V   L  W +AG    I   +D    +Y++ +YG  A      +L+++         AS  LH++  + ++    SFFD TP+GRILNR  KD+D VD  +P T+  ++ +  R+  ++ ++    PYF++A++PL  F+F +  ++  + R+L+R+D I +SPI+SH   ++ G S++ A+     F  +   L D + + +F+    NRW+   L++I  ++  ++ +  V  +  +    AGL++SYA+ IT      VR + + ES   ++ERI  Y T + SEAP +IPE K   EWPQ G I F+   +RYR GL L L NL   V+  EK+GIVGRTG+GKSS+ + L+RL+E + G+IKID+IDI+ LGL DLRSK++IIPQDPVLF+G +R NLDPF  YSD E+W ALE ++LK   +   L LE  + ENGEN SVG+RQL+C+ARALL+ + IL++DEATAA+D ETD  IQ++IR AF  CTVLTIAHRLNT++  DR+MV++ G+I E + P  L AD +S F  + + A
Sbjct:    2 SWASPIVYKGFRKPLQMDDLGELSQYETIEVNGTRIKRIWDEEVDTVGLKHARLGKVLWRCVRTRLIMGM----------------------IMFVISQMITFLGPVRFFSNGDTPCLLCSCVF-QALFIRYILEYLAKQNTTSLGYGIALVMGLLLTEILRVAFLSFSF-FLNIRTGTRARSMVYSLIYQKLSKLRNV--GDKSIGEFVNLCASDAQRIYEGVSIGCFSLGGPVVIIMAIIYTTYLIGPSALVGCGLVLLVFPIQMKVARLAGQLRGKVVRITDQRVRMMSEVLNCIKLIKMYAWDRSFADNIVAKRTEERNALTSAGLLQGINMSIALIIPTVATVASFSVHIATGQN--LTSAQAFTIMTIFNVLVFSLAVLPFGVRAVAEASTALTRVKSLMQMEELSPFLDKPSNSNVALSIEHCDFSWDKVSLLYKSDGFNGQTASDGKVKQAKSQKQYIPSLGPIQLPCIRLCYCHNQTTRLPSTSGRGGPILPVKTKLVPSLFDIDLEVKKGSLIGICGSVGSGKSSLLQCILSQMRKTKGRVGIGGSIAYVSQQAWIMNATAKDNILLGLPFNESRYKAACFACSLTKDFEILPNGDQTEIGERGINLSGGQKQRISLARALYADKDLYLLDDPLSAVDAHVGQHIFKHCIK--GSLWGKSVLFATHQLQYLSQCDQVLYMNNGRIAERGTYIQLIQDKKNPNFTEIHRNL------------EHVPRPISQVVRRTRFSNCSRGSSLSVRARG-------------------AKRPASTQGARAQLTEVEERQEGAVRLSTYVNYMKSAGGMFAQPCVCISFMLVLFMLACLLLQTFVDSWLGYWLDAGNKTGIIEHEDGDINNYYMMVYGVCALVFLFGLLLKTFMFVKFTLKASSKLHDLCFKKVMSGTMSFFDVTPTGRILNRFSKDLDEVDAQLPWTLESFMQNVLRIFIALGLVSAMFPYFLIAVVPLMIFFFVLNSYFRRSVRELKRLDGITRSPIFSHLTATVQGLSTLHAFDKMADFNARFSSLIDLNTLPFFMYFVSNRWLSVRLDIITVVITTVTALLVVTTKGVLTEAFAGLALSYAIRITGLFQFTVRMAAETESRFTSVERINYYITSVPSEAPAEIPETKTKDEWPQEGTIVFNQVKMRYRSGLPLVLDNLTGFVRPQEKIGIVGRTGSGKSSVGVVLWRLVELSGGSIKIDNIDISTLGLQDLRSKISIIPQDPVLFAGTIRFNLDPFRKYSDEELWKALERSHLKDMVSNLPLKLEAPVVENGENFSVGERQLICMARALLRHSKILMMDEATAAIDSETDAKIQDTIRDAFVDCTVLTIAHRLNTVLTADRIMVMEAGKIVEFDEPSVLSADPESYFSKLLQAA 1331          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO44553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVD2])

HSP 1 Score: 556.214 bits (1432), Expect = 2.803e-173
Identity = 413/1331 (31.03%), Postives = 683/1331 (51.31%), Query Frame = 2
Query:  815 FSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTIS--YKFFFSGLLKVIYDQSNFIQPAILGYYINF-IGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPF-----FFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLR-KAMFLNAFTSVAWFCTPPLVALFSFGAYVLAD-PNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAK----RINHFL--------NGEELDPDNVEVSTSNDKPISIVNGNFSWG---ENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKK--LSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVD-EEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSW--SEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDA 4717
            F+W  + +  G  + L  +DL  L+E+D  + ++ ++D  W+ EL             ++    S R                      P+ W  R LL   S  Y     GL  +       +   +  +  +  + +H +    G  Y+  I  VS+ + F +    +   + G+R + AI  +IYK+ L LS A     + G  +NL S D+ + +            L  +S   +++ +   WQ L       L   I  + I+A+ G ++ KL ++   + D R+ +I E+++GI+ +K+ A E    +KV  +R KE   +R K++ L++F+++ +F +  +  L S  + + AD P ++    K F  +   NI+ F +++    +   ++GL  AK    RI  FL        N      D   +       + I + +  W    E++   L  I L+     LV+I G VG GKSSL+ +ILGE+  ISG++  +  +AYVPQ  W  + ++++NI FGK M   +Y+KVLE C+L+ DL + P GD T IGE+G +LSGGQ+ R+SLAR+VY +  +YL DDP S++D+ VG+ IF +       LS   +ILVTH + Y   AD +  +  G + +  + +E   N        R   + + D  +   D++  + + E   K  L +  + GRE+ ++                    E     + + L + +E  + G V   V+  Y + G    A++A+L Y  +L A VS  ++  +W  S   ++  ++  ++    LGIYG +     +FI  ++    +    +S  LH+ M+ +II++P  FFDT P GRILNR+ +DI  +D  +PN V    +     +S++I+    + +  LA++PL   Y ++ ++++ +SR+L+R++S+R SP+YSH  E+I G   +RA  +   +  K     D +    FL++S  RWM   L+L+  + I +    A+       + LAGLS+++A+    +    VR   ++E+++ + ER+  YT +  E P     ++P  +WP+ G +   +  + Y P     LR++   V+ GE++GIVG+TGAGKSS+  ALFR+ +P  G + +D +++  + +  +R  L +I Q+PVLFSG+LR NLDP + Y D EIW  L+   L SF  +    L + + E G N SVGQRQL+CLARALL+K  ILVLDEATA VD  TD LIQ  I+  F  CTVLTIAHRL+TI DYDR++V+   Q+ E+ TP +L+   K LF  M K++
Sbjct:    3 FTWMNKTLNAGNTRRLKEEDLIPLQEKDRTEPLLQLLDDNWSVEL-------------QIAGEESRR----------------------PRLW--RALLQMFSKRYCILVIGLKLLASLAGLLLAILVWFFLRSLSMTSHMDQTSAGL-YVMGITTVSLVKVFASHHSDYQSLLQGMRVRVAITGVIYKRLLYLSRAGIASISTGSTINLASNDSLRLERAVLTTVYGIAALFEISVALVLLVVLIGWQALSGV----LFYFIVAVYISAMAG-QLSKLNSKSCALADERLGVIGEVIAGIRTVKMLALEWFYRDKVNMLRRKEMRYIRIKSLVLSSFSAL-YFTSTSIATLISISSLLYADVPLSVF---KIFTLVMTLNIMRFSVTV---CLTECLRGLADAKVAVQRIERFLPVLLKMRLNHNPQKKDRTAM-------VDIRDVSACWAHQCEDDDVTLTGIKLKAVGDDLVIITGPVGGGKSSLLLSILGEIPLISGSISVRGRIAYVPQIPWISSGTIRENITFGKQMEEERYNKVLEVCSLVSDLSLFPRGDLTVIGERGASLSGGQQSRVSLARAVYADVEIYLLDDPFSSLDSKVGQDIFNECIQR--ALSNKLKILVTHQIKYFNFADCVIFLSRGKIGQDISQREDELNSAIIGK--RNDNDTEGDSHAAKDDKKDYIGRGERASKILLQLHRASGRERNDS------------------FIELGDGPIKQDLAEDDEDYQCGSVGWRVYWSYFRAGLPTSAIVALLLY--FLLAQVS--LIGPNWWLSRLSSMQRTEQRSS--LTLGIYGTIVGCTVLFISTRAFLFFHAALNSSCNLHDTMVMAIIKSPALFFDTNPIGRILNRLSRDIACMDDLLPNHVYRSFSLCLFSLSALILPAGTNVWLTLAVVPLIGIYVYLGRYFLRSSRELKRLESVRCSPVYSHIAETIDGIEVVRASNMQRVYLEKLIRYQDLNTQASFLVLSSARWMALRLDLLTVLSIAMVATGALLASQD--AALAGLSLTFAMESLDATQFGVRQCSEVENDMTSTERVLSYTNLPPE-PGYSRTIRPHEDWPEQGALSLRDVCLAYTPNSPCVLRDITLDVRPGERVGIVGKTGAGKSSVFAALFRMPDPT-GEVWVDGVELASVEIRTVRKALAVITQNPVLFSGSLRENLDPNHRYEDQEIWTVLKEVQLYSFVQRLPDALLYQVGEGGTNFSVGQRQLLCLARALLQKCKILVLDEATANVDYRTDRLIQEVIQLKFSGCTVLTIAHRLSTITDYDRIVVIDNHQVAEVGTPMELVRKNKGLFACMMKNS 1244          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1188.33 bits (3073), Expect = 0.000e+0
Identity = 684/1544 (44.30%), Postives = 976/1544 (63.21%), Query Frame = 2
