Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30033752
Length (bp)1445
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase (SMED30033752) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30033752) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30033752) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30033752) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033752

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30033752h1SMcG0004252 Contig597GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033752h1SMcG0013616 Contig597GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: CSK (C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC:2444])

HSP 1 Score: 351.288 bits (900), Expect = 1.902e-116
Identity = 174/377 (46.15%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRI+Y    + +IDEE YF +L +LVE Y SDA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP+F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: CSK (C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC:2444])

HSP 1 Score: 351.288 bits (900), Expect = 1.902e-116
Identity = 174/377 (46.15%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRI+Y    + +IDEE YF +L +LVE Y SDA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP+F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: CSK (C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC:2444])

HSP 1 Score: 351.288 bits (900), Expect = 1.902e-116
Identity = 174/377 (46.15%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRI+Y    + +IDEE YF +L +LVE Y SDA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP+F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: MATK (megakaryocyte-associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6906])

HSP 1 Score: 304.294 bits (778), Expect = 6.286e-98
Identity = 152/381 (39.90%), Postives = 235/381 (61.68%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILS 1200
            L  M W+HG I+ + A Q L P E+GLFL+RES  +PGD+ LCV +   V HYR+++ +    TIDE  +F +L ++VE Y  D   + T L +P  K G            +AGW+     L L   +G+G+F  V +  Y G+ +A K +    D+T    + E +VMT ++H+NLV+  G+++    +Y++ E++  G+LVN+LRTRG++ +     L FS++VA GM YLE K LVHRDLA RNIL+ +++VAK++DFGL +         R+P+KWTAPEA+K+ +F+  SD+WSFGV+LWE++S+G+ PY  +S++ V   +E+G+R+  P+ CP  ++ LM + W   PA RP F++  + L   L S  +  S
Sbjct:   76 LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLH-RDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTK---SAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNI--KCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQG-LYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS 449          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: MATK (megakaryocyte-associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6906])

HSP 1 Score: 303.908 bits (777), Expect = 2.823e-97
Identity = 152/381 (39.90%), Postives = 235/381 (61.68%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILS 1200
            L  M W+HG I+ + A Q L P E+GLFL+RES  +PGD+ LCV +   V HYR+++ +    TIDE  +F +L ++VE Y  D   + T L +P  K G            +AGW+     L L   +G+G+F  V +  Y G+ +A K +    D+T    + E +VMT ++H+NLV+  G+++    +Y++ E++  G+LVN+LRTRG++ +     L FS++VA GM YLE K LVHRDLA RNIL+ +++VAK++DFGL +         R+P+KWTAPEA+K+ +F+  SD+WSFGV+LWE++S+G+ PY  +S++ V   +E+G+R+  P+ CP  ++ LM + W   PA RP F++  + L   L S  +  S
Sbjct:  118 LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLH-RDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTK---SAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNI--KCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQG-LYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS 491          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 324.709 bits (831), Expect = 2.069e-105
Identity = 158/388 (40.72%), Postives = 239/388 (61.60%), Query Frame = 1
Query:   76 WYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPL---------------PKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGI-KEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYE---LGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            W+H  I+RE  E+LL  + +G FL+RES N+PGDFTLC+ +   V+HYRI      + T D+EEYFS+L +LV  Y  DA+GL   L  P+                 S           F+ AG V   + +D+ + +G G+F +V    YK + +A K   +  +     +  EA  M  + H NLV   G+V+D   +Y++TEYM NG+L++ LR+RG+  +     +MF++++  GM YLE K +VHRDLA RN+LLD ++VAK++DFGL ++ +S       G+ PIKWTAPEA++++QF+  SD+WSFG++LWEI+SFG++PY  I +Q V+  IE+G+R+  P+ CPPEI+ +M+  W ++   RP+F Q  + LTTI N+
Sbjct:  151 WFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTIRNT 538          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 324.709 bits (831), Expect = 2.069e-105
Identity = 158/388 (40.72%), Postives = 239/388 (61.60%), Query Frame = 1
Query:   76 WYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPL---------------PKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGI-KEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYE---LGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            W+H  I+RE  E+LL  + +G FL+RES N+PGDFTLC+ +   V+HYRI      + T D+EEYFS+L +LV  Y  DA+GL   L  P+                 S           F+ AG V   + +D+ + +G G+F +V    YK + +A K   +  +     +  EA  M  + H NLV   G+V+D   +Y++TEYM NG+L++ LR+RG+  +     +MF++++  GM YLE K +VHRDLA RN+LLD ++VAK++DFGL ++ +S       G+ PIKWTAPEA++++QF+  SD+WSFG++LWEI+SFG++PY  I +Q V+  IE+G+R+  P+ CPPEI+ +M+  W ++   RP+F Q  + LTTI N+
Sbjct:  151 WFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTIRNT 538          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 325.094 bits (832), Expect = 1.356e-104
Identity = 158/388 (40.72%), Postives = 239/388 (61.60%), Query Frame = 1
Query:   76 WYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPL---------------PKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGI-KEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYE---LGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            W+H  I+RE  E+LL  + +G FL+RES N+PGDFTLC+ +   V+HYRI      + T D+EEYFS+L +LV  Y  DA+GL   L  P+                 S           F+ AG V   + +D+ + +G G+F +V    YK + +A K   +  +     +  EA  M  + H NLV   G+V+D   +Y++TEYM NG+L++ LR+RG+  +     +MF++++  GM YLE K +VHRDLA RN+LLD ++VAK++DFGL ++ +S       G+ PIKWTAPEA++++QF+  SD+WSFG++LWEI+SFG++PY  I +Q V+  IE+G+R+  P+ CPPEI+ +M+  W ++   RP+F Q  + LTTI N+
Sbjct:  236 WFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTIRNT 623          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 325.094 bits (832), Expect = 1.356e-104
Identity = 158/388 (40.72%), Postives = 239/388 (61.60%), Query Frame = 1
Query:   76 WYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPL---------------PKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGI-KEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYE---LGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            W+H  I+RE  E+LL  + +G FL+RES N+PGDFTLC+ +   V+HYRI      + T D+EEYFS+L +LV  Y  DA+GL   L  P+                 S           F+ AG V   + +D+ + +G G+F +V    YK + +A K   +  +     +  EA  M  + H NLV   G+V+D   +Y++TEYM NG+L++ LR+RG+  +     +MF++++  GM YLE K +VHRDLA RN+LLD ++VAK++DFGL ++ +S       G+ PIKWTAPEA++++QF+  SD+WSFG++LWEI+SFG++PY  I +Q V+  IE+G+R+  P+ CPPEI+ +M+  W ++   RP+F Q  + LTTI N+
Sbjct:  236 WFHSMISRENTEKLLRGKPDGTFLVRESTNFPGDFTLCMSFHGKVEHYRIEQTSGGQLTCDKEEYFSNLTQLVSHYKRDADGLCHRLVTPIICETATFSSNGSSSFGSSSTVDLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDVRLGTYKNRKVALKVSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTIRNT 623          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 259.61 bits (662), Expect = 4.371e-76
Identity = 143/384 (37.24%), Postives = 212/384 (55.21%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKS----GLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGK--ILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR--ETDSY--ELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            L    WYHG I+R  +E +L     G FL+RES    G +T+ V +   V HYRI  D  ++  I +E  F +L ELV  +   A+GL+  L  P  K     GL    P         W   R  + +   LG G + +V++ ++K     +A K + + +      + EA++M  + H+NLV+  G+       Y++TE+M NG+L+ YLR   KS + PI  +  +  +A GMSYLE +  +HRDLA RN L+ ++ + KIADFGL R  + D+Y    G + PIKWTAPE +  N FS  SD+W+FGV+LWEI ++G  PY G+ + +V   +E GFR+  PQ CPP +Y LM   W  +P+ RP F+  H  L  +++S
Sbjct:  174 LDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEKMFITQEVKFRTLGELVHHHSVHADGLICLLMYPASKKDKGRGLFSLSPNA----PDEWELDRSEIIMHNKLGGGQYGDVYEGYWKRHDCTIAVKALKEDAMPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILVQMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKEDTYTAHAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENLISS 553          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300549)

HSP 1 Score: 390.578 bits (1002), Expect = 1.379e-128
Identity = 193/384 (50.26%), Postives = 264/384 (68.75%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG-GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNS 1191
            ++ EV L +M W+HG ITR+ AE LL PRE+GLFL+RES N+PGD+TLCVC+Q  V+HYR+ Y  + + TID+EEYF +L +LV  Y +DA+GL T L K LPK G   +      F   GWV P   L L E +GKG+F +V     + + +A K +++        + EASVMTT+ H NLV+F GLV  S  +YL+TEYM  GSLV+YLR+RG+  IT  +Q++F+ + A GM YLE K +VHRDLA RN+L+ ++ VAK++DFGL RE + Y L  G++PIKWTAPEA+KN +FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E G+++  P+ CPPEIY +M  AW +NPA RP F +  KV   +LN+  +
Sbjct:  344 SRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKY-LENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNEKVAVK-MLKDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLARE-ECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL-KVKLQLLNNATA 723          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300547)

HSP 1 Score: 390.578 bits (1002), Expect = 1.379e-128
Identity = 193/384 (50.26%), Postives = 264/384 (68.75%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG-GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNS 1191
            ++ EV L +M W+HG ITR+ AE LL PRE+GLFL+RES N+PGD+TLCVC+Q  V+HYR+ Y  + + TID+EEYF +L +LV  Y +DA+GL T L K LPK G   +      F   GWV P   L L E +GKG+F +V     + + +A K +++        + EASVMTT+ H NLV+F GLV  S  +YL+TEYM  GSLV+YLR+RG+  IT  +Q++F+ + A GM YLE K +VHRDLA RN+L+ ++ VAK++DFGL RE + Y L  G++PIKWTAPEA+KN +FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E G+++  P+ CPPEIY +M  AW +NPA RP F +  KV   +LN+  +
Sbjct:  344 SRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKY-LENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNEKVAVK-MLKDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLARE-ECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL-KVKLQLLNNATA 723          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300548)

