forkhead box J1-like protein 1

Overview
Nameforkhead box J1-like protein 1 (AFX62228.1)
Smed IDSMED30033757
Length (bp)1675
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of forkhead box J1-like protein 1 (SMED30033757) t-SNE clustered cells

Violin plots show distribution of expression levels for forkhead box J1-like protein 1 (SMED30033757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of forkhead box J1-like protein 1 (SMED30033757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for forkhead box J1-like protein 1 (SMED30033757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033757SMESG000072183.1 dd_Smed_v4_14635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033757SMESG000072183.1 dd_Smed_v6_14635_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal stripeSMED30033757SMESG000072183.1 JX842843.1smed_ncbi_20200123PMID:23144623
Vij et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30033757SMESG000072183.1 dd_Smed_v4_14635_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of forkhead box J1-like protein 1 vs. Ensembl Human
Match: FOXJ1 (forkhead box J1 [Source:HGNC Symbol;Acc:HGNC:3816])

HSP 1 Score: 137.502 bits (345), Expect = 9.123e-35
Identity = 81/212 (38.21%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  340 SEQCGNESGF------DDSLTNLNWLHN----------VNPMKINEQMSHVHVG--YPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSH 921
            +E+ G E G       DDSLT+L WL            + P   +    H   G   P   L ++       HT      + T + +     P + A     D  DY  NP++KP +++A LI  AM+     KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR KDEPGKGGFWR++P   + L     K +  P  H
Sbjct:   14 AEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAP----PGLQAP--PPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVH 219          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 107.457 bits (267), Expect = 1.164e-24
Identity = 45/91 (49.45%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   65 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 155          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 100.523 bits (249), Expect = 1.524e-24
Identity = 45/87 (51.72%), Postives = 64/87 (73.56%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGF 846
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGK GF
Sbjct:   22 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKVGF 108          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 107.457 bits (267), Expect = 5.723e-24
Identity = 48/97 (49.48%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKE 876
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++  N KE
Sbjct:   65 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID-TNPKE 160          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 107.457 bits (267), Expect = 7.085e-24
Identity = 45/91 (49.45%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   65 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 155          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 91.6633 bits (226), Expect = 1.957e-20
Identity = 45/107 (42.06%), Postives = 68/107 (63.55%), Query Frame = 1
Query:  610 NNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKE--LDHNLSKIKYNPSSHS 924
            ++PN KP F++  LI  A+K+  + ++TL+ IY +I  N+ +YR +   WQNS+RHNLS+NK F KVPR  D+PGKG +W ++     E  +     K++  PSS S
Sbjct:   88 SSPNDKPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRRPSSLS 194          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 82.4185 bits (202), Expect = 1.236e-16
Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRM 855
            KP +++  LI+ A+++    ++TLS+IY WI D F YY+ +   WQNS+RH+LS N  F KV R  D+PGKG FW +
Sbjct:  141 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 217          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 83.1889 bits (204), Expect = 1.320e-16
Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRM 855
            KP +++  LI+ A+++    ++TLS+IY WI D F YY+ +   WQNS+RH+LS N  F KV R  D+PGKG FW +
Sbjct:  236 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 312          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 82.8037 bits (203), Expect = 1.323e-16
Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRM 855
            KP +++  LI+ A+++    ++TLS+IY WI D F YY+ +   WQNS+RH+LS N  F KV R  D+PGKG FW +
Sbjct:  172 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 248          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 77.0258 bits (188), Expect = 3.005e-16
Identity = 38/90 (42.22%), Postives = 57/90 (63.33%), Query Frame = 1
Query:  661 AMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKE--LDHNLSKIKYNPSSHS 924
            A+K+  + ++TL+ IY +I  N+ +YR +   WQNS+RHNLS+NK F KVPR  D+PGKG +W ++     E  +     K++  PSS S
Sbjct:    3 AIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRRPSSLS 92          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Fly
Match: fd19B (gene:FBgn0031086 transcript:FBtr0070032)

HSP 1 Score: 96.2857 bits (238), Expect = 4.819e-22
Identity = 41/81 (50.62%), Postives = 57/81 (70.37%), Query Frame = 1
Query:  619 NLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            N KP FT++ LI  A+    + ++TLS I  WI+DNF YYR   S WQNS+RHNLS+N +F +VPR  D+PG+G +W ++P
Sbjct:   56 NAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDP 136          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300783)

HSP 1 Score: 98.5969 bits (244), Expect = 2.807e-21
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 1
Query:  613 NPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRY-SDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPD-NIKELDHNLSK 897
            N N KP +++A LI  A+      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLS+N+YF KV R +DEPGKG FWR++PD   K +DH+  K
Sbjct:  449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKK 545          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300784)

HSP 1 Score: 98.5969 bits (244), Expect = 2.807e-21
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 1
Query:  613 NPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRY-SDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPD-NIKELDHNLSK 897
            N N KP +++A LI  A+      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLS+N+YF KV R +DEPGKG FWR++PD   K +DH+  K
Sbjct:  449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKK 545          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300786)

HSP 1 Score: 98.5969 bits (244), Expect = 2.807e-21
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 1
Query:  613 NPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRY-SDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPD-NIKELDHNLSK 897
            N N KP +++A LI  A+      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLS+N+YF KV R +DEPGKG FWR++PD   K +DH+  K
Sbjct:  449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKK 545          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300785)