Query:  104 CSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVK--TPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP--ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            CS  S +   W  N  W+T NPDLT CFQ T+L W+P ++L + CA    + +R  +  Y      N  K+ +   L+ I  LD+F S  ++           + P L  +  LL   + +   +KGV SSGI+ I+W L L+  ++   S+ ++ +    A   +R+ T  + + ++ ++ + +C +D    +  L   +  D        PN            CPE  ASFLS+ITF W + ++  G+++PL   DL+ L  ED    +VP + R W  E  +V R   K  Y   +       +    E  ES        K + +P  L  L  T +  F  S L K+I D   F+ P IL   I F+ + +   W G+FY   +F+ +  ++ I Q++  +C V+G+R +TA+I  IY+KAL +S A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +++ +YFLW+ LGP+ +AG+ ++I M+PINAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWE++ +EKV  IRE E  VL+KA +L A ++  W C P LVAL +F  YVL D  N+L  +KAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EEL  D+VE   +   P  ISI +G FSW  +E+P L+ +N+ I EGSLV +VG VGSGKSSL+SA+LGEM K+ G+V  K  VAYVPQQAW  N +L++NI+FG+    + YH+V+EACAL +DL+ILPAGD+TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIF+ V    GLL   TRILVTHGL+YL +A  + VM DG ++E G+Y++L + +G FA+F+R Y   +  E +           + +    +     G   G   S+  S++S  S S+     +   N    K  D + A  G VKL VF  Y++    L +++++L + S+    +  N  LS W++   +N +Q    R   LG+YG L  +Q + +   SLS++ G  LAS+ LH  ML  ++R+P SFF+ TPSG ++NR  K++DT+D  IP  +++++ S   V+ S III +A+P   L +  L   YFF+Q+FY+ +SRQL+R++S+ +SPIY+HF E+++GTS IRA+   ++F  + ++  D +Q  ++  I  NRW+   LE +GN ++  + +FAV  R+++  G+ GLS+SYAL +T SL  +VR S D+E+N+VA+ER+KEY++ E EA W       P +WP  G I  +NF +RYR  LDLA+RN+N  +  GEK+GIVGRTGAGKSSL L LFR+IEPAEG I ID +DI  LGLH+LRS++TIIPQDPVLFSG LR+NLDPF+ YSD +IW ALE ++LKSF +     L    SE GENLS+GQRQL+CLARALL+KT +LVLDEATAA+DMETD+LIQ +IR+ F+ CTVLTIAHRLNTIMDY RV+VL +GQ+ E ++P  L+A +K  F+ MAKD+GL
Sbjct:    7 CSPNSSE-PFWDWNRSWNTSNPDLTPCFQSTVLVWVPCLYLWL-CAPFYLMYMRSHNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSCLSD----QMPLFSQAVKD--------PNP-----------CPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVE--ESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQSEET-----------EPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQKNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQ--PNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIA-QKGAFYRMAKDSGL 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1155.58 bits (2988), Expect = 0.000e+0
Identity = 667/1509 (44.20%), Postives = 950/1509 (62.96%), Query Frame = 2
Query:  104 CSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVK--TPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP--ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDR 4618
            CS  S +   W  N  W+T NPDLT CFQ T+L W+P ++L + CA    + +R  +  Y      N  K+ +   L+ I  LD+F S  ++           + P L  +  LL   + +   +KGV SSGI+ I+W L L+  ++   S+ ++ +    A   +R+ T  + + ++ ++ + +C +D    +  L   +  D        PN            CPE  ASFLS+ITF W + ++  G+++PL   DL+ L  ED    +VP + R W  E  +V R   K  Y   +       +    E  ES        K + +P  L  L  T +  F  S L K+I D   F+ P IL   I F+ + +   W G+FY   +F+ +  ++ I Q++  +C V+G+R +TA+I  IY+KAL +S A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +++ +YFLW+ LGP+ +AG+ ++I M+PINAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWE++ +EKV  IRE E  VL+KA +L A ++  W C P LVAL +F  YVL D  N+L  +KAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EEL  D+VE   +   P  ISI +G FSW  +E+P L+ +N+ I EGSLV +VG VGSGKSSL+SA+LGEM K+ G+V  K  VAYVPQQAW  N +L++NI+FG+    + YH+V+EACAL +DL+ILPAGD+TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIF+ V    GLL   TRILVTHGL+YL +A  + VM DG ++E G+Y++L + +G FA+F+R Y   +  E +           + +    +     G   G   S+  S++S  S S+     +   N    K  D + A  G VKL VF  Y++    L +++++L + S+    +  N  LS W++   +N +Q    R   LG+YG L  +Q + +   SLS++ G  LAS+ LH  ML  ++R+P SFF+ TPSG ++NR  K++DT+D  IP  +++++ S   V+ S III +A+P   L +  L   YFF+Q+FY+ +SRQL+R++S+ +SPIY+HF E+++GTS IRA+   ++F  + ++  D +Q  ++  I  NRW+   LE +GN ++  + +FAV  R+++  G+ GLS+SYAL +T SL  +VR S D+E+N+VA+ER+KEY++ E EA W       P +WP  G I  +NF +RYR  LDLA+RN+N  +  GEK+GIVGRTGAGKSSL L LFR+IEPAEG I ID +DI  LGLH+LRS++TIIPQDPVLFSG LR+NLDPF+ YSD +IW ALE ++LKSF +     L    SE GENLS+GQRQL+CLARALL+KT +LVLDEATAA+DMETD+LIQ +IR+ F+ CTVLTIAHRLNTIMDY R
Sbjct:    7 CSPNSSE-PFWDWNRSWNTSNPDLTPCFQSTVLVWVPCLYLWL-CAPFYLMYMRSHNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSCLSD----QMPLFSQAVKD--------PNP-----------CPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVE--ESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQSEET-----------EPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQKNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQ--PNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTR 1475          

HSP 2 Score: 71.633 bits (174), Expect = 8.057e-12
Identity = 55/214 (25.70%), Postives = 97/214 (45.33%), Query Frame = 2
Query: 4058 LRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKS 4690
            L+ LN  +  G  + +VG  G+GKSSL  AL   ++  EG++ +             +  +  +PQ   + +  L+ N+       +      +E   L         G E  I E G NLS GQ+Q V LARA+    ++ +LD+  +AVD    + I + +   +   K  T + + H L+ +     V+V+  G+I E+ + ++L   E +
Sbjct:  658 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSV-------------KGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGA 858          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1152.89 bits (2981), Expect = 0.000e+0
Identity = 665/1503 (44.24%), Postives = 947/1503 (63.01%), Query Frame = 2
Query:  122 DWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVK--TPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP--ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDR 4618
            DW     N  W+T NPDLT CFQ T+L W+P ++L + CA    + +R  +  Y      N  K+ +   L+ I  LD+F S  ++           + P L  +  LL   + +   +KGV SSGI+ I+W L L+  ++   S+ ++ +    A   +R+ T  + + ++ ++ + +C +D    +  L   +  D        PN            CPE  ASFLS+ITF W + ++  G+++PL   DL+ L  ED    +VP + R W  E  +V R   K  Y   +       +    E  ES        K + +P  L  L  T +  F  S L K+I D   F+ P IL   I F+ + +   W G+FY   +F+ +  ++ I Q++  +C V+G+R +TA+I  IY+KAL +S A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +++ +YFLW+ LGP+ +AG+ ++I M+PINAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWE++ +EKV  IRE E  VL+KA +L A ++  W C P LVAL +F  YVL D  N+L  +KAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EEL  D+VE   +   P  ISI +G FSW  +E+P L+ +N+ I EGSLV +VG VGSGKSSL+SA+LGEM K+ G+V  K  VAYVPQQAW  N +L++NI+FG+    + YH+V+EACAL +DL+ILPAGD+TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIF+ V    GLL   TRILVTHGL+YL +A  + VM DG ++E G+Y++L + +G FA+F+R Y   +  E +           + +    +     G   G   S+  S++S  S S+     +   N    K  D + A  G VKL VF  Y++    L +++++L + S+    +  N  LS W++   +N +Q    R   LG+YG L  +Q + +   SLS++ G  LAS+ LH  ML  ++R+P SFF+ TPSG ++NR  K++DT+D  IP  +++++ S   V+ S III +A+P   L +  L   YFF+Q+FY+ +SRQL+R++S+ +SPIY+HF E+++GTS IRA+   ++F  + ++  D +Q  ++  I  NRW+   LE +GN ++  + +FAV  R+++  G+ GLS+SYAL +T SL  +VR S D+E+N+VA+ER+KEY++ E EA W       P +WP  G I  +NF +RYR  LDLA+RN+N  +  GEK+GIVGRTGAGKSSL L LFR+IEPAEG I ID +DI  LGLH+LRS++TIIPQDPVLFSG LR+NLDPF+ YSD +IW ALE ++LKSF +     L    SE GENLS+GQRQL+CLARALL+KT +LVLDEATAA+DMETD+LIQ +IR+ F+ CTVLTIAHRLNTIMDY R