HSP 1 Score: 390.578 bits (1002), Expect = 1.379e-128
Identity = 193/384 (50.26%), Postives = 264/384 (68.75%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG-GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNS 1191
            ++ EV L +M W+HG ITR+ AE LL PRE+GLFL+RES N+PGD+TLCVC+Q  V+HYR+ Y  + + TID+EEYF +L +LV  Y +DA+GL T L K LPK G   +      F   GWV P   L L E +GKG+F +V     + + +A K +++        + EASVMTT+ H NLV+F GLV  S  +YL+TEYM  GSLV+YLR+RG+  IT  +Q++F+ + A GM YLE K +VHRDLA RN+L+ ++ VAK++DFGL RE + Y L  G++PIKWTAPEA+KN +FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E G+++  P+ CPPEIY +M  AW +NPA RP F +  KV   +LN+  +
Sbjct:  344 SRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKY-LENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNEKVAVK-MLKDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLARE-ECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL-KVKLQLLNNATA 723          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0299728)

HSP 1 Score: 390.578 bits (1002), Expect = 1.379e-128
Identity = 193/384 (50.26%), Postives = 264/384 (68.75%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG-GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNS 1191
            ++ EV L +M W+HG ITR+ AE LL PRE+GLFL+RES N+PGD+TLCVC+Q  V+HYR+ Y  + + TID+EEYF +L +LV  Y +DA+GL T L K LPK G   +      F   GWV P   L L E +GKG+F +V     + + +A K +++        + EASVMTT+ H NLV+F GLV  S  +YL+TEYM  GSLV+YLR+RG+  IT  +Q++F+ + A GM YLE K +VHRDLA RN+L+ ++ VAK++DFGL RE + Y L  G++PIKWTAPEA+KN +FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E G+++  P+ CPPEIY +M  AW +NPA RP F +  KV   +LN+  +
Sbjct:  344 SRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKY-LENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNEKVAVK-MLKDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLARE-ECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL-KVKLQLLNNATA 723          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300546)

HSP 1 Score: 391.734 bits (1005), Expect = 4.558e-128
Identity = 193/384 (50.26%), Postives = 264/384 (68.75%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG-GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNS 1191
            ++ EV L +M W+HG ITR+ AE LL PRE+GLFL+RES N+PGD+TLCVC+Q  V+HYR+ Y  + + TID+EEYF +L +LV  Y +DA+GL T L K LPK G   +      F   GWV P   L L E +GKG+F +V     + + +A K +++        + EASVMTT+ H NLV+F GLV  S  +YL+TEYM  GSLV+YLR+RG+  IT  +Q++F+ + A GM YLE K +VHRDLA RN+L+ ++ VAK++DFGL RE + Y L  G++PIKWTAPEA+KN +FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E G+++  P+ CPPEIY +M  AW +NPA RP F +  KV   +LN+  +
Sbjct:  426 SRCEVKLNAMPWFHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQSKVEHYRVKY-LENKLTIDDEEYFENLGQLVAHYEADADGLCTQLIKCLPKLGKQEFCINSKDFVDKGWVIPEAELQLRESIGKGEFGDVMLGILRNEKVAVK-MLKDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLARE-ECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAEL-KVKLQLLNNATA 805          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: csk (C-terminal Src kinase [Source:ZFIN;Acc:ZDB-GENE-061103-493])

HSP 1 Score: 355.14 bits (910), Expect = 3.512e-118
Identity = 169/381 (44.36%), Postives = 248/381 (65.09%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSD-KIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSK 1185
            KS   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRIIY    + +IDEEEYF +L +L+E Y  DA+GL T L KP    G          F ++GW   R  L L + +GKG+F +V    Y+GK +A KC+   +      + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG++ I     + FS++V   M YLE  + VHRDLA RN+L+ ++ +AK++DFGL +E  S +   ++P+KWT+PEA++  +FS  SD+WS+G++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++   RP+F+   + L  I+ ++
Sbjct:   72 KSASKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIIY-HNGKLSIDEEEYFENLMQLMEHYTKDADGLCTRLIKPKIMEGTV---AAQDEFSRSGWALNRKELKLIQTIGKGEFGDVMVGDYRGKKVAVKCIKHDATAQAF-VAEASVMTQLRHNNLVQLLGVIVEEKGSLYIVTEYMAKGSLVDYLRSRGRTVIGGDRLINFSMDVCKAMEYLEANNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASSTQDTAKLPVKWTSPEALREKKFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDSPDGCPPVVYDIMKQCWTLDAVVRPSFRDLREKLQDIITNE 447          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070705-183])

HSP 1 Score: 315.849 bits (808), Expect = 5.753e-103
Identity = 154/368 (41.85%), Postives = 233/368 (63.32%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVL 1164
            L  M W+HG I  + A   L P E+GLFL+RESV +PGDF LCVC+   V HYR+IY +  + TID  ++F +L +++EFY  +   + T L KP  K GL      +    ++GW+     L L E +G+G+F  VF   Y G+ +A K +I+        ++E SVMT + H+NLV   G+++  + ++++TE M  G+LVN+LR+RG+  ++ I  L F+++V  GM +LE K L+HRDLA RNIL+ ++ VAKI+DFGL R         ++P+KWTAPEA+KN +FS  SD+WS+GV+LWEI+S+G+ PY  ++V  V   +E+G+R+  P  CP ++YS+M + W   P  RP+F +  + L
Sbjct:   75 LSLMPWFHGKIAGQQAVDKLKPTEDGLFLVRESVRHPGDFVLCVCFSQKVFHYRVIY-QDNKLTIDNMQFFDNLIDMIEFYSRNRGAIATLLLKPKKKEGLKSAETKL---LKSGWLLDLSKLTLGEIIGEGEFGAVFAGEYTGQRVAVK-IIKCDVTAQAFLEETSVMTNLHHKNLVPLLGVIL-HNGLHIVTELMTKGNLVNFLRSRGRFAVSVIQLLRFALDVCEGMEHLESKKLLHRDLAGRNILVSEDGVAKISDFGLARVGSMAVDNSKLPVKWTAPEALKNKKFSTQSDVWSYGVLLWEIFSYGRQPYPKMTVNEVKECVEKGYRMDPPDECPADVYSIMTSCWQTEPKKRPSFHKLRERL 436          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070705-183])

HSP 1 Score: 315.464 bits (807), Expect = 7.826e-103
Identity = 154/368 (41.85%), Postives = 233/368 (63.32%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVL 1164
            L  M W+HG I  + A   L P E+GLFL+RESV +PGDF LCVC+   V HYR+IY +  + TID  ++F +L +++EFY  +   + T L KP  K GL      +    ++GW+     L L E +G+G+F  VF   Y G+ +A K +I+        ++E SVMT + H+NLV   G+++  + ++++TE M  G+LVN+LR+RG+  ++ I  L F+++V  GM +LE K L+HRDLA RNIL+ ++ VAKI+DFGL R         ++P+KWTAPEA+KN +FS  SD+WS+GV+LWEI+S+G+ PY  ++V  V   +E+G+R+  P  CP ++YS+M + W   P  RP+F +  + L
Sbjct:   72 LSLMPWFHGKIAGQQAVDKLKPTEDGLFLVRESVRHPGDFVLCVCFSQKVFHYRVIY-QDNKLTIDNMQFFDNLIDMIEFYSRNRGAIATLLLKPKKKEGLKSAETKL---LKSGWLLDLSKLTLGEIIGEGEFGAVFAGEYTGQRVAVK-IIKCDVTAQAFLEETSVMTNLHHKNLVPLLGVIL-HNGLHIVTELMTKGNLVNFLRSRGRFAVSVIQLLRFALDVCEGMEHLESKKLLHRDLAGRNILVSEDGVAKISDFGLARVGSMAVDNSKLPVKWTAPEALKNKKFSTQSDVWSYGVLLWEIFSYGRQPYPKMTVNEVKECVEKGYRMDPPDECPADVYSIMTSCWQTEPKKRPSFHKLRERL 433          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: abl2 (c-abl oncogene 2, non-receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-020809-2])

HSP 1 Score: 280.026 bits (715), Expect = 2.460e-87
Identity = 151/395 (38.23%), Postives = 219/395 (55.44%), Query Frame = 1
Query:   22 SKYMLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG--IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR----ETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKN 1188
            S Y+   N  E H     WYHGP++R  AE LL     G FL+RES + PG  ++ + Y+  V HYRI      +  +  E  FS+L ELV  + + A+GLVT L  P PK   P    V     +  W   R  + ++  LG G + EV+   +K   L         D   V   +KEASVM  V+H NLVQ  G+       Y++TEYM +G+L++YLR   +  +  +  L  +  ++  M YLE+K+ +HRDLA RN L+ +N V K+ADFGL R    +T +   G + PIKWTAPE++  N FS  SD+W+FGV+LWEI ++G  PY GI +  V   +E+G+R+  P+ CPP++Y LM A W  +P  RP+F + H+   T+ +  +
Sbjct:  117 SNYITPVNSLEKH----SWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTASDGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDK--WEMERTDITMKHKLGGGQYGEVYVGVWKKYNLTVAVKTLKEDTMEVEEFLKEASVMKEVKHPNLVQLLGVCTLEPPFYIVTEYMPHGNLLDYLRECERDQVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWQWSPLDRPSFAEIHQAFETMFHDSS 505          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: abl2 (c-abl oncogene 2, non-receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-020809-2])