HSP 1 Score: 98.5969 bits (244), Expect = 2.807e-21
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 1
Query:  613 NPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRY-SDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPD-NIKELDHNLSK 897
            N N KP +++A LI  A+      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLS+N+YF KV R +DEPGKG FWR++PD   K +DH+  K
Sbjct:  449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKK 545          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 146.747 bits (369), Expect = 5.829e-38
Identity = 107/336 (31.85%), Postives = 159/336 (47.32%), Query Frame = 1
Query:  367 FDDSLTNLNWLH-----NVNPMKINEQMSHVHV---GYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL------DHNLSKIKYNPSSHSIIPIKTEKLPIIS--------SYRQMTSYPPTVSTNSN-----------SNHINTFTIQEHSRPIISNHNAVKRPRK--SPVITIPE-----------NWDALECLKETDTKQVNNIKINENNHF---PQYEELLL 1227
             DDSLT+L WL      N +  +     SH H+     P   L  +        T      AS  +       P + A     D+ DYK+NP++KP +++A LI  AM+   K KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L         L  ++ NP+    + +  +   +IS        S + +  +    S + N           S  I+     +  +P   NH   K PR+  SP++ + E           +WDAL      D+     + +NE +     PQ EEL++
Sbjct:   48 LDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRLPPVQINPALQHRLRMNAQATGVISRNLSVSPESQQLLKDFEEATSADQNWDPRLAEATMLSCWISGKGTNKRKQPY--NHRTGKTPRRSSSPLLVMDEQEDLSSLRGNFDWDAL-----LDSALNGELSLNEGSPLSPTPQDEELMI 376          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 146.747 bits (369), Expect = 5.829e-38
Identity = 107/336 (31.85%), Postives = 159/336 (47.32%), Query Frame = 1
Query:  367 FDDSLTNLNWLH-----NVNPMKINEQMSHVHV---GYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL------DHNLSKIKYNPSSHSIIPIKTEKLPIIS--------SYRQMTSYPPTVSTNSN-----------SNHINTFTIQEHSRPIISNHNAVKRPRK--SPVITIPE-----------NWDALECLKETDTKQVNNIKINENNHF---PQYEELLL 1227
             DDSLT+L WL      N +  +     SH H+     P   L  +        T      AS  +       P + A     D+ DYK+NP++KP +++A LI  AM+   K KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L         L  ++ NP+    + +  +   +IS        S + +  +    S + N           S  I+     +  +P   NH   K PR+  SP++ + E           +WDAL      D+     + +NE +     PQ EEL++
Sbjct:   48 LDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRLPPVQINPALQHRLRMNAQATGVISRNLSVSPESQQLLKDFEEATSADQNWDPRLAEATMLSCWISGKGTNKRKQPY--NHRTGKTPRRSSSPLLVMDEQEDLSSLRGNFDWDAL-----LDSALNGELSLNEGSPLSPTPQDEELMI 376          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 138.658 bits (348), Expect = 3.246e-35
Identity = 87/241 (36.10%), Postives = 124/241 (51.45%), Query Frame = 1
Query:  313 LANTFHKNW----SEQCGNESG---FDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQAST--------QQDSSAFTFPM------------------------ISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSS 918
            +AN F + W     E   N SG   FDDSLT+L+WL N + +  N            +R  S+   P+  H F ++NQ             D++A   P                         I+      ++ DYK N ++KP +++A LI  AM+   K KITLS IY WI++NF YYRY++ SWQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P       + + K +  P++
Sbjct:    9 IANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNFSILSANP-----------ERTPSSGCHPQ--HLFYYKNQLGGTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRRRMPAT 236          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 138.658 bits (348), Expect = 3.246e-35
Identity = 87/241 (36.10%), Postives = 124/241 (51.45%), Query Frame = 1
Query:  313 LANTFHKNW----SEQCGNESG---FDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQAST--------QQDSSAFTFPM------------------------ISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSS 918
            +AN F + W     E   N SG   FDDSLT+L+WL N + +  N            +R  S+   P+  H F ++NQ             D++A   P                         I+      ++ DYK N ++KP +++A LI  AM+   K KITLS IY WI++NF YYRY++ SWQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P       + + K +  P++
Sbjct:    9 IANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNFSILSANP-----------ERTPSSGCHPQ--HLFYYKNQLGGTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRRRMPAT 236          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 107.071 bits (266), Expect = 5.230e-24
Identity = 45/91 (49.45%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   49 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 139          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Xenopus
Match: prss2 (serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065254])

HSP 1 Score: 138.658 bits (348), Expect = 1.023e-35
Identity = 80/194 (41.24%), Postives = 108/194 (55.67%), Query Frame = 1
Query:  349 CGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFS---FDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSH 921
            C  E   DDSLTNL WL + + +  +   S  +   P  R       P    T + Q   + +Q S A      S    S     + DY+ N N+KP +++A LI  AM+   + K+TLS IY WI+ NF YYR++D SWQNS+RHNLS+NK F KVPR KDEPGKGGFW+M+P       + + K +  P+SH
Sbjct:   18 CSRE---DDSLTNLQWLQDFSILSTDLS-SIANSRPPLPRASQGPCSPPAGDTASCQAPRTGKQRSVAVPTAWASLPTPSPSPVQEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRMPASH 207          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Xenopus
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:496834])

HSP 1 Score: 137.117 bits (344), Expect = 3.454e-34
Identity = 78/191 (40.84%), Postives = 107/191 (56.02%), Query Frame = 1
Query:  367 FDDSLTNLNWLHNVNPMKIN--------EQMSHVHV-GYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNP 912
             DDSLT+L WL   + +  N        +   + H+ G P   L ++       HT      +ST + S     PM        +  DYK NP++KP +++A LI  AM+   K KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR KDEPGKGGFW+++P     L +   K +  P
Sbjct:   97 LDDSLTSLQWLQEFSILNANVGKAPSSGDSHGYKHLSGAPCSPLAADPACLGMPHTPGKPISSSTSRASHLGLQPM--------EDIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLMNGAMKKRRLP 279          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 106.686 bits (265), Expect = 1.054e-23
Identity = 44/91 (48.35%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YY+ + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   67 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 157          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 106.686 bits (265), Expect = 1.123e-23
Identity = 44/91 (48.35%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YY+ + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   50 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 140          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 106.301 bits (264), Expect = 1.308e-23
Identity = 44/91 (48.35%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YY+ + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   67 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 157          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Mouse
Match: Foxj1 (forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474])