Sbjct:   55 DW-----NRSWNTSNPDLTPCFQSTVLVWVPCLYLWL-CAPFYLMYMRSHNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSCLSD----QMPLFSQAVKD--------PNP-----------CPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVE--ESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQSEET-----------EPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQKNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQ--PNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTR 1513          

HSP 2 Score: 71.633 bits (174), Expect = 8.243e-12
Identity = 55/214 (25.70%), Postives = 97/214 (45.33%), Query Frame = 2
Query: 4058 LRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKS 4690
            L+ LN  +  G  + +VG  G+GKSSL  AL   ++  EG++ +             +  +  +PQ   + +  L+ N+       +      +E   L         G E  I E G NLS GQ+Q V LARA+    ++ +LD+  +AVD    + I + +   +   K  T + + H L+ +     V+V+  G+I E+ + ++L   E +
Sbjct:  696 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSV-------------KGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGA 896          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 665/1503 (44.24%), Postives = 947/1503 (63.01%), Query Frame = 2
Query:  122 DWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVK--TPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKP--ISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDR 4618
            DW     N  W+T NPDLT CFQ T+L W+P ++L + CA    + +R  +  Y      N  K+ +   L+ I  LD+F S  ++           + P L  +  LL   + +   +KGV SSGI+ I+W L L+  ++   S+ ++ +    A   +R+ T  + + ++ ++ + +C +D    +  L   +  D        PN            CPE  ASFLS+ITF W + ++  G+++PL   DL+ L  ED    +VP + R W  E  +V R   K  Y   +       +    E  ES        K + +P  L  L  T +  F  S L K+I D   F+ P IL   I F+ + +   W G+FY   +F+ +  ++ I Q++  +C V+G+R +TA+I  IY+KAL +S A+R+  TVGEIVNLMSVDA +F D   + +++W +P+ +++ +YFLW+ LGP+ +AG+ ++I M+PINAVI  K K  Q  QM+ KD RIKL++E+L+GIK+LKL+AWE++ +EKV  IRE E  VL+KA +L A ++  W C P LVAL +F  YVL D  N+L  +KAFVS++LFNIL FP++MLP  I   +Q  VS KR+  FL+ EEL  D+VE   +   P  ISI +G FSW  +E+P L+ +N+ I EGSLV +VG VGSGKSSL+SA+LGEM K+ G+V  K  VAYVPQQAW  N +L++NI+FG+    + YH+V+EACAL +DL+ILPAGD+TEIGEKG+NLSGGQKQR+SLAR+VY + SVYL DDPLSAVDAHVGKHIF+ V    GLL   TRILVTHGL+YL +A  + VM DG ++E G+Y++L + +G FA+F+R Y   +  E +           + +    +     G   G   S+  S++S  S S+     +   N    K  D + A  G VKL VF  Y++    L +++++L + S+    +  N  LS W++   +N +Q    R   LG+YG L  +Q + +   SLS++ G  LAS+ LH  ML  ++R+P SFF+ TPSG ++NR  K++DT+D  IP  +++++ S   V+ S III +A+P   L +  L   YFF+Q+FY+ +SRQL+R++S+ +SPIY+HF E+++GTS IRA+   ++F  + ++  D +Q  ++  I  NRW+   LE +GN ++  + +FAV  R+++  G+ GLS+SYAL +T SL  +VR S D+E+N+VA+ER+KEY++ E EA W       P +WP  G I  +NF +RYR  LDLA+RN+N  +  GEK+GIVGRTGAGKSSL L LFR+IEPAEG I ID +DI  LGLH+LRS++TIIPQDPVLFSG LR+NLDPF+ YSD +IW ALE ++LKSF +     L    SE GENLS+GQRQL+CLARALL+KT +LVLDEATAA+DMETD+LIQ +IR+ F+ CTVLTIAHRLNTIMDY R
Sbjct:   17 DW-----NRSWNTSNPDLTPCFQSTVLVWVPCLYLWL-CAPFYLMYMRSHNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSCLSD----QMPLFSQAVKD--------PNP-----------CPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVE--ESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANEQSEET-----------EPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQKNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQ--PNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTR 1475          

HSP 2 Score: 71.2478 bits (173), Expect = 9.222e-12
Identity = 55/214 (25.70%), Postives = 97/214 (45.33%), Query Frame = 2
Query: 4058 LRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKS 4690
            L+ LN  +  G  + +VG  G+GKSSL  AL   ++  EG++ +             +  +  +PQ   + +  L+ N+       +      +E   L         G E  I E G NLS GQ+Q V LARA+    ++ +LD+  +AVD    + I + +   +   K  T + + H L+ +     V+V+  G+I E+ + ++L   E +
Sbjct:  658 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSV-------------KGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGA 858          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc6a (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101158001])

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 638/1569 (40.66%), Postives = 943/1569 (60.10%), Query Frame = 2
Query:  131 LWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNII-KSILVCGL---------FFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTP---ANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKF---FFSGLLKVIY-DQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVE--VSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVN-------------------KKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            LW  N  W T NPDLT CFQ T+L W+P ++L     + +P        + S R + + +  + +V G          FF   L+  +     +V L       L PI+ ++  +L + + +L  I+G  SS  LF++W L ++ + + L ++ I++      A+D  R++     F I        CFAD     +                 PN       +E   CP   ASFLSKI F W T L+ +G+R PL   DL+ L+EED+  +I+  + +EW  E  +     +++Q   LES        L S   +       + K+    +FL   L T++ KF   F +G L +I+ D   F  P +L   + FI +     W G+FY   +FL+S  ++  N Q+M+ C   G+R KTA++ ++Y+K+L ++ A+R+  TVGEIVNL+S D  K  DF  +F+ +W++PI I + ++FLWQ LGP+ +AG+  +I + P+N  I  K  KLQ  QM+  DGR++L++EIL+GIKILK +AWE +  E+V   REKE   L+K+  L + +  ++  +  L+A   FG YV+ D  N+L  QK FVS++L NIL  P+S LP AI  T+Q LVS +R+  +L  EEL  D V   +S+S+ + + I NG FSW +   P L+ I++ +  GSLV +VG VGSGKSSL+SA+LGE  K SG V  K  VAYVPQQAW QN ++QDNILFG+  + + Y +VLEACAL+ DL ILPAGD TEIGEKG+NLSGGQKQR+SLAR+VY+ + +YL DDPLSAVDAHVG+HIF+KV    G+L   TRILVTHG+++L +AD I V+ DG ++E+G+Y+ELL + G FADFI T+                        KK S  +  G  +  A+      +         +     T N N                    KL + + A  G VKL+++  Y +       +  +  Y     A ++ +  LS W++   +N +Q    RD  L ++G L F Q I I   +++++    +AS+ LH  +L +++R+P +FF++TPSG +LNR  K+ID +D  +P  +++ L+   +++   II+ IA+P   + ++PL+F Y F+Q FY+ TS QL+R++++ +SPIY+HF E++ G S IRA+    +F  +  E  D +Q  +F      RW+   LE +GN V+L + V +V  + T+  G+ GL+VS++L +T  L+ +VR+  D+E+N+V++ER+ EY +   EA W+      P  WPQ+G IEF ++ ++YR GL+LAL+ +   +Q+ EK+GIVGRTGAGKSSLAL +FR++E A+G I ID ++I  +GLHDLRS++TIIPQDPVLFSG+LR+NLDPF++Y+D EIW +LE+A+LK F +     L    SE GENLS+GQRQLVCLARALL+KT ILVLDEATAAVD+ETD LIQ++IRT F+ CTVLTIAHRLNTIMDY RV+V+ +G I E+++P  L++ ++  F+ M ++AGL
