Zinc finger HIT domain-containing protein 1

Overview
NameZinc finger HIT domain-containing protein 1
Smed IDSMED30033762
Length (bp)1148
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger HIT domain-containing protein 1 (SMED30033762) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger HIT domain-containing protein 1 (SMED30033762) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033762

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30033762SMESG000032541.1 SMESG000032540.1 Contig40657newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033762SMESG000032541.1 SMESG000032540.1 Contig40657uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033762SMESG000032541.1 Contig28417newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Human
Match: C9orf116 (chromosome 9 open reading frame 116 [Source:HGNC Symbol;Acc:HGNC:28435])

HSP 1 Score: 53.1434 bits (126), Expect = 4.403e-8
Identity = 33/103 (32.04%), Postives = 50/103 (48.54%), Query Frame = 2
Query:  749 ACL-PVIEKVIVPDKKECEDLEGLRTSDIY-ATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            AC  PV  K   P +         RTSD Y  + +LP RF  P    GY  ++   +Y+T+N  YG   P VH MP V+    + FS++    G  ++++ N+
Sbjct:    8 ACAEPVAPKATAPPE---------RTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNV 101          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Zebrafish
Match: si:ch211-248e11.2 (si:ch211-248e11.2 [Source:NCBI gene;Acc:557793])

HSP 1 Score: 64.3142 bits (155), Expect = 3.795e-12
Identity = 35/80 (43.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  815 LRTSDIYATE-NLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            ++TSD+Y  + NLP RF  PDC   Y +K  + LY+TTN  YG  KP VH MPT +    H FS+   + G  +D+ FN 
Sbjct:   27 IKTSDVYKVDKNLPSRFNNPDCFR-YSHKTTNPLYRTTNQAYGSKKPTVHEMPTSFNGSRHRFSEHLLKSGMYRDNGFNT 105          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000032208.1 (chromosome unknown C9orf116 homolog [Source:NCBI gene;Acc:101733379])

HSP 1 Score: 46.2098 bits (108), Expect = 8.593e-6
Identity = 31/92 (33.70%), Postives = 45/92 (48.91%), Query Frame = 2
Query:  782 PDKKECEDLEGLRTSDIY-ATENLPLRFEYPDCVT-GYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            P +    D    +T D Y  +E+LP +F  P+    GY  K  + LY+T+N  YG   P VH MPT +      FS+   + G  ++H FN 
Sbjct:    5 PAQGTSSDPSHPQTCDFYRVSESLPPKFNQPETWRRGYRPKTDNPLYRTSNQIYGSRPPTVHEMPTTFNGISDKFSETAVKCGMYRNHGFNT 96          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Mouse
Match: 1700007K13Rik (RIKEN cDNA 1700007K13 gene [Source:MGI Symbol;Acc:MGI:1916577])

HSP 1 Score: 63.929 bits (154), Expect = 1.110e-11
Identity = 31/79 (39.24%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  818 RTSDIY-ATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            +TSD Y  +E LP+RF  P    GYG KE   +Y+T+N  YG   P VH MP V+    + FS+++  +G  + H+ N+
Sbjct:   54 KTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMPKVFYPSSNKFSRQHAAFGMFQSHNINV 132          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Mouse
Match: 1700007K13Rik (RIKEN cDNA 1700007K13 gene [Source:MGI Symbol;Acc:MGI:1916577])