HSP 1 Score: 136.732 bits (343), Expect = 1.116e-34
Identity = 81/212 (38.21%), Postives = 108/212 (50.94%), Query Frame = 1
Query:  340 SEQCGNESG------FDDSLTNLNWLH----------NVNPMKINEQMSHVHVGY--PRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSH 921
             E+ G E G       DDSLT+L WL            + P   +    H   G   P   L ++       HT      + T + +     P + A     D  DY  NP++KP +++A LI  AM+     KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR KDEPGKGGFWR++P   + L     K +  P  H
Sbjct:   14 GEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPHGYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAP----PGLQAP--PPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVH 219          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 101.293 bits (251), Expect = 3.900e-24
Identity = 57/178 (32.02%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  361 SGFDDSLTNLNWLHNVNPMKINEQM-SHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN--PDNIKELDH 885
            S  + SLT+++WL  +      E++ S    G P      +   P + +    +++A+  QD                           KP +++A LI++A+      K+TLS+IY WI DNF YY+ +   W+NS+RHNLS+NK F+KVPR +D+PGKG +W ++  PD  ++  H
Sbjct:    3 SDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDG--------------------------KPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRH 154          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 107.071 bits (266), Expect = 5.808e-24
Identity = 48/97 (49.48%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKE 876
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++  N KE
Sbjct:   65 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID-TNPKE 160          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 107.071 bits (266), Expect = 7.303e-24
Identity = 45/91 (49.45%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   65 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 155          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 95.9005 bits (237), Expect = 9.130e-23
Identity = 43/84 (51.19%), Postives = 62/84 (73.81%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGK 837
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGK
Sbjct:   65 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGK 148          
BLAST of forkhead box J1-like protein 1 vs. UniProt/SwissProt
Match: sp|F1QDF8|FXJ1A_DANRE (Forkhead box protein J1-A OS=Danio rerio OX=7955 GN=foxj1a PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 4.400e-37
Identity = 107/336 (31.85%), Postives = 159/336 (47.32%), Query Frame = 1
Query:  367 FDDSLTNLNWLH-----NVNPMKINEQMSHVHV---GYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL------DHNLSKIKYNPSSHSIIPIKTEKLPIIS--------SYRQMTSYPPTVSTNSN-----------SNHINTFTIQEHSRPIISNHNAVKRPRK--SPVITIPE-----------NWDALECLKETDTKQVNNIKINENNHF---PQYEELLL 1227
             DDSLT+L WL      N +  +     SH H+     P   L  +        T      AS  +       P + A     D+ DYK+NP++KP +++A LI  AM+   K KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L         L  ++ NP+    + +  +   +IS        S + +  +    S + N           S  I+     +  +P   NH   K PR+  SP++ + E           +WDAL      D+     + +NE +     PQ EEL++
Sbjct:   48 LDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRLPPVQINPALQHRLRMNAQATGVISRNLSVSPESQQLLKDFEEATSADQNWDPRLAEATMLSCWISGKGTNKRKQPY--NHRTGKTPRRSSSPLLVMDEQEDLSSLRGNFDWDAL-----LDSALNGELSLNEGSPLSPTPQDEELMI 376          
BLAST of forkhead box J1-like protein 1 vs. UniProt/SwissProt
Match: sp|Q66IG8|FXJ12_XENTR (Forkhead box protein J1.2 OS=Xenopus tropicalis OX=8364 GN=foxj1.2 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 5.421e-35
Identity = 80/194 (41.24%), Postives = 108/194 (55.67%), Query Frame = 1
Query:  349 CGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFS---FDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSH 921
            C  E   DDSLTNL WL + + +  +   S  +   P  R       P    T + Q   + +Q S A      S    S     + DY+ N N+KP +++A LI  AM+   + K+TLS IY WI+ NF YYR++D SWQNS+RHNLS+NK F KVPR KDEPGKGGFW+M+P       + + K +  P+SH
Sbjct:   18 CSRE---DDSLTNLQWLQDFSILSTDLS-SIANSRPPLPRASQGPCSPPAGDTASCQAPRTGKQRSVAVPTAWASLPTPSPSPVQEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRMPASH 207          
BLAST of forkhead box J1-like protein 1 vs. UniProt/SwissProt
Match: sp|Q32NH9|FXJ12_XENLA (Forkhead box protein J1.2 OS=Xenopus laevis OX=8355 GN=foxj1.2 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 8.387e-35
Identity = 78/188 (41.49%), Postives = 108/188 (57.45%), Query Frame = 1
Query:  370 DDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFT----FPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSH 921
            DDSLTNL WL + + +  +   S  +   P  R+      P    T + Q   + +Q  +  T     P +S       + DY+ N N+KP +++A LI  AM+   + K+TLS IY WI+ NF YYR++D SWQNS+RHNLS+NK F KVPR KDEPGKGGFW+M+P       + + K +  PSSH
Sbjct:   22 DDSLTNLQWLQDFSILSTDLS-SIANSRPPVPRVSQGPCSPPAGDTASCQAPRTGKQRVTVPTAWASLPTLSPS--PVQEVDYRTNANVKPPYSYATLICMAMEASQQRKLTLSAIYNWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRMPSSH 206          
BLAST of forkhead box J1-like protein 1 vs. UniProt/SwissProt
Match: sp|Q708W2|FXJ1A_XENLA (Forkhead box protein J1-A OS=Xenopus laevis OX=8355 GN=foxj1-a PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.178e-34
Identity = 84/205 (40.98%), Postives = 113/205 (55.12%), Query Frame = 1
Query:  343 EQCGNES-----GFDDSLTNLNWLHNVNPMKINEQM-------SHVH---VGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNP 912
            E+ G ES       DDSLT+L WL   + +  NE         SH +    G P   L ++       HT      +ST + S     PM        ++ DYK NP++KP +++A LI  AM+   K KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR KDEPGKGGFW+++P     L +   K +  P
Sbjct:   23 EEQGQESFSSSVNLDDSLTSLQWLQEFSILNSNEGKTPSSSGDSHGYRQLSGAPCSPLAADPACLGMPHTPGKPISSSTSRASHLGLQPM--------EEIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYNWITDNFCYFRHADPTWQNSIRHNLSLNKCFMKVPREKDEPGKGGFWKIDPQYADRLINGAMKKRRLP 219          
BLAST of forkhead box J1-like protein 1 vs. UniProt/SwissProt
Match: sp|Q63247|FOXJ1_RAT (Forkhead box protein J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.675e-34
Identity = 82/215 (38.14%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  340 SEQCGNESG------FDDSLTNLNWLH---------------NVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSH 921
             E+ G E G       DDSLT+L WL                  +P+  ++    V  G P     +   QP   HT      + T + +     P + A     D  DY  NP++KP +++A LI  AM+     KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR KDEPGKGGFWR++P   + L     K +  P  H
Sbjct:   14 GEEAGPEGGMEEPDALDDSLTSLQWLQEFSILNAKAPTLPPGGTDPLGYHQVPGLVAPGSPLAADPACLGQP---HTPGKPTSSCTSRSAP----PGLQAP--PPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVH 219          
BLAST of forkhead box J1-like protein 1 vs. TrEMBL
Match: K7X3Q0 (Forkhead box J1-like protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 452/456 (99.12%), Postives = 454/456 (99.56%), Query Frame = 1
Query:  127 MLQHCLSYGERTREELEQNVYSKYQCPDXXXXXXXXXXXXXXXXXXXINRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINTFTIQEHSRPIISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNNIKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPYFSQCPPNSNEISLSNFENDSLGDILASPMLLDGEEIMDNEDFKSMVYQTEYDLFPTSKDDLQE 1494
            MLQH LSYGERTREELEQNVYSKYQCPDRRSSASSTTSTGSNESNRSINRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINTFTIQEHSRP+ISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNNIKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPY SQCPPNSNEISLSNFE+DSLGDILASPMLLDGEEIMDNEDFKSMVYQTEYDLFPTSKDDLQE
Sbjct:    1 MLQHYLSYGERTREELEQNVYSKYQCPDRRSSASSTTSTGSNESNRSINRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINTFTIQEHSRPMISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNNIKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPYLSQCPPNSNEISLSNFEDDSLGDILASPMLLDGEEIMDNEDFKSMVYQTEYDLFPTSKDDLQE 456          
BLAST of forkhead box J1-like protein 1 vs. TrEMBL
Match: K7XGV5 (Forkhead box J1-like protein 4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.258e-44
Identity = 112/274 (40.88%), Postives = 155/274 (56.57%), Query Frame = 1
Query:  289 FSQMSCQILANTFHKNWSEQCGNESG-FDDSLTNLNWLHNV-----------NPMKINEQMSHV---HVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISA--DQFSFD---KPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIK-----YN-PSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINT 1032
            F+     +LA  F KNW ++ G +S   DDSLTNLNWLHNV           +P+ +  Q +H    ++  P + +++N++     +       ++    + +FT  + SA  D    D   + DYK N + KP F++A LI  +M+EL K KITLSDIYGWI+DNF YYR SDSSWQNSVRHNLS+NK F+KVPR KDE GKGGFWR+NP     L+ NL K +     YN P   + +P  +  L   ++Y  M       + N+ SN + T
Sbjct:   45 FNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTT 318          
BLAST of forkhead box J1-like protein 1 vs. TrEMBL
Match: A0A4Z2DWG2 (Forkhead box protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_002042 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.475e-43
Identity = 94/212 (44.34%), Postives = 130/212 (61.32%), Query Frame = 1
Query:  268 INRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIK 903
            I    + F   S ++LA    KNW ++  +    DDSLT+L WL++ NP+ IN + +    G    +L S  Y       ++ Q+   +Q  + +   P I        + +Y+     KP F++A LI  AM+ELGKPK+TLSDIYGWI +NFAYYR++DSSWQNSVRHNLS+NK F+KVPR K E GKGGFWR+NP +I  L+ NL+K +
Sbjct:    5 IYAHSFEFYGNSLKLLAEKLRKNWMQKLSDSDQTDDSLTSLTWLYDANPISINLETAASLEGQ-EIKLCSALYD-----NYSKQSYVGSQPFTGSLLDPQI--------RLEYRTKWTGKPPFSYATLICLAMRELGKPKVTLSDIYGWIMNNFAYYRHTDSSWQNSVRHNLSLNKCFEKVPRDKGERGKGGFWRVNPRHIDWLEANLAKCR 202          
BLAST of forkhead box J1-like protein 1 vs. TrEMBL
Match: A0A430QJ11 (Fork-head domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0002449 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 2.973e-43
Identity = 91/212 (42.92%), Postives = 130/212 (61.32%), Query Frame = 1
Query:  268 INRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIK 903
            I+ Q +     + ++LA    KNW ++  N    DDSLT+L WL++ NP+ +N + +    G   +  +S       Y  +N  + +  Q  + +   P +        + +Y+     KP F++A LI  AM+ELGKPK+TLSDIYGWI +NFAYYR++DSSWQNSVRHNLS+NK F+KVPR K E GKGGFWR+NP +I  L+ NL+K +
Sbjct:    5 IHPQSFDLYGKNLKLLAEKLRKNWMQKLSNSDQTDDSLTSLTWLYDANPVSMNPEATAHFEGKEFNVCLSL------YDNYNRYSCSGNQPITGSLLDPQV--------RLEYRTKWTGKPPFSYATLICLAMRELGKPKVTLSDIYGWIMNNFAYYRHTDSSWQNSVRHNLSLNKCFEKVPRDKGERGKGGFWRVNPRHIDWLEANLAKCR 202          
BLAST of forkhead box J1-like protein 1 vs. TrEMBL
Match: A0A5K4F0F6 (FREAC-7-like protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.966e-43
Identity = 90/199 (45.23%), Postives = 123/199 (61.81%), Query Frame = 1
Query:  307 QILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIK 903
            ++LA    KNW ++  N    DDSLT+L WL++ NP+ +N + +    G   +   S       Y  +N  +    Q  + +   P I        + +Y+     KP F++A LI  AM+ELGKPK+TLSDIYGWI +NFAYYR++DSSWQNSVRHNLS+NK F+KVPR K E GKGGFWR+NP +I  L+ NL+K +
Sbjct:   18 KLLAEKLRKNWMQKLSNSDQTDDSLTSLTWLYDANPVSMNPEATAHFEGKEVNLCFSL------YDNYNRYSCGGNQPVTGSLLDPQI--------RLEYRTKWTGKPPFSYATLICLAMRELGKPKVTLSDIYGWIMNNFAYYRHTDSSWQNSVRHNLSLNKCFEKVPRDKGERGKGGFWRVNPRHIDWLEANLAKCR 202          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000049290.1 (forkhead box J1 [Source:NCBI gene;Acc:103028087])