Sbjct:   13 LWDWNRTWYTANPDLTQCFQNTVLVWVPCIYL----WLLVPFYCLHLYCHDSGRIRMSCLCMAKMVLGFLLASFGFVEFFYILLERSQDIGHHMVFL-------LSPIIRSMTVILALCIIQLERIRGCRSSIFLFLFWVLSVVCSLVPLRAK-IQLAVDEGIASDIVRYLAFFSYFTIQMAQLFLCCFADQPPQGK-----------------PN-------LEKNPCPVKDASFLSKILFWWFTGLVVKGYRTPLEATDLWTLREEDTSHKIISDLQQEWGAECAK-----LQKQEKSLESAPV-----LGSRLPDQAQLLRKLQKEQSSGFFL---LRTLARKFGPYFLTGTLCIIFHDAFMFAIPQVLSLLLGFIRDPEAPQWKGYFYATLMFLLSCLQSLFNHQYMYTCFTVGMRVKTAVMGLVYRKSLVINSAARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEIGLCLFFLWQHLGPSALAGIATVILIFPLNGFIAKKRSKLQEIQMKFMDGRVRLMNEILNGIKILKFYAWEKAFLEQVLGYREKELKALKKSQVLYSISIASFNSSSFLIAFAMFGVYVMLDERNVLDAQKVFVSMALINILKTPLSQLPFAISTTMQALVSLRRLGKYLCSEELKVDGVSKALSSSDGEDVVIENGTFSWSKEGPPCLKRISVRVPRGSLVAVVGHVGSGKSSLLSAMLGETEKRSGQVTVKGSVAYVPQQAWIQNATVQDNILFGREKLKTWYQRVLEACALLPDLDILPAGDATEIGEKGLNLSGGQKQRVSLARAVYRKADLYLLDDPLSAVDAHVGQHIFDKVIGPKGVLKDRTRILVTHGMSFLPQADLILVLIDGEITESGSYQELLSHHGAFADFIHTF--------------------ASTEKKESAIQRAGSRRSNARLSMVDFMPFSRDLSQEQLIGGDTTNTNLQNMEPVSENDQDQVPEDLGKLTEADKAHTGRVKLDMYKKYFKTIGLAIIIPIVFLYAFQQGASLAYSYWLSMWADDPVVNGTQ--TDRDLKLAVFGALGFVQGIAIFGTTVAISICGIIASRQLHMDLLVNVLRSPMAFFESTPSGNLLNRFVKEIDAIDCMVPEGLKMMLSYVFKLVEVCIIVLIATPIAAVIILPLAFLYAFVQSFYVATSCQLRRLEAVSRSPIYTHFNETVQGASVIRAFGEQSRFIMQANERVDFNQTSYFPRFVATRWLAVNLEFVGNGVVLAAAVLSVIGKSTVSPGIVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVNEYADTPKEASWNTEGSALPLAWPQSGTIEFQDYGLQYRKGLELALKGITLQIQKREKIGIVGRTGAGKSSLALGIFRILEAAKGRIFIDGVNIAEIGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDIYTDEEIWSSLELAHLKDFVSNLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDTLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGYISEMDSPANLIS-QRGQFYRMCREAGL 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000064939.1 (SMESG000064939.1)

HSP 1 Score: 2915.56 bits (7557), Expect = 0.000e+0
Identity = 1546/1550 (99.74%), Postives = 1547/1550 (99.81%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            MTVVSFKILCSNKSPDWLLWSSN IWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQI GLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRFITSIIEFVIVFISFIANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSE+GTYKELLKNDGPFADFIRTYLEQDDDESSEDCDEESKLIKQELRKKLSITESFGREKGE KSRRNSSISGLSKSKSMKTTEEKTNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA
Sbjct:    1 MTVVSFKILCSNKSPDWLLWSSNAIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIAGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRFITSIIEFVIVFISFIANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSESGTYKELLKNDGPFADFIRTYLEQDDDESSEDCDEESKLIKQELRKKLSITESFGREKGETKSRRNSSISGLSKSKSMKTTEEKTNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 1550          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000064939.1 (SMESG000064939.1)

HSP 1 Score: 2895.92 bits (7506), Expect = 0.000e+0
Identity = 1546/1589 (97.29%), Postives = 1547/1589 (97.36%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNR---------------------------------------IGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            MTVVSFKILCSNKSPDWLLWSSN IWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQI GLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRFITSIIEFVIVFISFIANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSE+GTYKELLKNDGPFADFIRTYLEQDDDESSEDCDEESKLIKQELRKKLSITESFGREKGE KSRRNSSISGLSKSKSMKTTEEKTNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNR                                       IGKDIDTVDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA
Sbjct:    1 MTVVSFKILCSNKSPDWLLWSSNAIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIAGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRFITSIIEFVIVFISFIANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSESGTYKELLKNDGPFADFIRTYLEQDDDESSEDCDEESKLIKQELRKKLSITESFGREKGETKSRRNSSISGLSKSKSMKTTEEKTNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRLEMFIVTFKRKDLHETITFLRFLSLSSHSFHEKGEEVVEIGKDIDTVDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 1589          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000057252.1 (SMESG000057252.1)

HSP 1 Score: 1783.46 bits (4618), Expect = 0.000e+0
Identity = 941/1578 (59.63%), Postives = 1193/1578 (75.60%), Query Frame = 2
Query:   92 FKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSS-SNDMDETHLLLPNNLNDDKTVEYPV----CPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRV-----HRKIIKQQYLKLESTSSHRYQSLPSENMESN---TRKTNISKDTPK--PWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYL-XXXXXXXXXXXXXXXKLIKQELRKKLSITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK-----------------KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA 4726
            F  LCS+KS DWLLW   + W+T +PD+TLCFQYTILNWIPL+FL I C I IPIL  K S  Y  RGKFNI KS L+  + F + L+   + S+ I  L PP A +LQPILSA+ S+L+IY+NRL Y KG+HSSG+LF YW LQL+ +  ++YSR  R+K    D FR +T+  EF++VF+SFI NCFAD  V   +   ++   D DET  LL + + DDKT+  P+    CPE + SFLSK+TF+W T L+ +G+R+PLT  DL+ L+E D+C  IV  ++ +WNRE  RV     H+K+ KQ         +  Y+ L SE  E+     + TN +K+  K  P FLR L HTI Y +  +G+ KV YD   F QP ILG +I FI N N+Y+WHGF    C+FL+SM R+ I QQ+   C VTG+R++TA+I IIY+KALKLS  SRKE TVGEIVNLMSVD+ K QD P F H+LW +PITI++ +YFLWQELGP+ +AG+ L+IC++PIN +IGSK+KKLQ +QM+MKD RIKL++EILSGIKILKL+AWE S EE ++ IR  EC +LR A +LNA ++V WFC P LVAL +F A+ L+  +++LT  KAFVS+SLFNIL+FPMSMLPG IV+ IQ  VS KRIN FL G+ELD +NVEVS  ++KP+ IV+G FSWG+ EAP+L +IN+E+ EGSLV +VGTVGSGK+SLISA++GE++K+SG V  +  + Y+PQQAWC+N SLQDNILF K ++  KY++V+EACAL EDLK+LPAGDQTEIGEKGINLSGGQKQRISLAR+VYQ+ SVYL DDPLSAVD+HVGKHIF++V    GLLS  TRILVTHGL YL K DKIFVMKDGNVSE+GT+ ELLKN+G FA+FIRTYL +++++   ED ++ESK +K+EL+  +S   S    + E +   +SS       +S K       + ++                 +L++EEVA+IGGVK  VF+ YI+  +YLF+   +  Y  Y+   V  N+ LS W+E G+ N +Q+  ++ ++LGIYG L   QA+FILI++ +LAYG FLASK+LHN++L++I+RAP+SFFDTTP GRILNRIGKDIDTVDV+IP T+RIWL + S VI SI +I I+SPYF+LAL+PL+  Y+  Q+FYI TSRQL+RIDSI++SPIYSHFQESI+G SSIRAYKV+D F  KC+ +TD++QM W+  I   RW+QFYLE IGN+VILLSGV AV  R TIGSG AGLS+SYAL IT  L  MVR + D+ES+ VA+ERIKEY EIESEAPW+I E +  S+WP +G++EF N+SVRYRPGLDL LRNLN  V  GEKLGIVGRTGAGKSSLALALFRLIEPAEGTI ID+ DIT LGLHDLRSK+TIIPQDP+LFSG +R+NLDPFN +SDGE+W  LE++ LKSF A+T  GL++ +SE GENLSVGQ+QLVCLARALLKK+ +LVLDEATAAVD+ETD+LIQ+SIR  FK CTVLTIAHRLNTIMDYDRVMVL+QG++KEI++P+ LLA+EKS+FHSMA DAGLA