HSP 1 Score: 278.1 bits (710), Expect = 9.843e-83
Identity = 151/392 (38.52%), Postives = 218/392 (55.61%), Query Frame = 1
Query:   22 SKYMLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG--IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR----ETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILN 1179
            S Y+   N  E H     WYHGP++R  AE LL     G FL+RES + PG  ++ + Y+  V HYRI      +  +  E  FS+L ELV  + + A+GLVT L  P PK   P    V     +  W   R  + ++  LG G + EV+   +K   L         D   V   +KEASVM  V+H NLVQ  G+       Y++TEYM +G+L++YLR   +  +  +  L  +  ++  M YLE+K+ +HRDLA RN L+ +N V K+ADFGL R    +T +   G + PIKWTAPE++  N FS  SD+W+FGV+LWEI ++G  PY GI +  V   +E+G+R+  P+ CPP++Y LM A W  +P  RP+F + H+   T+ +
Sbjct:  117 SNYITPVNSLEKH----SWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTASDGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDK--WEMERTDITMKHKLGGGQYGEVYVGVWKKYNLTVAVKTLKEDTMEVEEFLKEASVMKEVKHPNLVQLLGVCTLEPPFYIVTEYMPHGNLLDYLRECERDQVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWQWSPLDRPSFAEIHQAFETMFH 502          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 351.288 bits (900), Expect = 5.473e-117
Identity = 170/377 (45.09%), Postives = 247/377 (65.52%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVI-DSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRIIY    + +IDEEEYF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L   +GKG+F +V    ++G  +A KC I++       + EA VMT ++H NLVQ  G+++ D   ++++TE+M  GSLV+YLR+RG+S +     L FS++V+ GM+YLE  + VHRDLA RN+L+ +  +AK++DFGL +E  + +   ++P+KWTAPEA+++  FS  SD+WSFG++LWEIYSFG++PY  I+++ V+ ++E G+++  P  CPP +Y LM   W ++P  RP F+   + L  I
Sbjct:   34 KSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSG-KLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTV---AAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKC-IKNDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTKEASAIQDTSKLPVKWTAPEALRDKLFSTKSDVWSFGILLWEIYSFGRVPYPRIALKDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHI 405          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 350.517 bits (898), Expect = 3.985e-116
Identity = 170/377 (45.09%), Postives = 247/377 (65.52%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVI-DSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRIIY    + +IDEEEYF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L   +GKG+F +V    ++G  +A KC I++       + EA VMT ++H NLVQ  G+++ D   ++++TE+M  GSLV+YLR+RG+S +     L FS++V+ GM+YLE  + VHRDLA RN+L+ +  +AK++DFGL +E  + +   ++P+KWTAPEA+++  FS  SD+WSFG++LWEIYSFG++PY  I+++ V+ ++E G+++  P  CPP +Y LM   W ++P  RP F+   + L  I
Sbjct:   78 KSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSG-KLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTV---AAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKC-IKNDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTKEASAIQDTSKLPVKWTAPEALRDKLFSTKSDVWSFGILLWEIYSFGRVPYPRIALKDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHI 449          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: csk (C-terminal Src kinase [Source:NCBI gene;Acc:100216174])

HSP 1 Score: 346.665 bits (888), Expect = 1.006e-114
Identity = 170/379 (44.85%), Postives = 247/379 (65.17%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVI-DSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQ--FSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRIIY    + +IDEEEYF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L   +GKG+F +V    ++G  +A KC I++       + EA VMT ++H NLVQ  G+++ D   ++++TE+M  GSLV+YLR+RG+S +     L FS++V+ GM+YLE  + VHRDLA RN+L+ +  +AK++DFGL +E  + +   ++P+KWTAPEA+++    FS  SD+WSFG++LWEIYSFG++PY  I+++ V+ ++E G+++  P  CPP +Y LM   W ++P  RP F+   + L  I
Sbjct:   72 KSGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSSG-KLSIDEEEYFENLMQLVEHYTNDADGLCTNLMKPKLVEGTV---AAQDEFSRSGWALKMRDLKLLHTIGKGEFGDVMLGEHQGVKVAVKC-IKNDATAQAFVAEAMVMTQLQHNNLVQLLGVIVEDKSGLFIVTEFMAKGSLVDYLRSRGRSVLGGECLLKFSLDVSEGMAYLESNNFVHRDLAARNVLVSEENIAKVSDFGLTKEASAIQDTSKLPVKWTAPEALRDKASLFSTKSDVWSFGILLWEIYSFGRVPYPRIALKDVVPKVENGYKMDAPDGCPPVVYDLMKQCWHLDPKQRPTFRNLREQLEHI 445          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: gpn2 (GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751862])

HSP 1 Score: 323.939 bits (829), Expect = 4.546e-106
Identity = 161/378 (42.59%), Postives = 242/378 (64.02%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTIL 1176
            K +  L  M W+HG IT   A Q L P+E GLFL+RESV +PGD+ LCVC++D V HYRI  ++  +  ID  + F++L +++E+Y +    L T L KP  K G+           +AGW+     L L + +G+G+F +V +  Y G+ +A K +    D+T    + E + MT ++H+NLV   G+++  + + L+ E M  G+LVNYLR+RG+S + P   L+FS+++  GM YLE K LVHRDLA RNIL+ +   AKI+DFGL +     +   R+PIKWTAPEA++N +FS  SD+WSFGV+LWE+YS+G+ PY  +SV+ V+  +++G+R+  P+NCPP IYS+M + W  +P  RP FK+  + L T++
Sbjct:   64 KVDAKLSVMPWFHGAITGVQAVQQLQPKENGLFLVRESVRHPGDYVLCVCFKDEVTHYRI-SNQGGKLNIDLTQNFNNLMDMIEYYSAHQGVLTTRLIKPKCKQGMI---SAEQKLAKAGWLLNFQNLTLGKKIGEGEFGDVLQGEYMGRPVAIKNI--KCDMTAQNFLSETATMTKLQHKNLVNLLGVIL-KNGLLLVMELMSKGNLVNYLRSRGRSMVPPYQLLIFSMDIVQGMEYLELKRLVHRDLAARNILVSEKGEAKISDFGLSKPQLQQDDLSRLPIKWTAPEALQNYKFSSRSDVWSFGVLLWEVYSYGRAPYPKMSVREVIEAVKKGYRMEAPENCPPMIYSIMKSCWEADPGKRPTFKKLKEKLETMM 434          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: gpn2 (GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751862])

HSP 1 Score: 322.013 bits (824), Expect = 7.618e-105
Identity = 164/397 (41.31%), Postives = 246/397 (61.96%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSRC*CEFLFSI 1233
            K +  L  M W+HG IT   A Q L P+E GLFL+RESV +PGD+ LCVC++D V HYRI  ++  +  ID  + F++L +++E+Y +    L T L KP  K G+           +AGW+     L L + +G+G+F +V +  Y G+ +A K +    D+T    + E + MT ++H+NLV   G+++  + + L+ E M  G+LVNYLR+RG+S + P   L+FS+++  GM YLE K LVHRDLA RNIL+ +   AKI+DFGL +     +   R+PIKWTAPEA++N +FS  SD+WSFGV+LWE+YS+G+ PY  +SV+ V+  +++G+R+  P+NCPP IYS+M + W  +P  RP FK+              ++S R    FLF++
Sbjct:   70 KVDAKLSVMPWFHGAITGVQAVQQLQPKENGLFLVRESVRHPGDYVLCVCFKDEVTHYRI-SNQGGKLNIDLTQNFNNLMDMIEYYSAHQGVLTTRLIKPKCKQGMI---SAEQKLAKAGWLLNFQNLTLGKKIGEGEFGDVLQGEYMGRPVAIKNI--KCDMTAQNFLSETATMTKLQHKNLVNLLGVIL-KNGLLLVMELMSKGNLVNYLRSRGRSMVPPYQLLIFSMDIVQGMEYLELKRLVHRDLAARNILVSEKGEAKISDFGLSKPQLQQDDLSRLPIKWTAPEALQNYKFSSRSDVWSFGVLLWEVYSYGRAPYPKMSVREVIEAVKKGYRMEAPENCPPMIYSIMKSCWEADPGKRPTFKK-------------QLMSPRATNPFLFTV 446          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Csk (c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:88537])

HSP 1 Score: 350.517 bits (898), Expect = 2.317e-116
Identity = 173/377 (45.89%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRI+Y    + +IDEE YF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Csk (c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:88537])

HSP 1 Score: 350.517 bits (898), Expect = 2.317e-116
Identity = 173/377 (45.89%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRI+Y    + +IDEE YF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Csk (c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:88537])

HSP 1 Score: 350.517 bits (898), Expect = 2.317e-116
Identity = 173/377 (45.89%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRI+Y    + +IDEE YF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Matk (megakaryocyte-associated tyrosine kinase [Source:MGI Symbol;Acc:MGI:99259])

HSP 1 Score: 304.679 bits (779), Expect = 2.755e-98
Identity = 153/375 (40.80%), Postives = 233/375 (62.13%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            L  M W+HG I+ + A Q L P E+GLFL+RES  +PGD+ LCV +   V HYR+++ +    TIDE   F +L ++VE Y  D   + T L KP  K G            +AGW+     L L   +G+G+F  V +  Y G+ +A K +    D+T    + E +VMT ++H+NLV+  G+++    +Y++ E++  G+LVN+LRTRG++ ++    L F+++VA GM YLE K LVHRDLA RNIL+ +++VAK++DFGL +         R+P+KWTAPEA+KN +FS  SD+WSFGV+LWE++S+G+ PY  +S++ V   +E+G+R+  P  CP  +++LM + W   PA RP F++  + L   L S
Sbjct:   75 LSLMPWFHGKISGQEAIQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLH-RDGHLTIDEAVCFCNLMDMVEHYTKDKGAICTKLVKPRRKQG---AKSAEEELAKAGWLLDLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNI--KCDVTAQAFLDETAVMTKLQHRNLVRLLGVILHHG-LYIVMEHVSKGNLVNFLRTRGRALVSTSQLLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPDGCPGSVHTLMGSCWEAEPARRPPFRKIVEKLGRELRS 442          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Matk (megakaryocyte-associated tyrosine kinase [Source:MGI Symbol;Acc:MGI:99259])