HSP 1 Score: 139.813 bits (351), Expect = 1.280e-35
Identity = 85/234 (36.32%), Postives = 122/234 (52.14%), Query Frame = 1
Query:  349 CGNESGFDDSLTNLNWLHNVNPM------KINEQMSH--------VHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTN 1008
            C +    DDSLT+L WL   + +       ++    H        +    P   L  +        T      AS  +  S    P + A     D+ DYK NP++KP +++A LI  AM+   K KITLS IY WI+DNF Y+R++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L     K +  P      P++    P + ++ +M S  PTV T+
Sbjct:   41 CTSSDNLDDSLTSLQWLQEFSILNASGGQHVSTSSQHHSPFFGQQLGAEAPASPLAGDPASIGMPLTPGKPIAASFCRVPSLSALPSLVAHGHCPDEVDYKTNPHIKPPYSYATLICMAMQASKKSKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLSGAYKKRRTP------PVQIN--PALQNHLRMNSQ-PTVPTS 265          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 106.301 bits (264), Expect = 9.857e-24
Identity = 45/91 (49.45%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   49 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 139          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 105.916 bits (263), Expect = 1.000e-23
Identity = 45/91 (49.45%), Postives = 67/91 (73.63%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMN 858
            + D+ + + + + KP +++A LI++A+    K K+TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W ++
Sbjct:   59 TLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAID 149          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Cavefish
Match: foxk1 (forkhead box K1 [Source:NCBI gene;Acc:103029597])

HSP 1 Score: 100.523 bits (249), Expect = 6.254e-22
Identity = 42/85 (49.41%), Postives = 61/85 (71.76%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL 879
            KP +++A LI  A+      ++TLS IY  I+ ++ YYR +D  WQNS+RHNLS+N+YF KVPR ++EPGKG FWR++P +  +L
Sbjct:  257 KPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRVDPSSEAKL 341          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Cavefish
Match: foxk2 (forkhead box K2 [Source:ZFIN;Acc:ZDB-GENE-030131-2861])