Sbjct:    6 FTSLCSDKSNDWLLWYDLIGWNTQDPDITLCFQYTILNWIPLLFLWISCMIYIPILWNKASFIYRNRGKFNIFKSTLIAFILFFHLLNFCATISESISNLYPPPALYLQPILSAISSILLIYLNRLIYKKGIHSSGVLFFYWLLQLLASITVIYSRYRRLKFHDRDLFRTVTATFEFLLVFVSFILNCFADLAVFTDSEQINNFQQDFDETQPLL-SLIPDDKTI--PINRIPCPENRVSFLSKLTFTWLTGLVIKGYRQPLTFKDLFALRENDTCDTIVTNMEFQWNRENQRVKQTKFHKKLEKQNGF------TSNYKPLKSEEEETEIDFVQNTNNNKEQKKKSPSFLRALFHTIGYPYMLAGVFKVAYDLLTFAQPQILGLFITFIDNPNDYVWHGFLLAICLFLISMIRSVIFQQYYHGCYVTGMRSRTAVIGIIYRKALKLSSTSRKETTVGEIVNLMSVDSQKLQDVPSFLHVLWTAPITIVIAIYFLWQELGPSVLAGVALMICLIPINGIIGSKVKKLQAKQMKMKDNRIKLMNEILSGIKILKLYAWENSFEENIQNIRNDECRILRSATYLNAVSAVTWFCAPFLVALCTFTAFTLSSSSHVLTANKAFVSLSLFNILSFPMSMLPGVIVYGIQAYVSLKRINKFLVGDELDTENVEVSPPDEKPVKIVDGTFSWGKTEAPVLININMEVPEGSLVAVVGTVGSGKTSLISALIGELYKVSGRVMCRGSIGYIPQQAWCRNASLQDNILFSKPLINHKYNRVIEACALTEDLKVLPAGDQTEIGEKGINLSGGQKQRISLARAVYQDCSVYLLDDPLSAVDSHVGKHIFDQVIGPSGLLSSKTRILVTHGLTYLPKVDKIFVMKDGNVSESGTFTELLKNNGSFAEFIRTYLEQEEEENVEEDSEDESKELKKELKHTISRLSSNIDSESEYQKSSHSSNPLTDSRRSHKRQSSVRLSKSRSVLAEEAEAELKKAKKKRLIEEEVAEIGGVKFSVFLSYIRSSTYLFSFTVVFSYALYMCCSVGANMFLSYWTETGSTNGTQNPDSQGFYLGIYGSLGAGQALFILIENFALAYGTFLASKSLHNLLLKNILRAPSSFFDTTPLGRILNRIGKDIDTVDVSIPTTIRIWLMTASGVIGSIFVISISSPYFLLALVPLTAMYYMAQRFYIYTSRQLKRIDSIKRSPIYSHFQESIVGASSIRAYKVSDDFIKKCDIMTDENQMAWYPNIVSYRWLQFYLETIGNLVILLSGVLAVVTRSTIGSGYAGLSISYALQITGGLNYMVRMTSDLESHTVAVERIKEYAEIESEAPWNIEESQAHSDWPDSGRVEFVNYSVRYRPGLDLVLRNLNIVVDAGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIIIDNRDITKLGLHDLRSKITIIPQDPILFSGTIRMNLDPFNQHSDGELWSVLEMSYLKSFIAKTSEGLQYLVSEGGENLSVGQKQLVCLARALLKKSKVLVLDEATAAVDLETDDLIQSSIRRQFKKCTVLTIAHRLNTIMDYDRVMVLEQGRVKEIDSPQNLLANEKSIFHSMAVDAGLA 1574          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000039911.1 (SMESG000039911.1)

HSP 1 Score: 1723.75 bits (4463), Expect = 0.000e+0
Identity = 900/1539 (58.48%), Postives = 1161/1539 (75.44%), Query Frame = 2
Query:   77 MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSRSIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFADSNVIKQTLTKSSSNDMDETHLLLPNNLNDDKTV---EYPVCPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDR---VHRKIIKQQYLKLESTSSHRY-QSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYL-XXXXXXXXXXXXXXXKLIKQELRKKLS----------------ITESFGREKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNK-KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDR 4618
            M+ + F  LCS+KS DW LW   + WDTPNPD+TLCFQYTILNWIPL FL I   I IPILL + S  Y T GK NI K+IL+  L FI+ L+ F++ ++ +    PP   +LQPILS + S+L+IY+NR+ Y KG+HSSG+LF YW +QL  + I++YSR  R++T   D F  +T+ +EF++V ISF ANCF+D  V+       S +D++E+  LL  NL+ ++TV   +   CPE KASFLSK+TF W T +I +G+R+PL   DL+ L  ED+C+ IVP +++EW+RELDR   ++R   K Q     + S  R  Q + +   ES+ RK +  K    P FLR L++TI   +  +G+ K+ YD   F QP +LG++I+FI N  +Y+WHGF Y  C+F++ M R+ I QQ+   C VTG+R +TAII IIY+KALKLS  SRK  TVGEIVNLMSVD+ K QD P + HLLW SPI I++ MY LWQELG A +AG+ L+IC++P+N +IGS+IKKLQ +QM+MKD RIKL+SEILSGIKILKL+AWE S  E ++ IR  EC+VLR A +LNAF++V WFC P LVA+ SF A+VL+   N+LTP KAFVS+SLFNILN PMSMLPG IVF IQ  VS  R+N FL G+ELD DNVE+S  N+ P+ +++G FSWG+ + P L +IN+++ EGSLV +VGTVGSGK+SLISA++GE+++++G V  +  +AYVPQQAWCQN SLQDNI+F K MV  KY+ V+EACAL EDLK+LP GDQTEIGEKG+NLSGGQKQRISLAR+VYQ++SVY+FDDPLSAVD+HVGKHIF KV   DGLLS  TRILVTHGL +L K D IFVMKDG +SE GT+KEL+KN+GPFA+F+RTYL +++++   ED ++E+K +K EL++ +S                I+  F  E  ++  R++S     SKS   +  EE+     K KL+++EVA+ GGVK  VF+ Y++  +YLF+++ ++ Y  YL   V  N+ LS WSE+G  + SQ     +++LGIYG +   Q +FILI++ +LAYG F+ASK+LH ++L+SI+RAPNSFFDTTP GRILNRIGKDIDTVDV IP T+R+WL + + V +S+I+I I+SPYF++ALIPL+  Y+  Q+FYICTSRQL+RIDSI++SPIYSHFQE+I+G +SIRAYKVT+ F  KC+ + D++QM W+  I   RW+Q  LE IGNIVILL+G+  V  RDTIGSG AGLS+SYAL IT SL  MVR +CD+ES  VA+ERIKEY +IESEAPWD  EVKPP+EWP +GK+EF N+SVRYRPGL+L LRNLN  V  GEKLGIVGRTGAGKSSLALALFRLIEPAEGTI+ID+I+++ LGLHDLRSK+TIIPQDPVLFSG LR+NLDPFN YSDGE+W +LE + LKSF ++T  GL+F +SE+GEN+SVGQRQLVCLARALLK+T +LVLDEATAA+D+ETD+LIQNSIR  FKSCTVLTIAHRLNTI+DYDR
Sbjct:    1 MSKIYFTGLCSSKSDDWTLWYDKIGWDTPNPDITLCFQYTILNWIPLSFLWISSMIYIPILLNRISYSYRTLGKLNIFKTILIALLIFIHILNFFRTVNESVKNRSPPSVLYLQPILSGLSSILLIYLNRIIYKKGIHSSGVLFFYWLIQLCASVIVVYSRYSRLQTSNPDIFSTVTATLEFILVLISFCANCFSDPAVLSNQEILDSEDDIEESQPLL--NLSSNETVNRHKIKACPEKKASFLSKLTFIWFTGMIIKGYRRPLIFSDLFALLNEDTCRNIVPKMEKEWSRELDRTSALNRDRKKPQGHDNFTASYQRLSQYISNLQDESDERKKHTIK---TPSFLRSLVYTIGLPYMLAGIHKLAYDLLTFTQPLLLGFFISFIENKKDYVWHGFIYAACLFVIGMIRSVILQQYYHGCYVTGMRTRTAIIGIIYRKALKLSSTSRKNTTVGEIVNLMSVDSQKLQDVPVYLHLLWSSPIIIVIAMYLLWQELGAAVLAGIALMICLIPVNGIIGSRIKKLQNKQMKMKDNRIKLMSEILSGIKILKLYAWENSFCENIEKIRNDECVVLRSATYLNAFSAVIWFCAPFLVAVCSFAAFVLSSTENVLTPNKAFVSLSLFNILNVPMSMLPGTIVFGIQAYVSLVRVNKFLLGDELDQDNVEISPPNESPVKVIDGTFSWGKCDPPTLTEINMDVSEGSLVAVVGTVGSGKTSLISALIGELYRVAGRVLCRGSIAYVPQQAWCQNASLQDNIIFRKPMVRHKYNSVIEACALTEDLKVLPGGDQTEIGEKGVNLSGGQKQRISLARAVYQDASVYIFDDPLSAVDSHVGKHIFNKVIGPDGLLSGKTRILVTHGLTFLPKVDNIFVMKDGKISENGTFKELVKNNGPFAEFVRTYLEQEEEEGEVEDSEDEAKELKNELKRTISKLSSQLDNQNELQKSTISNKFLFESKKSHRRQSSVRLSKSKSVLAEEAEEQMRKAKKNKLIEDEVAETGGVKFSVFLSYLRSSTYLFSIITVVSYLLYLVCSVGANLFLSYWSESGNTSKSQ-----NFYLGIYGAIGAGQGVFILIENFALAYGTFMASKSLHTLLLKSILRAPNSFFDTTPLGRILNRIGKDIDTVDVNIPTTIRMWLATAAGVFASVIVISISSPYFLIALIPLALMYYMAQRFYICTSRQLKRIDSIKRSPIYSHFQETIVGATSIRAYKVTEDFINKCDTMNDENQMAWYPNILSYRWLQLNLETIGNIVILLAGILGVLTRDTIGSGYAGLSLSYALQITGSLNFMVRMTCDLESYTVAVERIKEYADIESEAPWDNEEVKPPAEWPSSGKVEFINYSVRYRPGLELVLRNLNLCVSAGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIEIDNINVSRLGLHDLRSKITIIPQDPVLFSGTLRMNLDPFNQYSDGELWSSLESSYLKSFVSKTPEGLDFIVSESGENMSVGQRQLVCLARALLKRTKVLVLDEATAAIDLETDDLIQNSIRKQFKSCTVLTIAHRLNTILDYDR 1529          

HSP 2 Score: 65.0846 bits (157), Expect = 5.577e-10
Identity = 62/265 (23.40%), Postives = 112/265 (42.26%), Query Frame = 2
Query: 3905 VAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINL---DPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSI---RTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLAD 4681
            V++ R+ ++  +  E   D  E+ PP+E P    ++  + +  +       L  +N  V  G  + +VG  G+GK+SL  AL   +    G                 R  +  +PQ     + +L+ N+    P   +    +   +E   L         G +  I E G NLS GQ+Q + LARA+ +  ++ + D+  +AVD    + I N +          T + + H L  +   D + V++ G+I E  T K+L+ +
Sbjct:  640 VSLVRVNKFL-LGDELDQDNVEISPPNESP----VKVIDGTFSWGKCDPPTLTEINMDVSEGSLVAVVGTVGSGKTSLISALIGELYRVAG-------------RVLCRGSIAYVPQQAWCQNASLQDNIIFRKPMVRHKYNSV---IEACALTEDLKVLPGGDQTEIGEKGVNLSGGQKQRISLARAVYQDASVYIFDDPLSAVDSHVGKHIFNKVIGPDGLLSGKTRILVTHGLTFLPKVDNIFVMKDGKISENGTFKELVKN 883          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000014785.1 (SMESG000014785.1)

HSP 1 Score: 1066.6 bits (2757), Expect = 0.000e+0
Identity = 667/1637 (40.75%), Postives = 958/1637 (58.52%), Query Frame = 2