HSP 1 Score: 304.679 bits (779), Expect = 2.755e-98
Identity = 153/375 (40.80%), Postives = 233/375 (62.13%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            L  M W+HG I+ + A Q L P E+GLFL+RES  +PGD+ LCV +   V HYR+++ +    TIDE   F +L ++VE Y  D   + T L KP  K G            +AGW+     L L   +G+G+F  V +  Y G+ +A K +    D+T    + E +VMT ++H+NLV+  G+++    +Y++ E++  G+LVN+LRTRG++ ++    L F+++VA GM YLE K LVHRDLA RNIL+ +++VAK++DFGL +         R+P+KWTAPEA+KN +FS  SD+WSFGV+LWE++S+G+ PY  +S++ V   +E+G+R+  P  CP  +++LM + W   PA RP F++  + L   L S
Sbjct:   75 LSLMPWFHGKISGQEAIQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLH-RDGHLTIDEAVCFCNLMDMVEHYTKDKGAICTKLVKPRRKQG---AKSAEEELAKAGWLLDLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNI--KCDVTAQAFLDETAVMTKLQHRNLVRLLGVILHHG-LYIVMEHVSKGNLVNFLRTRGRALVSTSQLLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPDGCPGSVHTLMGSCWEAEPARRPPFRKIVEKLGRELRS 442          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P41239|CSK_CHICK (Tyrosine-protein kinase CSK OS=Gallus gallus OX=9031 GN=CSK PE=2 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 8.882e-118
Identity = 172/377 (45.62%), Postives = 248/377 (65.78%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+ + L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRIIY    + +IDEE YF +L +LVE Y +DA+GL + L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ +AK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CP  +Y +M   W ++P HRP+F Q  + L  I
Sbjct:   72 KAGIKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIIYSS-SKLSIDEEVYFENLMQLVEHYTTDADGLCSRLIKPKVMEGTV---AAQDEFSRSGWALNMKDLKLLQIIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKSGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEANNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDPPDGCPAIVYEVMKKCWTLDPGHRPSFHQLREQLVHI 443          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P41240|CSK_HUMAN (Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 9.133e-116
Identity = 174/377 (46.15%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRI+Y    + +IDEE YF +L +LVE Y SDA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP+F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P32577|CSK_RAT (Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 1.074e-115
Identity = 173/377 (45.89%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRI+Y    + +IDEE YF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYDVMKNCWHLDAATRPTFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P41241|CSK_MOUSE (Tyrosine-protein kinase CSK OS=Mus musculus OX=10090 GN=Csk PE=1 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 1.621e-115
Identity = 173/377 (45.89%), Postives = 246/377 (65.25%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV  +  V+HYRI+Y    + +IDEE YF +L +LVE Y +DA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTV---AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQLEHI 443          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q0VBZ0|CSK_BOVIN (Tyrosine-protein kinase CSK OS=Bos taurus OX=9913 GN=CSK PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 2.242e-115
Identity = 174/377 (46.15%), Postives = 245/377 (64.99%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK-IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            K+   L  M W+HG ITRE AE+LL P E GLFL+RES NYPGD+TLCV     V+HYRI+Y    + +IDEE YF +L +LVE Y SDA+GL T L KP    G          F ++GW      L L + +GKG+F +V    Y+G  +A KC I++       + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+ ++ VAK++DFGL +E  S +  G++P+KWTAPEA++  +FS  SD+WSFG++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y +M   W ++ A RP+F Q  + L  I
Sbjct:   72 KAGTKLSLMPWFHGKITREQAERLLCPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMY-HASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTV---AAQDEFFRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKC-IKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKSGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAATRPSFLQLREQLERI 443          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A443RF52 (Tyrosine-protein kinase OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_10615 PE=3 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 8.622e-135
Identity = 195/384 (50.78%), Postives = 264/384 (68.75%), Query Frame = 1
Query:   37 NTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEEC---LGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILN 1179
            N  ++EV L +M W+HG I RE AE LL PRE+GLFL+RES N+PGD+TLCVCY++ V+HYR+IY K  + TIDEEE+F +L +LVE Y  DA+GL T L   +PK G   +      F++AGWV P   LD  +C   LGKG+F +V  A Y+G+ +A K +I SS      + EAS+MT++RH+NLVQ  G+V D   I L+TEYM  GSLV+YLR+RG+  +TP +Q+ F+I+   GM+YLE K +VHRDLA RN+L+ +  VAK+ DFGL RE      GG+ PIKWTAPEA+K ++FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E+G+++  P  CP EIY +M  AW ++P  RP+F    K L + L 
Sbjct:   13 NFKRAEVKLNAMPWFHGKIRREEAECLLQPREDGLFLVRESTNFPGDYTLCVCYKNKVEHYRVIY-KDNKLTIDEEEFFENLSQLVEHYQKDADGLCTRLRDSVPKRGGLEFSVDSKAFEKAGWVIPLADLDFGDCREVLGKGEFGDVRLAWYRGQKVAVKILIDSSKAAQSFLAEASLMTSLRHKNLVQLMGVVFDGGTICLVTEYMAKGSLVDYLRSRGRLHVTPRDQINFAIDTCAGMAYLESKHVVHRDLAARNVLISEECVAKVCDFGLAREESFNLEGGKFPIKWTAPEALKYHRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLVDVVKHVEKGYKMEAPDGCPSEIYEIMRQAWDLDPEARPSFAVVLKKLESFLK 395          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A1E1XQP7 (Tyrosine-protein kinase OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 2.632e-132
Identity = 194/386 (50.26%), Postives = 271/386 (70.21%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHY-FQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR-ETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI-LNSKNSI 1194
            ++EV L SM W+HG I+RE AE LL PRE+GLFL+RES NYPGD+TLCVC++  V+HYR+IY +  + TIDEEEYF  L +L+E Y  DA+GL T L++ +PK G  +   + H  F+ AGW   +  L + E +GKG+F +V  A+YKG+ +A K + +S       I EAS+MT++RH NLVQ  GLVI+   + ++TEYM  GSLV+YLR+RG+  +T ++Q+ F+ +   GM+YLE K +VHRDLA RN+L+  + VAK++DFGL R E+D+ E GG+ PIKWTAPEA+K N+FS  SDMWSFG++LWEIYSFG++PY  I +  V+  + +G+R+  P+ CP E+Y LM AAW   P  RP F Q  + L  + L ++N+I
Sbjct:   62 RAEVKLNSMPWFHGKISRERAEMLLQPREDGLFLVRESTNYPGDYTLCVCFRSKVEHYRVIY-RLGKLTIDEEEYFEGLPQLIEHYEQDADGLCTRLSRSVPKQGGEV--AIDHRAFEMAGWAIKKQDLQVIENIGKGEFGDVLLANYKGQKVAVKKIKESGKNML--IAEASLMTSLRHPNLVQLLGLVIEESSLQIVTEYMAKGSLVDYLRSRGRLHVTRLDQINFATDTCAGMAYLESKHVVHRDLAARNVLISDDCVAKVSDFGLARDESDNLE-GGKFPIKWTAPEALKCNKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVRHVSKGYRMESPEGCPSEVYELMRAAWQEEPQERPTFAQVLRKLQGLRLEAQNAI 441          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: T1JDP9 (Tyrosine-protein kinase OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 3.361e-132
Identity = 185/380 (48.68%), Postives = 258/380 (67.89%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
             +SEV L +M W+HG I RE AE+LLHPR++GLFL+RES NYPGD+TLCVC+   V+HYR+IY K  + TIDEEE+F +L +LVE Y  DA+GL T L + +PK G   +      F+ AGWV  +  L L E +GKG+F +V   + +G+ +A K +  SS      + EASVMT++RH NLVQ  G+V D   +YL+TE+M  GSLV+YLR+RG+  +T  +Q+ F+ +    M+YLE K +VHRDLA RN+L+     AK++DFGL R+    + GG+ PIKWTAPEA+++++FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E+G+R+  P+ CPPE+Y +M  AW + P  RP F    K L  +  S
Sbjct:   49 KRSEVKLNAMPWFHGKIVRELAEELLHPRQDGLFLVRESTNYPGDYTLCVCFNQKVEHYRVIY-KDNKLTIDEEEFFENLTQLVEHYEKDADGLCTQLKRSVPKKGSLDFSVDSKAFEMAGWVINKSDLKLGEVIGKGEFGDVVLGNLRGQKVAVKTLKDSSKAAQQFLAEASVMTSLRHPNLVQMIGVVFDWPSVYLVTEFMGKGSLVDYLRSRGRLHVTKKDQINFACDTCAAMAYLESKKVVHRDLAARNVLISDEATAKVSDFGLARDESFNQEGGKFPIKWTAPEALRHSKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVQHVEKGYRMEAPEGCPPEVYEIMRKAWDLQPELRPTFSDVLKSLEHLRTS 427          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A087UEP1 (Tyrosine-protein kinase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_19905 PE=3 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 3.861e-132
Identity = 186/376 (49.47%), Postives = 260/376 (69.15%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            +SEV L +M W+HG ITR+ AE LL PRE+GLFL+RES N+PGD+TLCVC+++ V+HYR+IY K+ + TIDEEEYF +L  LVE Y +DA+GL T L   +PK G P +      F++AGW    D L L E LGKG+F +V    ++G+ +A K +  +S      + EASVMT++ H+NLVQ  G+V +   IY++TEYM  GSLV+YLR+RG+  +T  +Q+ F+ +   GM+YLE + +VHRDLA RN+L+    VAK+ DFGL RE      GG+ PIKWTAPEA+++++FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E+G+R+  P+ CP EIY +M  AW + P +RP F +  K L  +
Sbjct:   71 RSEVKLNAMPWFHGKITRDEAEALLQPREDGLFLVRESTNFPGDYTLCVCFKNKVEHYRVIY-KENKLTIDEEEYFENLSRLVEHYQNDADGLCTRLKLSVPKKGGPEFSVDSQEFEKAGWTIKLDDLKLGEVLGKGEFGDVVLGCFRGQKVAVKVLKDNSKAAQTFLAEASVMTSLSHRNLVQLLGVVFNWPSIYIVTEYMSKGSLVDYLRSRGRLHVTKQDQIHFATDTCAGMAYLESRQVVHRDLAARNVLISDENVAKVCDFGLAREKSFNLEGGKFPIKWTAPEALRHSKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEKGYRMEAPEGCPTEIYDIMKQAWDLEPENRPTFAEVLKRLEEL 445          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A2J7RIA3 (Tyrosine-protein kinase OS=Cryptotermes secundus OX=105785 GN=Csk PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 1.355e-131
Identity = 186/370 (50.27%), Postives = 259/370 (70.00%), Query Frame = 1
Query:   43 NKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDK--IYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFK 1146
             K+EV L +M W+HG I+R+ AEQLL P+E+GLFL+RES N+PGD+TLCVCYQ  V+HYR+ Y K  + TID+EE+F +L +LVE Y  DA+GL T LTK LPK G   +      F +AGWV     L+L E +GKG+F +V     +G  +A K +  SS+     + EAS+MT++RH+NLVQ  GLV ++    IYL+TEYM  GSLV+YLR+RG+  +T  +Q+ F+ +   GM YLE + +VHRDLA RN+L+ +  VAK++DFGL RE +    GG++PIKWTAPEA+K ++FS  SDMWSFG++LWEIYSFG++PY  I +  V+  +E+G+++  P+ CPPE+Y +M  AW + P  RP F+
Sbjct:   55 KKAEVKLNAMPWFHGKISRDRAEQLLSPKEDGLFLVRESTNFPGDYTLCVCYQGKVEHYRVKY-KDNQLTIDDEEFFENLSQLVEHYEQDADGLCTQLTKSLPKKGKQDFCVDTKAFVEAGWVIQEHELELRESIGKGEFGDVMLGILRGDKVAVKMLKDSSEAAQKFLAEASLMTSLRHENLVQLLGLVFNNKNKHIYLVTEYMSKGSLVDYLRSRGRLHVTKKDQINFAFDTCSGMEYLESRKVVHRDLAARNVLISEEGVAKVSDFGLAREENFTLEGGKLPIKWTAPEALKQSKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEKGYKMEAPEGCPPEVYEIMRQAWDLQPDKRPTFR 423          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: csk (tyrosine-protein kinase CSK [Source:NCBI gene;Acc:103033740])