HSP 1 Score: 99.3673 bits (246), Expect = 1.480e-21
Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL 879
            KP +++A LI  A+      ++TL+ IY  I+ N+ YYR +D  WQNS+RHNLS+N+YF KVPR ++EPGKG FWR++P    +L
Sbjct:  214 KPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPSTESKL 298          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 129.028 bits (323), Expect = 9.273e-33
Identity = 68/171 (39.77%), Postives = 96/171 (56.14%), Query Frame = 1
Query:  367 FDDSLTNLNWLHNVNPMKINEQMSHVHVG-----YPRDRLVSNSYQPRNYHTFNHQNQASTQ-QDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
             DDSLT+L WL   +    + +   V  G      P      ++   R       Q  A  + ++ +        A     D+ DY+ + ++KP +++A LI  AM+   K K+TL+ IY WI DNF YYR++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW M+P
Sbjct:    1 LDDSLTSLQWLQEFSIQGSSLRAPQVSPGGASGPAPCSPPAGDTAGARGTPACTPQRPACGRSREGTGEQQVGGRAASPVPDEVDYRTDASVKPPYSYATLICMAMRSTHKSKVTLASIYKWIMDNFCYYRHADPTWQNSIRHNLSLNKCFVKVPRQKDEPGKGGFWAMDP 171          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 124.02 bits (310), Expect = 5.882e-31
Identity = 79/220 (35.91%), Postives = 107/220 (48.64%), Query Frame = 1
Query:  298 MSCQILANTFHKNWS----EQCGNESG---FDDSLTNLNWLHNVN------PMKINEQMSH--------VHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFP-----------MISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            +S   +A+    NW     E   N++G    DDSLT+L WL N +      P    +Q                  D L   +  P           + T  D++  T P           M    Q    + DY+ N   KP +++A LI  AM+   K K+TL+ IY WI+DNF YYR++D  W+NS+RHNLS+NK F KVPR+KDEPGKGGFW +NP
Sbjct:    2 LSSPAIADRVKANWRLLHPEDRDNDAGAVTLDDSLTSLQWLQNFSIANADLPRPPGQQQGRSWAAAGGGAGAPGWGDLLGVGAGPP----------ASPTAGDTAGSTGPRTPGKPVSAAVMAQEQQQQQTEIDYRTNGAAKPPYSYATLICMAMQASKKSKVTLATIYKWITDNFCYYRHADPCWRNSIRHNLSLNKCFSKVPRQKDEPGKGGFWSINP 211          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 104.375 bits (259), Expect = 5.667e-24
Identity = 56/155 (36.13%), Postives = 86/155 (55.48%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISS-YRQMTSYPPTVSTNSNSNHINTF-TIQEHSRPIISNHNAV 1083
            KP +++A LI  A+      ++TLS IY +IS ++ YYR SD  WQNS+RHNLS+N+YF KVPR +++PGKG FWR++P +    +  L++  Y       +P       ++SS YR   S PP+ +   +   + T   +     P  + H  V
Sbjct:  199 KPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYRASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPAS----EGKLAEQAYRKRRARGVPCFRAPFGLLSSRYR---SAPPSPTHRGSLAGVETPDCLSREGSPTPAEHEGV 346          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 104.375 bits (259), Expect = 5.927e-24
Identity = 56/155 (36.13%), Postives = 86/155 (55.48%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISS-YRQMTSYPPTVSTNSNSNHINTF-TIQEHSRPIISNHNAV 1083
            KP +++A LI  A+      ++TLS IY +IS ++ YYR SD  WQNS+RHNLS+N+YF KVPR +++PGKG FWR++P +    +  L++  Y       +P       ++SS YR   S PP+ +   +   + T   +     P  + H  V
Sbjct:  199 KPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYRASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPAS----EGKLAEQAYRKRRARGVPCFRAPFGLLSSRYR---SAPPSPTHRGSLAGVETPDCLSREGSPTPAEHEGV 346          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 97.4413 bits (241), Expect = 3.165e-23
Identity = 42/85 (49.41%), Postives = 61/85 (71.76%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL 879
            KP +++A LI  A+      ++TLS IY  I+ ++ YYR +D  WQNS+RHNLS+N+YF KVPR ++EPGKG FWR++P +  +L
Sbjct:  127 KPPYSYAQLIVQAITSALDKQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFVKVPRSQEEPGKGSFWRIDPPSEGKL 211          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 102.449 bits (254), Expect = 2.530e-23
Identity = 44/81 (54.32%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  613 NPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRM 855
            N N+KP  ++A +I+ A+    +  I+L+DIY +IS N+AYYR++ S WQNS+RHNLS+NK F+KVPRR +EPGKG  WR+
Sbjct:  336 NRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRI 416          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 91.6633 bits (226), Expect = 3.779e-20
Identity = 44/103 (42.72%), Postives = 69/103 (66.99%), Query Frame = 1
Query:  622 LKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL-----DHNLSKIKYNPS 915
            +KP  ++A +I+ A+    +  I+L+DIY +ISDN+A+YR+S  +WQNSVRHNLS+NK F+KVP+R  + GKG  W+++ +  ++         LSKI+   S
Sbjct:  302 IKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRRGAS 404          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 81.6481 bits (200), Expect = 8.052e-17
Identity = 38/79 (48.10%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            KP +++A LI  A+ +  + K+TLS IY WI  +F YY+  D+SWQNS+RHNLS+N  F K  +  D  GKG FW + P
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRP 185          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 72.0182 bits (175), Expect = 1.375e-13
Identity = 34/92 (36.96%), Postives = 56/92 (60.87%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPK-ITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSK 897
            KPT +++ +++  +++    K ++LS+IY  I + F YY+Y    WQ+SVRHNLS+NK F+KV +     GKG  W ++ + I E +    K
Sbjct:  461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLDEEYIAERERQKKK 548          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Nematostella
Match: EDO44876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL7])

HSP 1 Score: 116.316 bits (290), Expect = 2.069e-31
Identity = 49/79 (62.03%), Postives = 64/79 (81.01%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            KP +++A LI  AM++  + KITLS IY WI +NF +YR +D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFWR++P
Sbjct:    1 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFVKVPRKKDEPGKGGFWRIDP 79          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Nematostella
Match: EDO36951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH30])

HSP 1 Score: 98.2117 bits (243), Expect = 9.096e-25
Identity = 43/79 (54.43%), Postives = 58/79 (73.42%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            KP +++A LI  A+      ++TLS IY  I+ N+ YYR +D  WQNS+RHNLS+N+YF KVPR +DEPGKG FWR++P
Sbjct:    4 KPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTADKGWQNSIRHNLSLNRYFVKVPRAQDEPGKGSFWRIDP 82          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 93.5893 bits (231), Expect = 3.359e-23
Identity = 41/79 (51.90%), Postives = 57/79 (72.15%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            KP +++  LIS A+K+    KITLS IY +I +NF YYR +   WQNS+RHNLS+NK F K+PR + +PGKG +W ++P
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDP 81          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Nematostella
Match: EDO46828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP00])