Query:  134 WSSNVIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSR--SIRVKTPANDKFRXXXXXXXXXXXXXXXXANCFAD----SNVIKQTLTKSSSN----DMDETHL-----LLPNNLNDDKTVEYPV-------------CPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYL---------------------KLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNE-YIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTXXXXXXXXXXXXXXXXXRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENE-APILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLXXXXXXXXXXXXXXXKLIKQEL------RKKLSITESFGR-----------------------EKGEAXXXXXXXXXXXXXXXXXXXXXXXXNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTI--------------NNSQ----DLAA-----RDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTXXXXXXXXXXXXXXXXXXXXLALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDT---IGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTXXXXXXXXXXXXXXXXRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQT-DLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 4723
            W+S   W++P+PD+  CFQ+       L +LI+ C   I  L+RKK +      K  IIK  L+  L  +  L++  + + +     P              S+L I V        V+S G  F YW L  I+ A+   +   S+++K    D  R     I    V +S + +CF++    S + +    +   N    + D+ H+     + PN ++  KT E  +             CPE  +SFLS+I F W T LI +G++ PL  +DL++L  E+ C  IVPI+ R +++ L    R+  K   +                     KL S   +  +S+P +N E++T K    K+   P  +  L+ +       SGL K+I+D   F+ P +L   + F+ +  E + W G+F    + + +M RTFI  Q+  +    G+R ++++IS +Y+K+L+LS ASRKE TVGEIVNLMS+DA KF +   + H++W  P  II  +  LW ELGP+ +AGLV+++ M+P+NAVIG+  +K+Q QQ+++ D RIK+++EIL+GIK+LKL+AWE S    V  IR KE   +++A + NA  S  + C P LV+L +FG +VL   +N+L  +KAFVSI+LFNIL FP+ MLP  I   IQ  VS KR+  FL  EE++ D V    +     +I NG F W      P+L++IN+   E  LV IVG VG GKSS++SA+LGE+ K+ G V  K  +AYVPQQAW  N +++DNI+FG      KY ++++AC L  D +IL   D TEIGEKGINLSGGQKQR+SLAR+ Y +S+VYL DDPLSAVD+HVGK + + V SS G+L+  TRILVTH LA L+K D+I VM +G VSE GTY +L+++ G FA+FI T+L  +   ++       +L +++L      R    I +S                          EK  A   +        +            N NK L++EE +K G VK+ V++ Y++   +  A   IL + +     +  N+ L  WS+   I              N+SQ    DL       RD  LGIYG   F QA+  L  SL  A+ +  ++ +LH ++L  ++R P S F+T P GRI+NR   D++ V   +P+ +  +L +  + I   I++ I +P+ I+ L  +  FY  IQ+ Y+ TSRQL+R++S+ KSPIYSHF E++ G SSIRAY + DKF    +   DK+   ++     NRW+   LE +GN ++ ++ +FAV        I +GL GLSVSYAL IT +L  +VR S ++ESN+V++ERI+EY+++  EAPWDI E KP   WP  G I+F N+S +YR GLD  L+N+NF +   EK+GIVGRTG+GKSSL LALFR++E ++G I ID + I  LGLHD+R +LTIIPQDPVLFSG LR NLDPFN + D EIW  LE++NLK+F   + +  LE  ISE GENLSVGQRQLVCLARALL++TNILVLDEATAAVD++TD LIQ +IR  FK CT+LTIAHRLNT++DYD+++VL+ G+I E++ P  LL + +S F+SMAK + L
Sbjct:    5 WASE--WNSPSPDIPTCFQFFDAPIYLLGYLIL-CFPYIIHLIRKK-VNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKK--NNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNS-GFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGKKYKEIEEPEKEKLTSPPDNNKRSIP-QNAETDTDK---KKEKFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPYQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFDELEEKDLLLQDLQRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNK-LIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQALIQLFSSLFFAFAIIKSAASLHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMSSEVESNIVSVERIEEYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 1628          
The following BLAST results are available for this feature:
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC10.000e+044.47ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+044.47ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+045.13ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+045.13ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC30.000e+042.86ATP binding cassette subfamily C member 3 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrp-70.000e+039.58pep chromosome:WBcel235:V:19674843:19693043:1 gene... [more]
mrp-21.050e-16739.12pep chromosome:WBcel235:X:563719:572701:-1 gene:WB... [more]
mrp-17.211e-16549.92pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-12.302e-16449.41pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-46.263e-16450.76pep chromosome:WBcel235:X:9884278:9889704:1 gene:W... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRP0.000e+044.24gene:FBgn0032456 transcript:FBtr0090023[more]
MRP0.000e+044.11gene:FBgn0032456 transcript:FBtr0090026[more]
MRP0.000e+044.11gene:FBgn0032456 transcript:FBtr0090025[more]
MRP0.000e+044.18gene:FBgn0032456 transcript:FBtr0090022[more]
MRP0.000e+044.15gene:FBgn0032456 transcript:FBtr0090021[more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+044.41ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc10.000e+044.56ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc6a0.000e+041.23ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc6b.20.000e+041.47ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc20.000e+040.88ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC10.000e+043.94ATP binding cassette subfamily C member 1 [Source:... [more]
septin90.000e+043.91septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
septin90.000e+044.29septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
ABCC10.000e+043.66ATP binding cassette subfamily C member 1 [Source:... [more]
septin90.000e+043.73septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcc10.000e+044.41ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+043.07ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+043.09ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc40.000e+034.48ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc90.000e+034.56ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35379|MRP1_MOUSE0.000e+044.41Multidrug resistance-associated protein 1 OS=Mus m... [more]
sp|Q864R9|MRP1_MACFA0.000e+044.41Multidrug resistance-associated protein 1 OS=Macac... [more]
sp|Q5F364|MRP1_CHICK0.000e+044.19Multidrug resistance-associated protein 1 OS=Gallu... [more]
sp|Q8CG09|MRP1_RAT0.000e+044.21Multidrug resistance-associated protein 1 OS=Rattu... [more]
sp|P33527|MRP1_HUMAN0.000e+044.47Multidrug resistance-associated protein 1 OS=Homo ... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GTI50.000e+048.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GQF25.630e-1048.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HV065.726e-1048.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3J1750.000e+046.00multidrug resistance-associated protein 1 OS=Lingu... [more]
A0A1B6EGY90.000e+045.43Uncharacterized protein OS=Clastoptera arizonana O... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+043.82ATP binding cassette subfamily C member 1 [Source:... [more]
abcc10.000e+043.87ATP binding cassette subfamily C member 1 [Source:... [more]
abcc10.000e+043.99ATP binding cassette subfamily C member 1 [Source:... [more]
abcc6b.20.000e+041.07multidrug resistance-associated protein 1-like [So... [more]