HSP 1 Score: 52.373 bits (124), Expect = 5.749e-8
Identity = 25/52 (48.08%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  818 RTSDIY-ATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMP 970
            +TSD Y  +E LP+RF  P    GYG KE   +Y+T+N  YG   P VH MP
Sbjct:   54 KTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMP 105          
BLAST of Zinc finger HIT domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|B5X5D0|CI116_SALSA (UPF0691 protein C9orf116 homolog OS=Salmo salar OX=8030 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.426e-14
Identity = 39/102 (38.24%), Postives = 55/102 (53.92%), Query Frame = 2
Query:  764 IEKVIVPDKKE------CEDLEGLRTSDIYATE-NLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFN 1048
            I +VI+ D +        +D E ++TSD+Y  + NLP RF  PDC  GY  K  H  YQT++  YG  +P VH MPT +      FS+   + G  +D+ FN
Sbjct:    5 ILRVIIMDSENYVETHPSDDNEAMKTSDVYKVDKNLPKRFNNPDCFQGYSTKINHPFYQTSSQIYGSKRPTVHEMPTTFNGSYRKFSEHMLKSGMFRDNGFN 106          
BLAST of Zinc finger HIT domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|B0UXH9|CI116_DANRE (UPF0691 protein C9orf116 homolog OS=Danio rerio OX=7955 GN=si:ch211-248e11.2 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.865e-11
Identity = 35/80 (43.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  815 LRTSDIYATE-NLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            ++TSD+Y  + NLP RF  PDC   Y +K  + LY+TTN  YG  KP VH MPT +    H FS+   + G  +D+ FN 
Sbjct:   27 IKTSDVYKVDKNLPSRFNNPDCFR-YSHKTTNPLYRTTNQAYGSKKPTVHEMPTSFNGSRHRFSEHLLKSGMYRDNGFNT 105          
BLAST of Zinc finger HIT domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5BN45|CI116_MOUSE (UPF0691 protein C9orf116 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 7.762e-11
Identity = 31/79 (39.24%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  818 RTSDIY-ATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            +TSD Y  +E LP+RF  P    GYG KE   +Y+T+N  YG   P VH MP V+    + FS+++  +G  + H+ N+
Sbjct:   54 KTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMPKVFYPSSNKFSRQHAAFGMFQSHNINV 132          
BLAST of Zinc finger HIT domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q32P67|CI116_BOVIN (UPF0691 protein C9orf116 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.617e-8
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 2
Query:  818 RTSDIY-ATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            +TSD Y  +E+LP RF  P    GY  KE   +Y+T+N  YG   P VH MP V+    + FS++    G  ++++ N+
Sbjct:   23 KTSDWYRVSEDLPARFNNPAWFRGYRTKEPPSVYRTSNQAYGSRAPTVHEMPKVFYPNSYKFSRQVAVGGMFQNNTLNV 101          
BLAST of Zinc finger HIT domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5BN46|CI116_HUMAN (UPF0691 protein C9orf116 OS=Homo sapiens OX=9606 GN=C9orf116 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.115e-7
Identity = 33/103 (32.04%), Postives = 50/103 (48.54%), Query Frame = 2
Query:  749 ACL-PVIEKVIVPDKKECEDLEGLRTSDIY-ATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            AC  PV  K   P +         RTSD Y  + +LP RF  P    GY  ++   +Y+T+N  YG   P VH MP V+    + FS++    G  ++++ N+
Sbjct:    8 ACAEPVAPKATAPPE---------RTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNV 101          
BLAST of Zinc finger HIT domain-containing protein 1 vs. TrEMBL
Match: A0A4E0S0U1 (Zinc finger HIT domain-containing protein 1 OS=Fasciola hepatica OX=6192 GN=D915_004964 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.053e-16
Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  809 EGLRTSDIYA-TENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            EG +TSD Y   ENLP +F  PD   GY  ++ + LY+TTN+EYG+ KPNVHTM  VY  ++  F++RYG+ G  ++HS N 
Sbjct:   47 EGAKTSDYYTVAENLPKKFNEPDLFQGYDRRQTNPLYRTTNAEYGRLKPNVHTMNAVYHARNQDFTRRYGKSGNYRNHSLNT 128          
BLAST of Zinc finger HIT domain-containing protein 1 vs. TrEMBL
Match: A0A504YUW4 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_11747 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.379e-15
Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  809 EGLRTSDIYA-TENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            EG +TSD Y   ENLP +F  PD   GY  ++ + LY+TTN+EYG+ KPNVHTM  VY  ++  F++RYG+ G  ++HS N 
Sbjct:   73 EGAKTSDYYTVAENLPKKFNEPDLFQGYERRQTNPLYRTTNAEYGRLKPNVHTMNAVYHARNQDFTRRYGKSGNYRNHSLNT 154          
BLAST of Zinc finger HIT domain-containing protein 1 vs. TrEMBL
Match: A0A2H1CB17 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_08194 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.678e-15
Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  809 EGLRTSDIYA-TENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            EG +TSD Y   ENLP +F  PD   GY  ++ + LY+TTN+EYG+ KPNVHTM  VY  ++  F++RYG+ G  ++HS N 
Sbjct:   86 EGAKTSDYYTVAENLPKKFNEPDLFQGYDRRQTNPLYRTTNAEYGRLKPNVHTMNAVYHARNQDFTRRYGKSGNYRNHSLNT 167          
BLAST of Zinc finger HIT domain-containing protein 1 vs. TrEMBL
Match: K1Q7P7 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10021467 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.466e-14
Identity = 36/79 (45.57%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  812 GLRTSDIYATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFN 1048
            G +TS+ Y TEN+P RFE P+   GYG K +H +Y+T+ S+YG   P+VHTMPT +  +   FS   G+ G  ++HS N
Sbjct:   17 GAKTSEFYRTENVPNRFENPEWFQGYGGKTQHPMYRTSASDYGAKAPSVHTMPTTFHARSQKFSMHLGQCGMYRNHSLN 95          
BLAST of Zinc finger HIT domain-containing protein 1 vs. TrEMBL
Match: A0A210PYP4 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT02167 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.904e-13
Identity = 35/81 (43.21%), Postives = 52/81 (64.20%), Query Frame = 2
Query:  809 EGLRTSDIYATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            EG +T+  Y T+N+P RF+ PD   GYG K++H +Y+TT+  YG   P+VHTMPT +  +   FS+  G+ G  ++HS N 
Sbjct:   20 EGSQTAAFYRTDNIPTRFDNPDWFQGYGGKDQHPMYRTTSCTYGAKPPSVHTMPTSFHCRSQKFSEHLGKCGMYRNHSLNT 100          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Cavefish
Match: si:ch211-248e11.2 (chromosome 6 C9orf116 homolog [Source:NCBI gene;Acc:103023176])