HSP 1 Score: 88.9669 bits (219), Expect = 1.575e-21
Identity = 40/79 (50.63%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  625 KPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
            KP F++  LI  A++   + ++TLS IY +I  NF YYR +   WQNS+RHNLS+NK F KVPR  D+PGKG +W ++P
Sbjct:    2 KPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMKNFPYYRNNKQGWQNSIRHNLSLNKCFVKVPRNYDDPGKGNYWMLDP 80          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 95.5153 bits (236), Expect = 4.846e-21
Identity = 40/83 (48.19%), Postives = 59/83 (71.08%), Query Frame = 1
Query:  622 LKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNI 870
            +KP +++  LI+ A++   + +ITLS IY +I D F YYR +   WQNS+RHNLS+N+ F KVPR   +PGKG FW ++PD++
Sbjct:   78 VKPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLDPDSL 160          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 142.51 bits (358), Expect = 1.498e-36
Identity = 80/207 (38.65%), Postives = 118/207 (57.00%), Query Frame = 1
Query:  349 CGNESGFDDSLTNLNWLHNVNPMKIN-EQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTF----PMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL------DHNLSKIKYNPSSHSIIPI 936
            CG+++  DDSLT+L WL + + +  N  Q +H    +   +L  ++                T    +A ++    P + A   + D  DY+NN  +KP F++A LI  AM+   K KITLS IY WI+DNF YYR++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L         +  ++ NP+  S + I
Sbjct:   37 CGSDN-LDDSLTSLQWLQDFSILGANVPQHAHQQPHFFGQQLGLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVARGLTPDGADYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHLLSGSHKKRRMPPVQINPALQSRLHI 242          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 142.51 bits (358), Expect = 1.965e-36
Identity = 80/207 (38.65%), Postives = 118/207 (57.00%), Query Frame = 1
Query:  349 CGNESGFDDSLTNLNWLHNVNPMKIN-EQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTF----PMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL------DHNLSKIKYNPSSHSIIPI 936
            CG+++  DDSLT+L WL + + +  N  Q +H    +   +L  ++                T    +A ++    P + A   + D  DY+NN  +KP F++A LI  AM+   K KITLS IY WI+DNF YYR++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L         +  ++ NP+  S + I
Sbjct:   55 CGSDN-LDDSLTSLQWLQDFSILGANVPQHAHQQPHFFGQQLGLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVARGLTPDGADYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHLLSGSHKKRRMPPVQINPALQSRLHI 260          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Medaka
Match: foxj1b (forkhead box protein J1-B [Source:NCBI gene;Acc:101165351])

HSP 1 Score: 132.494 bits (332), Expect = 4.022e-33
Identity = 78/192 (40.62%), Postives = 108/192 (56.25%), Query Frame = 1
Query:  367 FDDSLTNLNWLHN-----VNPMKIN-------EQMSHV----HVGYPRDRLVSNSYQPRNYHTFNHQ-----NQASTQQDSSA------FTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNP 861
             DDSLT+L+WL N      +P + N           H+     +G+ R    S S  P              +  ++  DSSA         P I A   +  + DYK NP +KP +++A LI  AM+   +PK+TLS IY WI+ NF YYR+++ SWQNS+RHNLS+NK F+KVPR+KDEPGKGGFW+++P
Sbjct:   32 LDDSLTSLHWLQNFSILSADPERPNGAGPGCPSSQQHLCMMKRLGFQRAGTDSPSSPPAGDTAAAGMPLYPGSPVTSGSDSSASPRYPSCAHPQIQASPSA--EVDYKTNPKVKPPYSYASLICMAMQASKQPKVTLSTIYNWITQNFCYYRHAEPSWQNSIRHNLSLNKCFKKVPRQKDEPGKGGFWQIDP 221          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 101.679 bits (252), Expect = 2.153e-24
Identity = 50/111 (45.05%), Postives = 74/111 (66.67%), Query Frame = 1
Query:  586 SFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSS 918
            + D+ +   + + KP +++A LI++A+    + ++TLS+IY WI DNF YYR + S W+NS+RHNLS+NK F KVPR KD+PGKG +W +  DN  + D   S+ K  P S
Sbjct:   63 TLDQEEAAQHRDGKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI--DNNPKEDTLPSRPKKRPRS 171          
BLAST of forkhead box J1-like protein 1 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 106.301 bits (264), Expect = 2.606e-24
Identity = 68/210 (32.38%), Postives = 104/210 (49.52%), Query Frame = 1
Query:  340 SEQCGNESGFDDSLTNLNWLHNVNPMKIN-EQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTF----PMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKEL------DHNLSKIKYNPSSHSIIPI 936
            S  CG+++  DDSLT+L WL + + +  N  Q +H    +   +L  ++                T    +A ++    P + A   + D  DY+NN  +KP F++A LI                       NF YYR++D +WQNS+RHNLS+NK F KVPR+KDEPGKGGFW+++P   + L         +  ++ NP+  S + I
Sbjct:   31 SSWCGSDN-LDDSLTSLQWLQDFSILGANVPQHAHQQPHFFGQQLGLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVARGLTPDGADYRNNARVKPPFSYATLIY----------------------NFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHLLSGSHKKRRMPPVQINPALQSRLHI 217          
BLAST of forkhead box J1-like protein 1 vs. Planmine SMEST
Match: SMESG000072183.1 (SMESG000072183.1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 394/394 (100.00%), Postives = 394/394 (100.00%), Query Frame = 1
Query:  127 MLQHCLSYGERTREELEQNVYSKYQCPDXXXXXXXXXXXXXXXXXXXINRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINTFTIQEHSRPIISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNNIKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPYF 1308
            MLQHCLSYGERTREELEQNVYSKYQCPDRRSSASSTTSTGSNESNRSINRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINTFTIQEHSRPIISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNNIKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPYF
Sbjct:    1 MLQHCLSYGERTREELEQNVYSKYQCPDRRSSASSTTSTGSNESNRSINRQKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINTFTIQEHSRPIISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNNIKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPYF 394          

HSP 2 Score: 155.606 bits (392), Expect = 2.897e-41
Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 2
Query: 1313 SVRQIVMRFLSAISRMTVSVIFLLVQCFSMEKRSWTTKISSPWSTKPNMTYFQPQKMIYKNSTHCWAYINYET 1531
            SVRQIVMRFLSAISRMTVSVIFLLVQCFSMEKRSWTTKISSPWSTKPNMTYFQPQKMIYKNSTHCWAYINYET
Sbjct:  396 SVRQIVMRFLSAISRMTVSVIFLLVQCFSMEKRSWTTKISSPWSTKPNMTYFQPQKMIYKNSTHCWAYINYET 468          
BLAST of forkhead box J1-like protein 1 vs. Planmine SMEST
Match: SMESG000010030.1 (SMESG000010030.1)