HSP 1 Score: 348.206 bits (892), Expect = 1.276e-115
Identity = 169/377 (44.83%), Postives = 241/377 (63.93%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSD-KIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITRE AE+LL+P E GLFL+RES N+PGD+TLCV     V+HYRI+Y +  + +IDEEE+F +L +LVE Y  DA+GL T L KP    G          F ++GW   R  L L + +GKG+F +V    Y+G  +A KC+   +      + EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG++ I     L FS+NV   M YLE  + VHRDLA RN+L+  + +AK++DFGL +E  S +   ++P+KWTAPEA++   FS  SD+WS+G++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y++M   W ++   RP F      L  I
Sbjct:   72 KSGGKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNFPGDYTLCVSCDGKVEHYRIVY-QNCKLSIDEEEFFENLMQLVEHYTKDADGLCTRLIKPKLMEGTV---AAQDEFSRSGWALNRKELKLLQAIGKGEFGDVMVGDYRGTKVAVKCIKHDATAQAF-VAEASVMTQMRHNNLVQLLGVIVEEKGSLYIVTEYMAKGSLVDYLRSRGRTIIGGDCLLKFSMNVCEAMEYLEANNFVHRDLAARNVLVSDDNIAKVSDFGLTKEASSTQDTAKLPVKWTAPEALREKTFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYNIMKQCWTLDVNMRPTFNALRDSLQDI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:103023502])

HSP 1 Score: 344.739 bits (883), Expect = 3.037e-114
Identity = 167/377 (44.30%), Postives = 244/377 (64.72%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDS-DKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITR+ AE+LL+P E GL+L+RES NYPGD+TLCV  +  V+HYRIIY    + +IDEEE+F +L +LVE Y  DA+GL T L KP    G          F ++GW   R  L L + +GKG+F +V    Y+G  +A KC+   +      I EASVMT +RH NLVQ  G++++    ++++TEYM  GSLV+YLR+RG++ +     L FS++V   M YLE  + VHRDLA RN+L+ ++ +AK++DFGL +E  S +   ++P+KWT+PEA++  +FS  SD+WS+GV+LWEIYSFG++PY  I ++ V+  +E+G+++  P  CP  +Y LM   W ++   RP+F+   + L  I
Sbjct:   72 KSGGKLSLMPWFHGKITRDQAERLLYPPETGLYLVRESTNYPGDYTLCVSCEGKVEHYRIIY-HNGKLSIDEEEFFENLMQLVEHYTKDADGLCTRLIKPKLMEGTV---AAQDEFSRSGWALSRKDLKLIQTIGKGEFGDVMVGDYRGTKVAVKCIKHDATAQAF-IAEASVMTQLRHNNLVQLLGVIVEERGSLFIVTEYMAKGSLVDYLRSRGRTVLGGDCLLKFSLDVCEAMEYLEVNNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASSTQDTAKLPVKWTSPEALREKRFSTKSDVWSYGVLLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDAPDGCPAVVYDLMKQCWTLDSVMRPSFRMLREKLQHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:103023502])

HSP 1 Score: 344.739 bits (883), Expect = 3.598e-114
Identity = 167/377 (44.30%), Postives = 244/377 (64.72%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDS-DKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITR+ AE+LL+P E GL+L+RES NYPGD+TLCV  +  V+HYRIIY    + +IDEEE+F +L +LVE Y  DA+GL T L KP    G          F ++GW   R  L L + +GKG+F +V    Y+G  +A KC+   +      I EASVMT +RH NLVQ  G++++    ++++TEYM  GSLV+YLR+RG++ +     L FS++V   M YLE  + VHRDLA RN+L+ ++ +AK++DFGL +E  S +   ++P+KWT+PEA++  +FS  SD+WS+GV+LWEIYSFG++PY  I ++ V+  +E+G+++  P  CP  +Y LM   W ++   RP+F+   + L  I
Sbjct:   75 KSGGKLSLMPWFHGKITRDQAERLLYPPETGLYLVRESTNYPGDYTLCVSCEGKVEHYRIIY-HNGKLSIDEEEFFENLMQLVEHYTKDADGLCTRLIKPKLMEGTV---AAQDEFSRSGWALSRKDLKLIQTIGKGEFGDVMVGDYRGTKVAVKCIKHDATAQAF-IAEASVMTQLRHNNLVQLLGVIVEERGSLFIVTEYMAKGSLVDYLRSRGRTVLGGDCLLKFSLDVCEAMEYLEVNNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASSTQDTAKLPVKWTSPEALREKRFSTKSDVWSYGVLLWEIYSFGRVPYPRIPLKEVVPRVEKGYKMDAPDGCPAVVYDLMKQCWTLDSVMRPSFRMLREKLQHI 446          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:103034670])

HSP 1 Score: 328.561 bits (841), Expect = 2.938e-108
Identity = 164/385 (42.60%), Postives = 246/385 (63.90%), Query Frame = 1
Query:   58 HLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLT---FVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSS 1203
            +L  M W+HG I+   A   L P E+GLFL+RES+ +PGD+ LCV ++  V HYR+IY +  + TID  ++F +L ++VEFY  +   LVT L KP  K G       ++   + GW+    GL L E +G+G+F  V++  Y G+ +A K +   SD+T   F+G  E SVMT ++H+NLVQ  G+++  + +Y++TE+M  G+LVNYLR+RG+S I+ +  L +++ V  GM YLE K LVHRDLA RNILL ++ VAK++DFGL +         ++P+KWTAPE +KN + S  SD+WS+GV+LWEI+S+G  PY  +S+Q V  ++EQG+R+  P+ CPPE+Y++M   W   P  RP+F +  ++L   +    S   S
Sbjct:   49 NLSLMPWFHGKISGPEAVSKLRPMEDGLFLVRESIRHPGDYVLCVSFKQEVIHYRVIY-QDSKLTIDSTQHFYNLIDMVEFYSKNKGALVTTLQKPKQKEGARSAALQLY---KTGWLLDLAGLTLGESIGEGEFGAVYEGEYMGRKVAVKNI--KSDVTAQAFLG--ETSVMTKLQHKNLVQLLGVILH-NGLYIVTEFMAKGNLVNYLRSRGRSVISTVQLLHYALEVCEGMEYLECKKLVHRDLAARNILLSEDNVAKVSDFGLAKVDSQAFDNTKLPVKWTAPEGLKNKKISTRSDVWSYGVLLWEIFSYGMQPYPKMSLQEVKEQVEQGYRMEAPEACPPEVYTIMRDCWEKEPKMRPSFHKLRELLQAEVTKHESSTGS 424          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:103034670])

HSP 1 Score: 328.561 bits (841), Expect = 7.092e-108
Identity = 164/385 (42.60%), Postives = 246/385 (63.90%), Query Frame = 1
Query:   58 HLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLT---FVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSS 1203
            +L  M W+HG I+   A   L P E+GLFL+RES+ +PGD+ LCV ++  V HYR+IY +  + TID  ++F +L ++VEFY  +   LVT L KP  K G       ++   + GW+    GL L E +G+G+F  V++  Y G+ +A K +   SD+T   F+G  E SVMT ++H+NLVQ  G+++  + +Y++TE+M  G+LVNYLR+RG+S I+ +  L +++ V  GM YLE K LVHRDLA RNILL ++ VAK++DFGL +         ++P+KWTAPE +KN + S  SD+WS+GV+LWEI+S+G  PY  +S+Q V  ++EQG+R+  P+ CPPE+Y++M   W   P  RP+F +  ++L   +    S   S
Sbjct:   76 NLSLMPWFHGKISGPEAVSKLRPMEDGLFLVRESIRHPGDYVLCVSFKQEVIHYRVIY-QDSKLTIDSTQHFYNLIDMVEFYSKNKGALVTTLQKPKQKEGARSAALQLY---KTGWLLDLAGLTLGESIGEGEFGAVYEGEYMGRKVAVKNI--KSDVTAQAFLG--ETSVMTKLQHKNLVQLLGVILH-NGLYIVTEFMAKGNLVNYLRSRGRSVISTVQLLHYALEVCEGMEYLECKKLVHRDLAARNILLSEDNVAKVSDFGLAKVDSQAFDNTKLPVKWTAPEGLKNKKISTRSDVWSYGVLLWEIFSYGMQPYPKMSLQEVKEQVEQGYRMEAPEACPPEVYTIMRDCWEKEPKMRPSFHKLRELLQAEVTKHESSTGS 451          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: abl1 (c-abl oncogene 1, non-receptor tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-100812-9])