HSP 1 Score: 68.1662 bits (165), Expect = 1.437e-13
Identity = 38/79 (48.10%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  818 RTSDIYATE-NLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            RTSD Y  + NLP RF +P+ + GY  K  H LYQTTN  YG  KP VH MPT +      FS+   R G  KD+ FN 
Sbjct:   23 RTSDFYRVKPNLPKRFNHPEKLRGYSKKTLHPLYQTTNQTYGSKKPTVHEMPTAFHGTCRKFSENTLRCGMYKDNGFNT 101          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO42553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S180])

HSP 1 Score: 68.9366 bits (167), Expect = 1.354e-14
Identity = 31/81 (38.27%), Postives = 48/81 (59.26%), Query Frame = 2
Query:  809 EGLRTSDIYATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            +G +T + Y T+N+P RF  PDC  GY   + + +Y T++ EYG  +P VHTMPT +  +   F+   G+ G  ++HS N 
Sbjct:   27 KGAKTCEYYRTKNIPDRFNNPDCFDGYNTSQPNPMYMTSSQEYGNRRPTVHTMPTSFHAKCQKFTDHLGKCGMYRNHSLNT 107          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Medaka
Match: ENSORLT00000043692.1 (chromosome 9 C9orf116 homolog [Source:NCBI gene;Acc:101158705])

HSP 1 Score: 63.5438 bits (153), Expect = 5.211e-12
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  815 LRTSDIYATE-NLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            ++TSD Y T+ +LP RF  PDC  GYG K  H LY+T+N  YG +KP VH MP         FS+    +G  +D+SFN 
Sbjct:   12 VQTSDFYRTDPDLPRRFNDPDCFHGYGVKPTHPLYRTSNQTYGSNKPTVHEMPV-------SFSEAMLHHGMYRDNSFNT 84          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000032541.1 (SMESG000032541.1)