HSP 1 Score: 174.096 bits (440), Expect = 1.462e-47
Identity = 112/274 (40.88%), Postives = 155/274 (56.57%), Query Frame = 1
Query:  289 FSQMSCQILANTFHKNWSEQCGNESG-FDDSLTNLNWLHNV-----------NPMKINEQMSHV---HVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISA--DQFSFD---KPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIK-----YN-PSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHINT 1032
            F+     +LA  F KNW ++ G +S   DDSLTNLNWLHNV           +P+ +  Q +H    ++  P + +++N++     +       ++    + +FT  + SA  D    D   + DYK N + KP F++A LI  +M+EL K KITLSDIYGWI+DNF YYR SDSSWQNSVRHNLS+NK F+KVPR KDE GKGGFWR+NP     L+ NL K +     YN P   + +P  +  L   ++Y  M       + N+ SN + T
Sbjct:   45 FNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTT 318          
BLAST of forkhead box J1-like protein 1 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 137.117 bits (344), Expect = 6.686e-35
Identity = 92/226 (40.71%), Postives = 129/226 (57.08%), Query Frame = 1
Query:  370 DDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFP----MISADQFSFD---KPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHI 1026
            D+SLT+LNWL+N++ + I+  +       P   L  N+      ++FN  N+  T   S    FP        ++  FD   + +YKN+   KP  ++  LI  AM +LGKPKI L++IY WI +NF YYR SDSSWQNSVRHNLS+ K F+KVPR+KDE GKGGFWR+NP+  + L +N  K +     ++  P      P++SS  Q     P+  T SN  H+
Sbjct:   55 DESLTSLNWLNNIS-IPISNTIPTNEEYLPSSTLSLNA------NSFN-SNKIQTYDKSVLQYFPSKLQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENLGNNFIKYRRQFHVYATPPPLPPSQPLVSSQPQ-----PSAQTQSNGYHL 267          
BLAST of forkhead box J1-like protein 1 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 137.117 bits (344), Expect = 8.725e-35
Identity = 92/226 (40.71%), Postives = 129/226 (57.08%), Query Frame = 1
Query:  370 DDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFP----MISADQFSFD---KPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHI 1026
            D+SLT+LNWL+N++ + I+  +       P   L  N+      ++FN  N+  T   S    FP        ++  FD   + +YKN+   KP  ++  LI  AM +LGKPKI L++IY WI +NF YYR SDSSWQNSVRHNLS+ K F+KVPR+KDE GKGGFWR+NP+  + L +N  K +     ++  P      P++SS  Q     P+  T SN  H+
Sbjct:   66 DESLTSLNWLNNIS-IPISNTIPTNEEYLPSSTLSLNA------NSFN-SNKIQTYDKSVLQYFPSKLQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENLGNNFIKYRRQFHVYATPPPLPPSQPLVSSQPQ-----PSAQTQSNGYHL 278          
BLAST of forkhead box J1-like protein 1 vs. Planmine SMEST
Match: SMESG000072873.1 (SMESG000072873.1)