abcc6a0.000e+041.37multidrug resistance-associated protein 1-like [So... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+039.64ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
ABCC81.592e-1332.79ATP binding cassette subfamily C member 8 [Source:... [more]
ENSPMAT00000007076.11.588e-12443.03pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 g... [more]
ENSPMAT00000006454.12.974e-12243.44pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:... [more]
ENSPMAT00000001536.12.731e-11941.83pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 ge... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BPT10.000e+037.15ABC type transmembrane transporter of MRP/CFTR fam... [more]
YBT10.000e+034.38Transporter of the ATP-binding cassette (ABC) fami... [more]
VMR18.958e-1634.57Vacuolar membrane protein; involved in multiple dr... [more]
YCF14.898e-15247.47Vacuolar glutathione S-conjugate transporter; ABC-... [more]
YOR14.973e-15135.42Plasma membrane ATP-binding cassette (ABC) transpo... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364740.000e+046.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468460.000e+035.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412570.000e+033.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316470.000e+033.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445532.803e-17331.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+044.30multidrug resistance-associated protein 1 [Source:... [more]
abcc18.057e-1244.20multidrug resistance-associated protein 1 [Source:... [more]
abcc18.243e-1244.24multidrug resistance-associated protein 1 [Source:... [more]
abcc19.222e-1244.24multidrug resistance-associated protein 1 [Source:... [more]
abcc6a0.000e+040.66multidrug resistance-associated protein 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064939.10.000e+099.74SMESG000064939.1[more]
SMESG000064939.10.000e+097.29SMESG000064939.1[more]
SMESG000057252.10.000e+059.63SMESG000057252.1[more]
SMESG000039911.15.577e-1058.48SMESG000039911.1[more]
SMESG000014785.10.000e+040.75SMESG000014785.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033764 ID=SMED30033764|Name=Multidrug resistance-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4887bp
CAACTATTTAAACCTATAATTATAGAATTTTGTTTTTTGCTTTTTAGTTA
TTTATTTTCATATTAAAAATTTTTAAATGACAGTAGTGAGTTTCAAAATT
CTATGTTCAAATAAATCTCCAGACTGGCTGCTTTGGTCTTCTAATGTAAT
TTGGGATACTCCAAATCCTGATCTTACTCTTTGTTTTCAATACACAATAT
TGAATTGGATTCCCTTGATGTTTCTTATAATTGGCTGTGCTATAAATATT
CCTATATTGTTGAGAAAGAAATCCATTTATTATTCTACAAGGGGAAAGTT
TAATATAATAAAATCAATTTTAGTTTGTGGTTTATTTTTTATCTATTGTT
TGGATTTATTTAAATCCACCAGTGATCAGATTGTTGGCCTGCAGCCTCCG
GTGGCTCAATTTCTTCAACCAATTTTATCAGCAGTGTTTTCGCTGCTTGT
TATCTATGTCAACCGACTTACGTATATTAAAGGAGTCCACTCGTCAGGAA
TATTATTTATTTATTGGAGTTTACAGCTAATAGTGAATGCCATCATTCTC
TATTCAAGAAGCATCAGAGTCAAGACGCCCGCAAATGATAAATTTCGATT
TATTACATCTATTATAGAGTTTGTGATCGTTTTCATTAGTTTTATCGCAA
ATTGTTTCGCGGATTCCAATGTGATTAAACAAACTTTGACTAAGTCATCG
TCAAACGATATGGATGAAACACATTTATTGTTGCCAAATAATCTGAATGA
CGACAAAACTGTGGAATATCCGGTATGTCCAGAATTAAAAGCCTCGTTTT
TGTCAAAAATAACATTTTCATGGCCCACAAGATTAATTTACCGTGGTTTC
CGTAAACCTCTAACAATCGATGATCTTTATATGCTGAAAGAGGAGGATTC
GTGTAAGGAAATTGTCCCAATCATAGATAGAGAGTGGAACCGAGAACTCG
ATAGAGTACATAGAAAGATCATAAAGCAACAATACTTAAAATTGGAATCA
ACATCAAGCCATCGTTATCAATCTCTTCCATCAGAAAATATGGAGAGTAA
TACCCGGAAGACTAATATCAGCAAAGACACACCGAAACCGTGGTTTTTAA
GAGTTCTTTTACATACTATTAGTTATAAATTCTTTTTTTCTGGACTTTTA
AAAGTCATATATGATCAATCAAATTTTATTCAACCGGCTATTCTTGGATA
TTATATTAATTTCATCGGCAACCACAATGAATACATTTGGCATGGCTTTT
TCTATATGTTTTGTATTTTTCTCGTTTCAATGGCACGAACTTTTATCAAT
CAACAGTTCATGTTTATGTGCGCTGTGACAGGCATCAGAGCCAAGACAGC
AATTATCTCTATTATTTATAAAAAGGCCTTAAAATTATCTTTGGCAAGTA
GAAAAGAAAGAACAGTTGGAGAAATTGTTAATTTAATGTCTGTAGATGCT
TCAAAATTTCAAGATTTTCCGTTTTTCTTTCATTTATTATGGGTCTCTCC
GATAACTATAATAGTGACAATGTATTTCCTATGGCAGGAATTGGGACCCG
CCACGATAGCGGGGTTGGTTCTTTTAATCTGCATGTTGCCAATCAATGCT
GTTATAGGATCAAAAATCAAAAAATTACAAACGCAACAAATGCGAATGAA
AGATGGAAGGATCAAACTTATCAGTGAAATTCTTAGTGGAATAAAAATTT
TAAAATTATTTGCATGGGAGTTATCTCTTGAAGAAAAAGTTAAAACAATC
CGAGAAAAAGAATGCTTAGTTTTAAGAAAAGCTATGTTTCTCAATGCATT
TACTAGTGTAGCTTGGTTTTGTACACCTCCACTTGTTGCTCTTTTCAGTT
TTGGAGCGTACGTTTTGGCGGATCCTAATAATATCCTAACCCCACAGAAA
GCTTTTGTTTCTATTTCTTTATTTAACATACTAAATTTTCCTATGTCGAT
GCTTCCCGGAGCAATTGTATTTACTATCCAAGGCCTTGTTTCTGCAAAAC
GAATAAATCACTTTCTAAATGGTGAAGAATTGGATCCTGATAACGTGGAG
GTTTCTACATCAAATGATAAGCCAATATCTATTGTCAATGGGAATTTTAG
CTGGGGTGAGAATGAAGCACCTATTTTGAGAGATATTAATTTGGAAATCG
AGGAAGGTTCTCTAGTGATGATTGTTGGCACAGTTGGTAGTGGGAAATCC
TCTCTTATTAGTGCTATTTTAGGAGAGATGTTTAAAATATCTGGAACAGT
TAAAAGAAAAGAACCAGTTGCATATGTGCCTCAACAAGCTTGGTGTCAAA
ACCGTTCATTGCAAGATAACATCTTGTTTGGAAAGTCTATGGTATATTCC
AAATATCACAAGGTTCTTGAAGCTTGTGCATTAATAGAAGATCTAAAGAT
TTTACCAGCAGGAGATCAAACAGAAATTGGCGAAAAGGGTATTAATCTTT
CTGGAGGACAAAAACAGCGAATAAGCTTAGCAAGATCGGTTTACCAAAAC
TCTTCGGTTTATTTATTTGATGACCCGCTTTCGGCAGTAGATGCGCACGT
TGGGAAGCACATTTTTGAAAAGGTATTTAGCTCAGATGGATTACTTTCTA
AAACAACAAGAATTCTTGTCACTCATGGCTTGGCATATTTAGCAAAGGCT
GATAAAATATTTGTTATGAAAGATGGAAATGTTAGTGAAGCTGGAACTTA
CAAAGAATTATTGAAGAATGACGGACCCTTTGCTGACTTTATCAGAACAT
ATTTAGAACAAGATGACGATGAATCGTCCGAAGATTGCGATGAAGAAAGT
AAACTTATAAAACAAGAACTTCGAAAAAAATTGTCGATTACTGAATCATT
TGGTAGAGAAAAGGGAGAAGCTAAGTCTCGAAGAAATTCTTCTATTTCAG
GATTGTCAAAAAGCAAAAGTATGAAAACAACAGAAGAAAAAACAAATAAT
GTAAATAAAAAATTAGTTGATGAAGAAGTTGCTAAAATCGGAGGAGTGAA
ACTCGAAGTATTTATTTATTATATTCAATGCGGATCCTATTTGTTTGCTA
TGCTAGCAATCTTGTGTTATTGTTCATATCTAGCTGCACTTGTCTCCGGG
AACATAGTTCTTAGCTCATGGAGCGAGGCTGGTACTATTAATAATAGTCA
GGATCTGGCAGCTCGAGATTATTTTCTGGGTATTTATGGTGGACTCGCCT
TCACTCAAGCCATTTTTATTTTAATTCAAAGCCTTTCTCTGGCTTATGGA
ATGTTCCTTGCCTCTAAAACTCTACACAATGTCATGCTGCGATCAATAAT
TAGGGCGCCTAATTCATTTTTCGATACCACACCTTCTGGAAGAATACTCA
ACAGAATCGGGAAAGATATTGATACAGTCGATGTAACAATTCCAAATACT
GTAAGAATTTGGTTGACATCTGGATCGAGAGTTATCAGTTCAATTATTAT
AATTTGTATTGCTTCACCATATTTTATTCTTGCACTGATTCCTTTGTCTT
TCTTTTATTTTTTTATTCAAAAGTTTTATATTTGTACAAGTCGACAACTC
CAAAGAATTGATTCCATTAGAAAATCCCCGATCTATTCACATTTTCAAGA
AAGCATTATTGGAACTTCTTCTATTCGTGCTTACAAGGTTACTGATAAAT
TTACCACTAAATGTGAAGAACTCACTGATAAAAGTCAAATGGTTTGGTTT
CTTATAATTTCCTGCAATCGTTGGATGCAGTTTTATTTGGAATTAATCGG
AAATATAGTAATATTATTGTCGGGGGTTTTTGCGGTCTTCATTCGTGATA
CTATTGGATCCGGTTTAGCGGGATTGAGTGTAAGTTACGCACTGATGATA
ACTACCAGTCTAGCAGTTATGGTGAGGAACTCATGCGACATCGAATCCAA
TGTTGTGGCAATTGAAAGAATTAAAGAATACACAGAAATTGAATCAGAGG
CACCTTGGGATATTCCTGAGGTCAAGCCTCCAAGTGAATGGCCACAAAAT
GGCAAAATTGAATTCAGCAATTTTTCAGTCAGATATAGACCAGGATTAGA
TCTTGCATTGAGAAATTTAAATTTCACTGTCCAAAGAGGAGAAAAGCTTG
GAATCGTAGGCCGAACAGGAGCCGGAAAATCCTCATTGGCACTGGCTTTA