HSP 1 Score: 455.677 bits (1171), Expect = 7.082e-163
Identity = 218/221 (98.64%), Postives = 221/221 (100.00%), Query Frame = 2
Query:  389 MKSILTTAKLSRANAAHKCFRGTGLDDKICPQIIPVQQPKYVYNECKKDVYEDFPYIKPEKSIADDSGKCQFNPPTVNKYVHFADGHQDDECTQVIKQESEIENSNEVLDKYRLLTPENYACLPVIEKVIVPDKKECEDLEGLRTSDIYATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            MKSILTTAKLSRANAAHKCFRGTGLDDKICPQIIPVQQPKYVY+ECKKDVYEDFPYIKPEKSIADDSGKCQFNPPTVNKYVHFADGHQDDECTQVIKQE+EIENSNEVLDKYRLLTPENYACLPVIEKVIVPDKKECEDLEGLRTSDIYATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKH+PNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI
Sbjct:    1 MKSILTTAKLSRANAAHKCFRGTGLDDKICPQIIPVQQPKYVYDECKKDVYEDFPYIKPEKSIADDSGKCQFNPPTVNKYVHFADGHQDDECTQVIKQEAEIENSNEVLDKYRLLTPENYACLPVIEKVIVPDKKECEDLEGLRTSDIYATENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHRPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 221          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000032075.1 (SMESG000032075.1)

HSP 1 Score: 56.9954 bits (136), Expect = 5.930e-10
Identity = 24/47 (51.06%), Postives = 36/47 (76.60%), Query Frame = 2
Query:  911 LYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            +Y+TTN EYG+  PN+HTMP +++ +++ F+KRYG  G  KD+S NI
Sbjct:   83 MYRTTNHEYGRIPPNIHTMPVIFRSRNNFFTKRYGPSGNYKDNSMNI 129          
BLAST of Zinc finger HIT domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000032075.1 (SMESG000032075.1)