HSP 1 Score: 264.233 bits (674), Expect = 1.022e-78
Identity = 143/394 (36.29%), Postives = 218/394 (55.33%), Query Frame = 1
Query:   22 SKYMLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYK--GKILAAKCVIQSSDLTFVG--IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR----ETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILN 1179
            S Y+   N  E H     WYHGPI+R  AE LL     G FL+RES + PG  ++ +  +  V HYRI      +Y +  E  FS+L ELV  + S A+GL+  L  P PK   P    V   + +  W   R  + ++  LG G + EV++   K   + +A K +    D   V   +KEA++M  ++H NLVQ  G+       Y++TE+M +G+L++YLR   +  +T +  L  +  ++  M YLE+K+ +HRDLA RN L+ ++ + K+ADFGL R    +T +   G + PIKWTAPE++  N+F       +FGV+LWEI ++G  PY G+ +  V   +E+G+R+  P+ CPP +Y LM A W  N A RP+F + H+   T+ +
Sbjct:   88 SNYITPVNSLEKH----SWYHGPISRNAAEYLLSSGINGSFLLRESESSPGQLSISLRCEGRVYHYRINTASDGKYFVSSESRFSTLAELVHHHSSVADGLIVPLHYPAPKRTKPTVYGVSPTYDR--WEIERTDITMKHKLGGGQYGEVYEGLKKKYSRTVAVKTLNPREDTMEVEEFLKEAAMMKEIKHPNLVQLLGVCTREPPFYIVTEFMTHGNLLDYLRECNRDEVTAVVLLHMATQISSAMEYLEKKNFIHRDLAARNCLVAESHMVKVADFGLSRLMTGDTYTARAGAKFPIKWTAPESLAYNKFCAPVSCSAFGVLLWEIATYGMSPYPGVDLSQVYERLERGYRMEQPEGCPPRVYQLMQACWQWNAADRPSFAEIHQTFETMFH 475          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 244.588 bits (623), Expect = 8.563e-77
Identity = 139/373 (37.27%), Postives = 212/373 (56.84%), Query Frame = 1
Query:   76 WYHGPITRETAEQLLHPR--EEGLFLIRESVNYPGDFTLCVCYQDGVQ-----HYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAG---WVFPRDGLDLEECLGKGDFAEVFKAHY-KGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR--ETDSY--ELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQ 1149
            W+ G I+R  A +LL  R  + G FLIRES +  G + L V   D +Q     HY I   +   +TI++   FS+L++LV  ++ +ANGL     K L      +  PV           W   R  ++L   LG G F EV++  + K   +A K +   + +    + EA +M    H NL+Q + +    + IY++TE M+NGSL+ YL+      +   + +  ++ VA GM+YLE ++ +HRDLA RNIL+  N+  K+ADFGL R  + D Y    GG+ P+KWTAPEA   ++F+  SD+WSFG++L+EI ++GK+PY+G++   V+ E+E G+R+PCP NCP + YS+M   W    A RP+F Q
Sbjct:    1 WFFGKISRADAVKLLLARGNDHGSFLIRESESKHGAYALSVSEWDALQGVEVRHYHIQPLEGGGFTINKRAAFSTLQDLVRHHVLEANGL-----KSLILYVCMVTSPVTFGLSHDTVDQWEVKRSSIELLRQLGAGQFGEVYEGLWNKTTRVAVKTLKPGAMVPEEFLAEAHIMKRFTHCNLIQLYAVCTTEEPIYIITELMVNGSLLQYLQNDEGGVLKMCHLINMAVQVASGMAYLEAQNYIHRDLAARNILVGDNLTCKVADFGLARVIKDDEYIAREGGKFPVKWTAPEAANYSRFTIKSDVWSFGILLYEIVTYGKVPYAGMTNAEVLEELEHGYRMPCPTNCPRDFYSIMYNCWHKEEACRPSFLQ 368          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 1.585e-76
Identity = 132/345 (38.26%), Postives = 196/345 (56.81%), Query Frame = 1
Query:  136 GLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHY-KGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR-----ETDSYE--LGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFK 1146
            G FL+R+S      ++L V   D V+HY+I   +K  + I     F++L +LV+ Y  DANGL   L +P  K  +P    +        W  PR  + L + LG G F EV++  + K   +A K + Q +      ++EA +M  +RH  L+Q + +    + IY++TE M NGSL NYL+T     +  +  +  +  VA GM+YLE ++ +HRDLA RNIL+ ++   K+ADFGL R       D YE  +G + PIKWTAPEA   N+FS  SD+WSFGV+L EI ++GKLPY G +   V++ +++G+R+PCP  CP   Y LM   W ++   RP F+
Sbjct:   18 GSFLVRQSETSGHGYSLSVRDGDTVKHYKIRVLEKGSFFITRRNQFATLRDLVQSYSRDANGLCVTLNQPCLKKEMPQTEGLSSDMADK-WEIPRSSVQLVKRLGAGQFGEVWQGLWNKTTPVAIKTLKQGTMDRDDFLREAQLMKRLRHPKLIQLYAVCTQEEPIYIITELMSNGSLANYLQTPEGRSLDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEYEARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVDRGYRMPCPPGCPQAFYDLMLECWNVDDQARPTFE 361          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 242.276 bits (617), Expect = 4.108e-75
Identity = 139/378 (36.77%), Postives = 211/378 (55.82%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQ--LLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRII-YDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPV---IHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLT---FVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR-----ETDSYE--LGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFK 1146
            L +  W+ G I R  AE+  L      G FLIR+S +   D++L V     V+HYRI   D+   + I     F +L ELV++Y S+++GL   L KP     + I  P    + Y     W  PR  + L++ LG G F EV++  +    L A   ++   +    F+G  EA +M  +RH NL+Q + +    + IY++TE M +GSL++YLR      +     +  +  +A GM+YLE ++ +HRDLA RNIL+ +  V K+ADFGL R       D YE   G +VPIKWTAPEAV  ++FS  SD+WSFG++L+E+ ++G++PY  +    V+ ++++G+R+P P NCPP  YS+M   W      RP F+
Sbjct:   65 LDAEPWFFGDIKRADAEKYLLADVNTTGAFLIRQSESRKTDYSLSVRDGSTVKHYRIRQLDENGGFFISRRVTFQNLIELVQYYKSNSDGLCMALQKPC----VVIEAPTTIGLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQGLWNNSTLVAVKTLKPGAMKKEEFIG--EAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTFE 436          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 241.891 bits (616), Expect = 1.953e-74
Identity = 141/375 (37.60%), Postives = 215/375 (57.33%), Query Frame = 1
Query:   76 WYHGPITRETAEQ--LLHPREEGLFLIRESVNYPGDFTLCVCYQ-----DGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKI-LAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR--ETDSYEL--GGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVL 1164
            W+   ++R+ AE+  LL   + G +LIR+S    G ++L V        D V+HY+I    K  Y I     F +L+ELV +Y   A+GL   L KP     + I P     +++  W  PR+ + LE+ LG G F +V+   Y  K  +A K +   S      ++EA++M T++H  LV+ H +V D + I+++TEYM  GSL+++L+T   S +     +     VA GM+++E K+ +HRDL   NIL++ N+V KIADFGL R  E + Y    G + PIKWTAPEA+    FS  SD+WSFG++L E+ +FG++PY G++   V+  +E+G+R+P P NCP E+YS+M   W   P  RP F+    +L
Sbjct:  129 WFFKGLSRKDAERQLLLCGNKIGSYLIRDSETNKGSYSLSVRDHIVEVGDTVKHYKIRTLDKGGYFITSRITFHTLQELVVYYHLKADGLCQKLGKPC----IAIQPQ--KPWEKDAWEIPRESIKLEKKLGAGQFGDVWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDKLVRLHAVVTD-EPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERGYRMPKPDNCPCELYSIMQECWRQKPEERPTFEYLQSLL 496          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 112.849 bits (281), Expect = 6.435e-27
Identity = 70/245 (28.57%), Postives = 122/245 (49.80%), Query Frame = 1
Query:  433 LEECLGKGDFAEVFKA--HYKGKILAAKCVIQSSDLTFVGI-KEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHK 1158
            L++ +G+G +  V+KA   +  +++A K V+  +D     I  E S++  + H N+V++HG +  S ++Y+L EY  NGSL   L +R  +G++      +      G+ YL  + ++HRD+   NILL  +   K+ADFG+    +S  L     + W APE + N   S +SD+WS G  + E+ +    PY  ++  ++   +E     P P +    +   +   +V N   RP   Q  K
Sbjct:   27 LKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSL-RRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP-PYHNLTDANIYYAVENDTYYP-PSSFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 106.301 bits (264), Expect = 9.969e-25
Identity = 79/254 (31.10%), Postives = 130/254 (51.18%), Query Frame = 1
Query:  439 ECLGKGDFAEVFKAH--YKGKILAAKCV----IQSSDLTFVGIKEA-----SVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRET-DSY---ELGGRVPIKWTAPEAVKNNQ-FSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRL-PCPQNCPPEIYSL----MDAAWVINPAHRP 1137
            E +GKG F  V+       G+++A K V      S +   +   EA     S +  + H N+VQ+ G    ++   L  EY+  GS+ + +R  G+     I  L  +  V  G++YL  K ++HRD+   N+LLD++ + KI+DFG+ R++ D Y   ++  R  + W APE V   Q +S   D+WS G ++ E+++ GK P+S + V   M +I +     P P++  P I  +    +DA + INP  RP
Sbjct: 1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHL--TTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 93.5893 bits (231), Expect = 1.240e-20
Identity = 65/206 (31.55%), Postives = 108/206 (52.43%), Query Frame = 1
Query:  547 IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDS----YELGGRVPIKWTAPEAVKNNQFS-PMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQ 1149
            I+EAS+   + H ++ +   +   S+  Y+L EY+  G L++Y+   G   I       F+  +A  + YL   ++VHRDL   NI++  +   KI DFGL    DS    +   G   + + APE +K N ++ P  D+WSFGVVL+ +   GK+P+   +   +  +I+QG ++  PQ+   E+ SL+    V++P  R   KQ
Sbjct:  192 IREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHG--SIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQLHTFCGS--LYFAAPELLKANPYTGPEVDVWSFGVVLF-VLVCGKVPFDDENSSVLHEKIKQG-KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQ 391          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 91.2781 bits (225), Expect = 5.630e-20
Identity = 73/248 (29.44%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  445 LGKGDFAEVFK-AHYKGKILAAKCV----IQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLC-----RETDSYELGGRVPIKWTAPEAV--KNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIE-QGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQ 1149
            LG+G FA  F+     G+I AAK V    I+S       + E  +  ++ H N+VQF     D   +Y+L E   NGSL+  L+ R    +T      F+  +   + Y+  + ++HRDL   NI  D N   KI DFGL           Y + G  P  + APE +  K++  S   D+WS GV+L+ +   GK P+    V  +   I+ + F  P  +    E   L+     ++P  RP+  +
Sbjct:   88 LGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICG-TP-NYIAPEVLMGKHSGHSFEVDIWSLGVMLYALL-IGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTE 330          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 88.9669 bits (219), Expect = 1.091e-19
Identity = 59/218 (27.06%), Postives = 110/218 (50.46%), Query Frame = 1
Query:  376 PVIHYFQQAGWVFPRDGLDLEECLGKGDFAEV--FKAHYKGKILAAKCVIQSSDLTFVGIK----EASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETD--SYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPY 1005
            P++ Y   +G  +      +   LG G F  V   ++++ G+  A K + + + +    ++    E  +++ V H  +++  G   DS +++++ +Y+  G L + LR + +    P+ +  ++  V   + YL  KD+++RDL   NILLDKN   KI DFG  +     +Y L G     + APE V    ++   D WSFGV+++E+ + G  P+
Sbjct:   72 PMLQYRDTSG-KYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLR-KSQRFPNPVAKF-YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTP--DYIAPEVVSTKPYNKSVDWWSFGVLIYEMLA-GYTPF 283          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 230.72 bits (587), Expect = 1.946e-72
Identity = 109/267 (40.82%), Postives = 164/267 (61.42%), Query Frame = 1
Query:  406 WVFPRDGLDLEECLGKGDFAEVFKAHYK--GKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR--ETDSYEL--GGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKN 1188
            W   R  + ++  LG G + EV++  +K   K +A K + + +      +KEASVM  ++HQNLVQ  G+       Y++TE+M+NG+L++YLR+     +  +  +  +  V   MSYLE  + +HRDLA RN L+  N + K+ADFGL R    D Y    G + PIKWTAPEA+ +N FS  SD+W+FG++LWE+ ++G  PY GI +  V  +++ G+R+PCP+ CPPE+YSLM   W  +P  RP+FK+ H+ L T+  S N
Sbjct:    7 WEIERTEIAMKHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEEFLKEASVMKGIKHQNLVQLLGVCTREPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLVSEDIYTAHQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPEGCPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTMFPSSN 273          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO35408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ9])