TTCCGGTTAATAGAACCAGCGGAAGGAACAATAAAAATTGATGACATTGA
TATCACTTTGTTGGGTCTCCATGATTTGAGAAGCAAATTAACAATAATTC
CTCAGGATCCTGTGTTGTTTTCTGGAAATTTAAGGATAAATCTCGATCCA
TTCAATCTCTATTCTGACGGTGAAATTTGGATTGCGTTAGAAATTGCGAA
TTTGAAATCATTTTTCGCTCAGACTGATTTAGGTTTAGAATTTACGATTT
CTGAAAATGGAGAAAATTTAAGTGTGGGCCAAAGACAGTTAGTTTGTTTA
GCAAGAGCTTTACTTAAAAAAACTAATATTCTTGTTTTGGACGAGGCAAC
GGCTGCGGTTGACATGGAAACGGACGAACTCATTCAGAATAGTATTCGTA
CAGCGTTCAAATCTTGTACAGTTTTAACAATTGCTCACAGACTTAACACA
ATTATGGACTATGACCGGGTAATGGTTCTCCAGCAAGGTCAGATCAAAGA
AATTAATACTCCGAAGAAACTTCTTGCAGATGAGAAATCGTTATTCCATA
GTATGGCCAAAGATGCCGGACTAGCTTAGAGTTAAATGAAAATGTGTTAA
TTGATCTTGTCACCAAAATATTTAATTATTTTCGTAAATTACTGTGAAAC
ATTGGCATTTGAAATTTGAGGACTTACCAAACAGTCATTTTGTTATTTTA
CTTTTTCTGTCATACATTTTATTAGATAATAAATTAA
back to top

protein sequence of SMED30033764-orf-1

>SMED30033764-orf-1 ID=SMED30033764-orf-1|Name=SMED30033764-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1551bp
MTVVSFKILCSNKSPDWLLWSSNVIWDTPNPDLTLCFQYTILNWIPLMFL
IIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSD
QIVGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQ
LIVNAIILYSRSIRVKTPANDKFRFITSIIEFVIVFISFIANCFADSNVI
KQTLTKSSSNDMDETHLLLPNNLNDDKTVEYPVCPELKASFLSKITFSWP
TRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIK
QQYLKLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISY
KFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNEYIWHGFFYMFCIFLV
SMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEI
VNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLL
ICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELS
LEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADP
NNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGE
ELDPDNVEVSTSNDKPISIVNGNFSWGENEAPILRDINLEIEEGSLVMIV
GTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNIL
FGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRIS
LARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTH
GLAYLAKADKIFVMKDGNVSEAGTYKELLKNDGPFADFIRTYLEQDDDES
SEDCDEESKLIKQELRKKLSITESFGREKGEAKSRRNSSISGLSKSKSMK
TTEEKTNNVNKKLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCS
YLAALVSGNIVLSSWSEAGTINNSQDLAARDYFLGIYGGLAFTQAIFILI
QSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDT
VDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKF
YICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELT
DKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDTIGSGLAGL
SVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVK
PPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAG
KSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSG
NLRINLDPFNLYSDGEIWIALEIANLKSFFAQTDLGLEFTISENGENLSV
GQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVL
TIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGLA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0008559xenobiotic-transporting ATPase activity
GO:0015431glutathione S-conjugate-exporting ATPase activity
GO:0016787hydrolase activity
GO:0022857transmembrane transporter activity
GO:0042910xenobiotic transporter activity
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0000166nucleotide binding
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0042493response to drug
GO:0042908xenobiotic transport
GO:0050729positive regulation of inflammatory response
GO:0071716leukotriene transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR005292Multidrug-R_assoc
IPR036640ABC1_TM_sf
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR011527ABC1_TM_dom
IPR017871ABC_transporter_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 693..868
e-value: 2.4E-8
score: 43.7
coord: 1337..1522
e-value: 3.6E-13
score: 59.7
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 684..818
e-value: 4.0E-20
score: 72.7
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 1328..1476
e-value: 5.9E-30
score: 104.6
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 1311..1545
score: 18.434
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 667..891
score: 22.649
IPR005292Multi drug resistance-associated proteinTIGRFAMTIGR00957TIGR00957coord: 10..1549
e-value: 0.0
score: 1653.2
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 1000..1258
e-value: 9.3E-38
score: 130.4
coord: 353..623
e-value: 6.6E-34
score: 117.8
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 993..1274
score: 35.071
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 365..635
score: 33.946
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 647..918
e-value: 1.6E-70
score: 239.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1295..1545
e-value: 2.3E-85
score: 288.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 926..955
NoneNo IPR availablePANTHERPTHR24223FAMILY NOT NAMEDcoord: 82..1550
NoneNo IPR availablePANTHERPTHR24223:SF350CANALICULAR MULTISPECIFIC ORGANIC ANION TRANSPORTER 2coord: 82..1550
NoneNo IPR availableCDDcd18595ABC_6TM_MRP1_2_3_6_D1_likecoord: 354..643
e-value: 4.35942E-141
score: 433.049
NoneNo IPR availableCDDcd03250ABCC_MRP_domain1coord: 667..867
e-value: 5.87209E-107
score: 336.364
NoneNo IPR availableCDDcd03244ABCC_MRP_domain2coord: 1309..1529
e-value: 1.40333E-128
score: 396.479
NoneNo IPR availableCDDcd18603ABC_6TM_MRP1_2_3_6_D2_likecoord: 991..1286
e-value: 4.31754E-129
score: 401.086
NoneNo IPR availableTMHMMTMhelixcoord: 612..634
NoneNo IPR availableTMHMMTMhelixcoord: 1216..1238
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
NoneNo IPR availableTMHMMTMhelixcoord: 75..92
NoneNo IPR availableTMHMMTMhelixcoord: 136..158
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
NoneNo IPR availableTMHMMTMhelixcoord: 1119..1141
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 464..486
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 490..512
NoneNo IPR availableTMHMMTMhelixcoord: 989..1011
NoneNo IPR availableTMHMMTMhelixcoord: 575..597
NoneNo IPR availableTMHMMTMhelixcoord: 1243..1265
NoneNo IPR availableTMHMMTMhelixcoord: 1040..1062
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 341..646
e-value: 9.0E-24
score: 86.1
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 955..1293
e-value: 5.6E-40
score: 139.4
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 992..1297
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 338..654
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 1448..1462
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 791..805
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1303..1540
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 661..891