HSP 1 Score: 56.9954 bits (136), Expect = 6.173e-10
Identity = 24/47 (51.06%), Postives = 36/47 (76.60%), Query Frame = 2
Query:  911 LYQTTNSEYGKHKPNVHTMPTVYKRQDHGFSKRYGRYGPPKDHSFNI 1051
            +Y+TTN EYG+  PN+HTMP +++ +++ F+KRYG  G  KD+S NI
Sbjct:   80 MYRTTNHEYGRIPPNIHTMPVIFRSRNNFFTKRYGPSGNYKDNSMNI 126          
The following BLAST results are available for this feature:
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C9orf1164.403e-832.04chromosome 9 open reading frame 116 [Source:HGNC S... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-248e11.23.795e-1243.75si:ch211-248e11.2 [Source:NCBI gene;Acc:557793][more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000032208.18.593e-633.70chromosome unknown C9orf116 homolog [Source:NCBI g... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
1700007K13Rik1.110e-1139.24RIKEN cDNA 1700007K13 gene [Source:MGI Symbol;Acc:... [more]
1700007K13Rik5.749e-848.08RIKEN cDNA 1700007K13 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5X5D0|CI116_SALSA7.426e-1438.24UPF0691 protein C9orf116 homolog OS=Salmo salar OX... [more]
sp|B0UXH9|CI116_DANRE2.865e-1143.75UPF0691 protein C9orf116 homolog OS=Danio rerio OX... [more]
sp|Q5BN45|CI116_MOUSE7.762e-1139.24UPF0691 protein C9orf116 homolog OS=Mus musculus O... [more]
sp|Q32P67|CI116_BOVIN1.617e-836.71UPF0691 protein C9orf116 homolog OS=Bos taurus OX=... [more]
sp|Q5BN46|CI116_HUMAN2.115e-732.04UPF0691 protein C9orf116 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S0U18.053e-1648.78Zinc finger HIT domain-containing protein 1 OS=Fas... [more]
A0A504YUW42.379e-1548.78Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A2H1CB172.678e-1548.78Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
K1Q7P71.466e-1445.57Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A210PYP41.904e-1343.21Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-248e11.21.437e-1348.10chromosome 6 C9orf116 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425531.354e-1438.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000043692.15.211e-1245.00chromosome 9 C9orf116 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Zinc finger HIT domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032541.17.082e-16398.64SMESG000032541.1[more]
SMESG000032075.15.930e-1051.06SMESG000032075.1[more]
SMESG000032075.16.173e-1051.06SMESG000032075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033762 ID=SMED30033762|Name=Zinc finger HIT domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1148bp
CGCTGCAAACAATTATTTGTGACGTGTCGGAAAGTGCTAAAAGCAATTAA
CTGAAATTTGTGTTTGTTGAAATTTCAGTTAAACATTTTATTTTAATGCA
ATCTTATAAAAGATAAGTTTTATAGCTGTTAAAGGTGAAAGTAAGCCAAT
TTAGTGCCCAGGCAGCATTGCATATTAATGCTGGATAATTGGCTGCAACA
TGTGACATTGTCACGGAAAGGATGTTTTTATAAAATATTATAGAATTGAT
AAATATGTTATGTTCTTGCTTGTGAACTTCATTACTAATTATTAACCAAT
CAAAATGATGCCGATAAATCCTCCAATTACGCTAAAGCTATCAACTTACA
CAAATCCCATATTTGAATTGATTTATTATTGAATATCGATGAAATCCATT
TTGACTACTGCTAAGCTGAGCAGAGCTAATGCTGCTCATAAATGCTTCAG
AGGAACTGGATTAGATGACAAAATTTGTCCTCAGATCATTCCAGTGCAGC
AGCCTAAATATGTATATAACGAATGCAAGAAAGATGTCTATGAGGATTTC
CCATATATCAAGCCAGAGAAATCGATTGCGGATGACAGCGGGAAATGTCA
ATTCAACCCCCCAACAGTCAATAAGTACGTCCATTTTGCTGATGGACATC
AGGACGACGAATGTACGCAAGTAATAAAACAAGAATCAGAAATCGAAAAC
TCGAATGAAGTGCTAGACAAATATCGGTTGCTAACTCCAGAAAATTATGC
CTGCCTTCCGGTAATTGAGAAGGTTATTGTTCCTGACAAAAAGGAATGTG
AAGACCTTGAAGGATTAAGAACGTCAGACATTTATGCCACAGAAAATTTG
CCATTAAGATTTGAATATCCCGACTGTGTCACGGGCTACGGAAACAAAGA
GAAGCATTTGTTGTATCAGACGACCAATTCAGAATATGGCAAACACAAAC
CAAATGTCCACACCATGCCGACCGTTTACAAAAGACAAGATCACGGATTT
TCGAAAAGATATGGCAGATATGGGCCCCCCAAAGATCATTCGTTTAATAT
CTGACCAAGAACAATGTATGAATCAAGATGGACTTATTGTATTCAATTTG
ATTAAAATTAGCCTGATTGTGAAGAAATAGATGTTAATAATTTGGATG
back to top

protein sequence of SMED30033762-orf-1

>SMED30033762-orf-1 ID=SMED30033762-orf-1|Name=SMED30033762-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=222bp
MKSILTTAKLSRANAAHKCFRGTGLDDKICPQIIPVQQPKYVYNECKKDV
YEDFPYIKPEKSIADDSGKCQFNPPTVNKYVHFADGHQDDECTQVIKQES
EIENSNEVLDKYRLLTPENYACLPVIEKVIVPDKKECEDLEGLRTSDIYA
TENLPLRFEYPDCVTGYGNKEKHLLYQTTNSEYGKHKPNVHTMPTVYKRQ
DHGFSKRYGRYGPPKDHSFNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR026507UPF0691
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026507Uncharacterised protein family UPF0691PFAMPF14892DUF4490coord: 141..221
e-value: 3.0E-21
score: 75.4
IPR026507Uncharacterised protein family UPF0691PANTHERPTHR20899UNCHARACTERIZEDcoord: 142..221