HSP 1 Score: 186.422 bits (472), Expect = 1.262e-55
Identity = 96/281 (34.16%), Postives = 157/281 (55.87%), Query Frame = 1
Query:  406 WVFPRDGLDLEECLGKGDFAEVFKAHYK-------GKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGK---------SGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSY-------ELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILN 1179
            W  PRD + L + +G+G F  VF    K         I   K V    D+  + ++   +     H N+V   G       +Y++TEY+  G+L++ LR   +         S +T  + L  +++V+ GM ++  K  VHRDLA RN+L+   + AK+ADFGL R  D Y         GGR+PIKW APEA+++  ++  +D+WSFGV+LWEI + G+ PY G+ +  ++ ++  G+++PCP +C  E+YS+M++ W + P+ RP F +  K+LT +L+
Sbjct:    4 WEIPRDCVTLGDRIGEGQFGIVFAGTVKIGEDTIKAAIKCIKDVDDRYDMKDLKLEMEMMKEIGYHPNVVSLIGTCTIETPLYIITEYVSGGNLLDQLRQSRRTDSKYVNVNSTLTSRDLLRIALDVSRGMRHIAMKKFVHRDLAARNVLMTDTLTAKVADFGLAR--DIYCEGKYVKTGGGRLPIKWMAPEAIRDQVYTTQTDVWSFGVLLWEIVTLGRSPYPGVPIAMLLEKLLYGYKMPCPSHCSEEVYSVMESCWQLEPSARPGFGELSKILTEMLS 282          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 189.119 bits (479), Expect = 4.477e-55
Identity = 103/262 (39.31%), Postives = 157/262 (59.92%), Query Frame = 1
Query:  427 LDLEECLGKGDFAEVFKAHYKGK-----ILAAKCVIQSSDLTFVG--IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETD--SYEL-GGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            L LE+ +G G+F +V+K   K        +A K + Q S     G  + EASVM      N++   G+V  +  + ++TE+M NGSL N+L+ +  S ++ I  +  +  +A GM YL + + VHRDLA RNIL+ + +V K+ADFGL RE +  +YE  GG++P++WTAPEA+K  +FS  SD+WS+G++LWE +SF + PY   S   VM  +E G+RLP P +CP  I+ +M   W  +   RP+F    K L +++ S
Sbjct:   58 LKLEKVIGGGEFGDVYKGTLKRPGENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLK-KMDSKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSRELEDSAYETSGGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECWDADRTKRPSFALIVKQLDSLIRS 318          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO37886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEI8])

HSP 1 Score: 182.57 bits (462), Expect = 5.844e-54
Identity = 102/295 (34.58%), Postives = 159/295 (53.90%), Query Frame = 1
Query:  400 AGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIK----------------EASVMTTV-RHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRG--------------KSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRE---TDSY--ELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTIL 1176
            A W FP   L L+E LG G F +V KA   G IL+     ++S+ T V +K                E  +M  +  H+N++   G     + + L+ EY  +G+L+ +LRTR               K+  T  +Q++ +  +A GM +L  K  +HRDLA RN+L+D+    KI DFGL R+   TD Y  +  G +P+KW APEA+ + ++S  +D+W+FGVVLWEI + G  PY G+ ++ ++  I +G R+  P++CPPEIY++M   W +    RP F +  + +  IL
Sbjct:    6 ADWEFPEKRLILQEVLGSGAFGQVIKAEAIG-ILSLSARDKTSEATTVAVKMLKENASESDYKDLASELKIMIHLGEHKNIINLLGACTRGENLMLILEYAKHGNLLQFLRTRRDIYEPTWKKTTFNPKTEFTLADQVVDAYQIAQGMDFLASKKCIHRDLAARNVLVDEGYALKIGDFGLARDIYKTDLYVKKGAGLLPVKWMAPEALFDREYSSKTDVWAFGVVLWEILTLGGSPYPGVPLEQLLDYINEGKRMAQPRDCPPEIYAIMCDCWSLEQDRRPTFAELVRRIERIL 299          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 184.496 bits (467), Expect = 1.683e-53
Identity = 98/278 (35.25%), Postives = 154/278 (55.40%), Query Frame = 1
Query:  418 RDGLDLEECLGKGDFAEVFKAHYKG----------KILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDS--------YEL-GGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSI 1194
            +D L LE  +G G+FA+V++               KIL      ++ +   V   EAS+M    H N++   G++  +  + ++TE++ NGSL N+L++     +T +  +     VA GM+YL + + +HRDLA RNIL+  N+ AK++DFGL RE D         Y+  GG++P++WTAPEA++  +FS  SD+WS+G++LWEI SFG+ PY       VM  +E G+RLP P  CP  I++LM   W      RP F    +    ++ S + +
Sbjct:   24 KDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCV---EASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKS-NDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEVIRSPDKM 297          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:101160398])

HSP 1 Score: 353.599 bits (906), Expect = 1.031e-118
Identity = 171/368 (46.47%), Postives = 242/368 (65.76%), Query Frame = 1
Query:   73 VWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDS-DKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            +W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRIIY    + TIDEEEYF +L +LVE Y  DA+GL T L KP    G          F ++GW   R  L L + +GKG+F +V    Y+G  +A KC I++       I EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+  + +AK++DFGL +E  S +   ++P+KWT+PEA++  +FS  SD+WS+G++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y LM   W ++ A RP+F+   + L  I
Sbjct:    1 IWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIIY-HNGKLTIDEEEYFENLMQLVEHYTKDADGLCTRLIKPKLMEGTV---AAQDEFSRSGWALNRKELKLLQTIGKGEFGDVILGDYRGTRVAVKC-IKNDATAQAFIAEASVMTQLRHNNLVQLLGVIVEERGSLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEANNFVHRDLAARNVLVSDDNIAKVSDFGLTKEASSIQDTAKLPVKWTSPEALREKRFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPVVYDLMKQCWTLDAAMRPSFRMLREKLQHI 363          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: CSK (C-terminal Src kinase [Source:NCBI gene;Acc:101160398])

HSP 1 Score: 355.525 bits (911), Expect = 1.740e-118
Identity = 175/377 (46.42%), Postives = 245/377 (64.99%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDS-DKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTI 1173
            KS   L  M W+HG ITRE AE+LL+P E GLFL+RES NYPGD+TLCV     V+HYRIIY    + TIDEEEYF +L +LVE Y  DA+GL T L KP    G          F ++GW   R  L L + +GKG+F +V    Y+G  +A KC I++       I EASVMT +RH NLVQ  G++++    +Y++TEYM  GSLV+YLR+RG+S +     L FS++V   M YLE  + VHRDLA RN+L+  + +AK++DFGL +E  S +   ++P+KWT+PEA++  +FS  SD+WS+G++LWEIYSFG++PY  I ++ V+  +E+G+++  P  CPP +Y LM   W ++ A RP+F+   + L  I
Sbjct:   72 KSGGKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIIY-HNGKLTIDEEEYFENLMQLVEHYTKDADGLCTRLIKPKLMEGTV---AAQDEFSRSGWALNRKELKLLQTIGKGEFGDVILGDYRGTRVAVKC-IKNDATAQAFIAEASVMTQLRHNNLVQLLGVIVEERGSLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEANNFVHRDLAARNVLVSDDNIAKVSDFGLTKEASSIQDTAKLPVKWTSPEALREKRFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPVVYDLMKQCWTLDAAMRPSFRMLREKLQHI 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000006131.2 (tyrosine-protein kinase CSK [Source:NCBI gene;Acc:101158271])

HSP 1 Score: 350.903 bits (899), Expect = 1.255e-116
Identity = 169/381 (44.36%), Postives = 250/381 (65.62%), Query Frame = 1
Query:   46 KSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSD-KIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSK 1185
            K++  L  M W+HG ITR+ AE+LL+P E GLFL+RES N+PGD+TLCV     V+HYRIIY    + TIDEE YF +L +L+E Y  DA+GL T L KP  + G          F ++GW   R  L L++ +GKG+F +V    Y+G  +A KC I++       I EASVMT +RH NLVQ  G++++ +  +Y++TEYM  G LV+YLR+RG++ +     L F+I+V   M+YLE  + VHRDLA RN+L+  + +AK++DFGL +E  S +   ++P+KWTAPEA++   FS  SD+WS+G++LWEIYSFG++PY  I ++ V+  +E+G+++ CP  CP  +Y++M   W ++P  RP+F+   + L  I + K
Sbjct:   72 KTDGKLSLMPWFHGKITRDQAERLLNPPETGLFLVRESTNFPGDYTLCVSCDGKVEHYRIIY-HNGKLTIDEEVYFENLMQLMEHYTKDADGLCTKLIKPKLEEGTV---AAQDEFSRSGWSMNRKDLKLQQVIGKGEFGDVMVGDYRGTKVAVKC-IKNDATAQAFIAEASVMTQMRHNNLVQLLGVIVEENGSLYIVTEYMAKGCLVDYLRSRGRTVLGGEALLKFAIDVCEAMAYLETNNFVHRDLAARNVLVSDDNIAKVSDFGLTKEASSTQDTAKLPVKWTAPEALREKNFSTKSDVWSYGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDCPDGCPEVVYNIMKQCWNLDPGARPSFQMLKEWLHHISHKK 447          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:101164299])