HSP 1 Score: 115.546 bits (288), Expect = 6.409e-27
Identity = 78/200 (39.00%), Postives = 109/200 (54.50%), Query Frame = 1
Query:  310 ILANTFHKNWSEQCGN-------ESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFS-FDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDH 885
            +LA  F +NW  +  +       +   DDSLTNLNWL N+N  K+  Q        P   + ++S     Y     Q  AS   D S  +  + S DQ     +  YK +   +P F+   LI  A++++G+ +IT + I  WI  NF YY+  D+SWQNSVR+ LS++K FQKVPRRKDEP KGGFWR++ D  K L+ 
Sbjct:    8 VLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQ------ALPISPISASSMSCGKYVDL-RQPYAS---DPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLNQ 197          
The following BLAST results are available for this feature:
BLAST of forkhead box J1-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ19.123e-3538.21forkhead box J1 [Source:HGNC Symbol;Acc:HGNC:3816][more]
FOXJ31.164e-2449.45forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ31.524e-2451.72forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ35.723e-2449.48forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ37.085e-2449.45forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-21.957e-2042.06ForKHead transcription factor family [Source:UniP... [more]
pha-41.236e-1646.75Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.320e-1646.75Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.323e-1646.75Defective pharyngeal development protein 4 [Sourc... [more]
fkh-23.005e-1642.22ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd19B4.819e-2250.62gene:FBgn0031086 transcript:FBtr0070032[more]
FoxK2.807e-2148.45gene:FBgn0036134 transcript:FBtr0300783[more]
FoxK2.807e-2148.45gene:FBgn0036134 transcript:FBtr0300784[more]
FoxK2.807e-2148.45gene:FBgn0036134 transcript:FBtr0300786[more]
FoxK2.807e-2148.45gene:FBgn0036134 transcript:FBtr0300785[more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1a5.829e-3831.85forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1a5.829e-3831.85forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1b3.246e-3536.10forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b3.246e-3536.10forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj35.230e-2449.45forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss21.023e-3541.24serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065... [more]
foxj13.454e-3440.84forkhead box J1 [Source:NCBI gene;Acc:496834][more]
ndel11.054e-2348.35nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.123e-2348.35nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.308e-2348.35nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj11.116e-3438.21forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474... [more]
Foxj23.900e-2432.02forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj35.808e-2449.48forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj37.303e-2449.45forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj39.130e-2351.19forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1QDF8|FXJ1A_DANRE4.400e-3731.85Forkhead box protein J1-A OS=Danio rerio OX=7955 G... [more]
sp|Q66IG8|FXJ12_XENTR5.421e-3541.24Forkhead box protein J1.2 OS=Xenopus tropicalis OX... [more]
sp|Q32NH9|FXJ12_XENLA8.387e-3541.49Forkhead box protein J1.2 OS=Xenopus laevis OX=835... [more]
sp|Q708W2|FXJ1A_XENLA1.178e-3440.98Forkhead box protein J1-A OS=Xenopus laevis OX=835... [more]
sp|Q63247|FOXJ1_RAT1.675e-3438.14Forkhead box protein J1 OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7X3Q00.000e+099.12Forkhead box J1-like protein 1 OS=Schmidtea medite... [more]
K7XGV55.258e-4440.88Forkhead box J1-like protein 4 OS=Schmidtea medite... [more]
A0A4Z2DWG21.475e-4344.34Forkhead box protein isoform 1 OS=Schistosoma japo... [more]
A0A430QJ112.973e-4342.92Fork-head domain-containing protein OS=Schistosoma... [more]
A0A5K4F0F64.966e-4345.23FREAC-7-like protein OS=Schistosoma mansoni OX=618... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049290.11.280e-3536.32forkhead box J1 [Source:NCBI gene;Acc:103028087][more]
foxj39.857e-2449.45forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj31.000e-2349.45forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxk16.254e-2249.41forkhead box K1 [Source:NCBI gene;Acc:103029597][more]
foxk21.480e-2149.41forkhead box K2 [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b9.273e-3339.77forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b5.882e-3135.91forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxk15.667e-2436.13forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxk15.927e-2436.13forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxk13.165e-2349.41forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH22.530e-2354.32Forkhead family transcription factor; rate-limitin... [more]
FKH13.779e-2042.72Forkhead family transcription factor; rate-limitin... [more]
HCM18.052e-1748.10Forkhead transcription factor; drives S-phase acti... [more]
FHL11.375e-1336.96Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448762.069e-3162.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369519.096e-2554.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426543.359e-2351.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468281.575e-2150.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339004.846e-2148.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj11.498e-3638.65forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj11.965e-3638.65forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj1b4.022e-3340.63forkhead box protein J1-B [Source:NCBI gene;Acc:10... [more]
ENSORLT00000031716.12.153e-2445.05forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
foxj12.606e-2432.38forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
back to top
BLAST of forkhead box J1-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072183.12.897e-41100.00SMESG000072183.1[more]
SMESG000010030.11.462e-4740.88SMESG000010030.1[more]
SMESG000067319.16.686e-3540.71SMESG000067319.1[more]
SMESG000067319.18.725e-3540.71SMESG000067319.1[more]
SMESG000072873.16.409e-2739.00SMESG000072873.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033757
GenBankAFX62228.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033757 ID=SMED30033757|Name=forkhead box J1-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1675bp
ATGCAAAAATTTTTAGCGTTATTTTCTTGAATTTGAATATTTATAAAAAA
ACGCATTCCACAGAATCTGCATAATTTATTTCTAGCTCGGCAAATTTTTT
TTTTCTGAAAGATTCCAACTGAATTCATGTTGCAGCACTGTCTCAGTTAT
GGTGAACGCACTAGAGAGGAATTGGAACAAAATGTCTACAGCAAGTATCA
ATGTCCTGATCGTCGATCCTCAGCGTCCTCGACCACTTCAACAGGATCCA
ATGAATCCAATAGAAGCATTAATCGACAAAAGTATTCCTTTTCGCAAATG
AGTTGCCAGATCTTGGCGAATACTTTTCATAAGAATTGGTCAGAACAATG
TGGAAATGAGTCCGGGTTTGATGATTCTCTCACCAATCTCAACTGGCTTC
ATAATGTGAATCCAATGAAGATTAATGAGCAAATGTCCCATGTTCACGTT
GGATATCCGAGAGACCGGCTGGTGTCGAACAGCTACCAACCAAGGAACTA
TCACACATTTAACCATCAGAATCAGGCATCCACTCAACAGGATTCCTCTG
CATTCACGTTTCCAATGATTTCTGCCGATCAGTTTTCATTTGACAAACCT
GATTATAAAAATAATCCAAACTTGAAGCCAACATTTACTTTTGCTGTTTT
GATTTCGTGGGCCATGAAAGAACTCGGGAAACCGAAAATCACTTTGTCGG
ACATTTACGGATGGATATCGGACAATTTTGCATACTACCGCTACTCAGAT
TCTAGTTGGCAGAATTCAGTTCGCCATAACCTATCGATGAATAAATATTT
TCAAAAGGTTCCAAGAAGAAAAGATGAACCTGGAAAGGGTGGATTTTGGC
GAATGAATCCAGATAATATCAAAGAATTGGATCACAATTTATCAAAGATC
AAATATAACCCTTCGAGTCATTCAATCATTCCTATCAAAACGGAGAAACT
GCCAATCATTTCCAGTTATCGACAAATGACCAGCTACCCCCCTACAGTGT
CTACCAACAGCAATAGCAACCATATAAATACCTTCACTATCCAAGAGCAC
TCGCGACCAATTATTAGCAATCACAATGCAGTCAAACGACCTAGAAAGTC
TCCAGTAATAACTATTCCAGAAAACTGGGATGCATTGGAATGTTTAAAGG
AGACGGACACAAAACAAGTAAACAACATCAAAATCAATGAAAACAATCAT
TTCCCTCAGTATGAAGAACTATTGTTATTTGATGGCCCTTCTGCTTACAA
AAATGATCTTGACTTCTCTTCGATGGATAATTCATCTACTGATTCATTTC
CATATTTTTCTCAGTGTCCGCCAAATAGTAATGAGATTTCTCTCAGCAAT
TTCGAGAATGACAGTCTCGGTGATATTCTTGCTAGTCCAATGCTTCTCGA
TGGAGAAGAGATCATGGACAACGAAGATTTCAAGTCCATGGTCTACCAAA
CCGAATATGACTTATTTCCAACCTCAAAAGATGATCTACAAGAACTCAAC
ACATTGTTGGGCATATATTAATTATGAAACATAATAGAATTATTGTATAT
AATGAGATATTATATGATATTTAGGGTTATAATATTTTTTATCACCATAT
TTTCACCGTATAATGGTGATTTTGGATCAGTGTATTATCCGTGTTTTGAT
GATCTGGATCTGTGATATTTGCAAT
back to top

protein sequence of SMED30033757-orf-1

>SMED30033757-orf-1 ID=SMED30033757-orf-1|Name=SMED30033757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MLQHCLSYGERTREELEQNVYSKYQCPDRRSSASSTTSTGSNESNRSINR
QKYSFSQMSCQILANTFHKNWSEQCGNESGFDDSLTNLNWLHNVNPMKIN
EQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISA
DQFSFDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDN
FAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKE
LDHNLSKIKYNPSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHI
NTFTIQEHSRPIISNHNAVKRPRKSPVITIPENWDALECLKETDTKQVNN
IKINENNHFPQYEELLLFDGPSAYKNDLDFSSMDNSSTDSFPYFSQCPPN
SNEISLSNFENDSLGDILASPMLLDGEEIMDNEDFKSMVYQTEYDLFPTS
KDDLQELNTLLGIY*
back to top
Aliases
The feature 'forkhead box J1-like protein 1' has the following synonyms
Synonym
foxJ1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000055dorsal stripe
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 211..228
score: 67.68
coord: 188..205
score: 51.06
coord: 167..180
score: 34.58
IPR001766Fork head domainSMARTSM00339forkneu4coord: 165..255
e-value: 3.0E-31
score: 119.8
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 167..250
e-value: 5.5E-30
score: 103.5
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 167..262
score: 28.512
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 155..260
e-value: 2.6E-33
score: 116.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..46
NoneNo IPR availablePANTHERPTHR45881FAMILY NOT NAMEDcoord: 78..322
NoneNo IPR availablePANTHERPTHR45881:SF2coord: 78..322
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 211..217
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 166..254