HSP 1 Score: 303.138 bits (775), Expect = 5.634e-98
Identity = 154/383 (40.21%), Postives = 239/383 (62.40%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSR 1206
            L  M W+HG I+   A   L P E+GLFL+RESV +PGD+ LCV +   V HYR+IY +  + TID ++YF +L +++EFY  + + + T LTKP  K G            + GW+     L L   +G+G+F  V++  Y G+ +A K +    D+T    ++E +VMT ++H+NLV+  G++++   ++++TE M+ G+LVN+LRTRG+S +T I    +S++V  GM YLE K LVHRDLA RNIL+  +  AKI+DFGL +         ++PIKWTAPEA+   +FS  SD+WS+GV+LWEI+S+G+ PY  +S++ V +++E G+R+  P++CP  +YSLM   W   P  RP F +  + L   +  ++  L ++
Sbjct:   73 LSLMPWFHGKISGSEAVCQLQPAEDGLFLVRESVRHPGDYVLCVSFSGEVIHYRVIY-QDNKLTIDNKQYFYNLIDMIEFYSKNKDSIATTLTKPKQKQGTK---SAELELSKMGWLLDMTKLRLGGIIGEGEFGAVYEGEYVGQRVAVKTI--KCDVTAQAFLQETAVMTKLQHKNLVRLLGVILNKG-LHIVTELMIKGNLVNFLRTRGRSVVTSIQLFRYSLDVCEGMEYLESKKLVHRDLAARNILVSDDNAAKISDFGLTKVVSKEADKAKLPIKWTAPEALTKEKFSTKSDVWSYGVLLWEIFSYGRQPYPKMSLKDVQAKVEAGYRMEAPEDCPANVYSLMKLCWEQEPRRRPGFPKLREKLEREMGKRSPGLPAK 448          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:101164299])

HSP 1 Score: 303.138 bits (775), Expect = 5.634e-98
Identity = 154/383 (40.21%), Postives = 239/383 (62.40%), Query Frame = 1
Query:   61 LQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSR 1206
            L  M W+HG I+   A   L P E+GLFL+RESV +PGD+ LCV +   V HYR+IY +  + TID ++YF +L +++EFY  + + + T LTKP  K G            + GW+     L L   +G+G+F  V++  Y G+ +A K +    D+T    ++E +VMT ++H+NLV+  G++++   ++++TE M+ G+LVN+LRTRG+S +T I    +S++V  GM YLE K LVHRDLA RNIL+  +  AKI+DFGL +         ++PIKWTAPEA+   +FS  SD+WS+GV+LWEI+S+G+ PY  +S++ V +++E G+R+  P++CP  +YSLM   W   P  RP F +  + L   +  ++  L ++
Sbjct:   73 LSLMPWFHGKISGSEAVCQLQPAEDGLFLVRESVRHPGDYVLCVSFSGEVIHYRVIY-QDNKLTIDNKQYFYNLIDMIEFYSKNKDSIATTLTKPKQKQGTK---SAELELSKMGWLLDMTKLRLGGIIGEGEFGAVYEGEYVGQRVAVKTI--KCDVTAQAFLQETAVMTKLQHKNLVRLLGVILNKG-LHIVTELMIKGNLVNFLRTRGRSVVTSIQLFRYSLDVCEGMEYLESKKLVHRDLAARNILVSDDNAAKISDFGLTKVVSKEADKAKLPIKWTAPEALTKEKFSTKSDVWSYGVLLWEIFSYGRQPYPKMSLKDVQAKVEAGYRMEAPEDCPANVYSLMKLCWEQEPRRRPGFPKLREKLEREMGKRSPGLPAK 448          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000059351.1 (SMESG000059351.1)

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 392/393 (99.75%), Postives = 392/393 (99.75%), Query Frame = 1
Query:   31 MLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSRC 1209
            MLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHY GKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSRC
Sbjct:    1 MLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYNGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSRC 393          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016115.1 (SMESG000016115.1)

HSP 1 Score: 296.59 bits (758), Expect = 3.258e-95
Identity = 163/420 (38.81%), Postives = 235/420 (55.95%), Query Frame = 1
Query:   76 WYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTK--PLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCV---IQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCRETDSYELG----------------------------------------------GRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNS 1182
            WYHG ++R  AE+ L P E G FLIR S  +PGD+T+CV + D VQ Y +IY  K  YT+DE+ +F+S+ EL+E Y  DA+GL   LTK    PKS L        Y  +       + + L   +G G+F+EV +  Y+  ++A KC+   I  ++ T     E S+M  + H +LV F G+   ++ +Y++TEYM NGSLVNYLR+RG++ I   +Q+ F+I+   GM YLE+  LVHRDLA RNILL+  +VAK++DFGL R  DS                                                  GR+P+KWTAPEA+ +N+++  SD+WSFG++LWEI+SFG+ PY  I   +V   +  G+R+  P++ P +IY LM   W + P  RP F + HK+L   + S
Sbjct:   72 WYHGKVSRSLAEERLMPCENGTFLIRSSDKFPGDYTICVKFND-VQFYHVIYSNKG-YTLDEDSWFASMPELIEHYQKDADGLCCTLTKCYESPKSRL-------DYLDENVLNIKFEEIKLGPKIGCGEFSEVLQGEYQDTVVAVKCLKKPINFAEKTLFTF-EFSLMAKLNHPHLVTFKGISSSNESVYIITEYMENGSLVNYLRSRGRTVIKTNDQIKFAIDSCSGMCYLEEHCLVHRDLAARNILLNAKLVAKVSDFGLARVDDSRTNSENCNNNLNSNSKNHSSKTPSPKLMLNVVNDLVSLPTSSVDDNTTSVGRIPVKWTAPEALTHNKYTNKSDVWSFGILLWEIFSFGRTPYPRIYANNVKQHLLNGYRMESPEDTPNDIYELMRDCWALEPEKRPTFCEIHKILHKKMKS 481          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000042606.1 (SMESG000042606.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.284e-76
Identity = 140/396 (35.35%), Postives = 217/396 (54.80%), Query Frame = 1
Query:   22 SKYMLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYKGKILAAKCVIQSSDLTFVG--IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR---ETDSY--ELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKN 1188
            S ++  +   + +LQ   WYHG I R  AE LL+    G FL+RES +     ++ + Y+  + H+RI  D   +Y + E + F ++ +L++++   A+GL   L  P PK        V        W   R  + ++  LG G +  V++A +K   +        +D+T     ++EA +M +++H NLV+  G+       Y++ E+M NG+L+ YLRTR K  + P   L  +I +A GM YLEQ + +HRDLA RN L+ ++ + K+ADFGL R     D+Y   +G + PIKWTAPE +  NQFS  SD+W+FGV+LWE+ ++G  PY GI +Q V   +E+G  +  P  CP  IY +M   W   P  RP+FK  H  L  +L++ N
Sbjct:  120 SDFIEESQDCDSYLQQFKWYHGAIPRSFAEYLLNSGITGSFLVRESESNRRLRSISLRYEGKIWHFRISKDYNNKYYVTENQRFDTISKLIDYHSKFADGLPCQLLFPAPKRAQATVFGVGENDSADIWEIDRTEIMMKNQLGSGQYGIVYEAFWKKYSITVAVKTVKTDITVADDFLEEARLMKSLQHPNLVRLLGVCTQEPPNYIIAEFMENGNLLEYLRTRSKEDLPPPVLLYMAIQIAAGMEYLEQHNFIHRDLAARNCLVGQDNIVKVADFGLARCMERDDTYTAHVGAKFPIKWTAPEGLAYNQFSTKSDVWAFGVLLWELATYGMTPYPGIELQDVYVYLEKGNIMNRPAGCPDNIYDIMKQCWQWFPESRPSFKDLHNELEKMLSNIN 515          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000056885.1 (SMESG000056885.1)

HSP 1 Score: 255.758 bits (652), Expect = 6.407e-76
Identity = 147/415 (35.42%), Postives = 226/415 (54.46%), Query Frame = 1
Query:   37 NTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYD-KKQRYTIDEEEYFSSLEELVEFYISDANGLVTCLTKPLPK----------------------SGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKAHYK--GKILAAKCVIQSSDLTFVG-IKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR---ETDSY--ELGGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKN 1188
            N   ++  L +  WYHG ITR+  E LL     G +L+R S + PG  ++ + Y   V HYRI +D  K+ Y I E   F ++  L++ + +  +GL+  L  P+PK                      S LP++  V        W   R  + + + LG G + +V++A +K    ++A K + +  +L     +KEA VM  +RH+NLVQ  G+ I     YL+TEY+  G+L+++LR   +  +TP   L  +  +A GM+YLE+ + +HRDLA RN L+  N + K+ DFGL R     DSY  ++G + PIKWTAPE +  N+FS  SD+W+FGVVLWE+ ++G  PY GI +  V   +E+G+R+  P+ CP  +Y +M   W  +P  RP+F Q +  L  I  S+N
Sbjct:  102 NKPANDSQLMAYQWYHGNITRQEGEHLLRSGINGSYLVRASESQPGQLSVTLRYDGRVYHYRIGFDIDKKLYYITENHKFPTVAFLIQHHSTFPDGLICALLYPVPKKVRTTNNEKVISKKSDFNISSSSQLPMFEDV------ENWEIDRSEILMHQKLGGGQYGDVYEAVWKRYNVVIAVKTLKEDLNLKIEDFLKEALVMKNLRHKNLVQLLGVCIKEPPFYLITEYISKGNLLHFLRKCNQLEVTPSILLYMATQIADGMTYLEENNFIHRDLAARNCLVGDNYLLKVGDFGLARYIQRDDSYTAKIGAKFPIKWTAPEGLAFNKFSSKSDIWAFGVVLWELATYGLSPYPGIELHDVYHILEKGYRMDRPEGCPEIVYGIMLQCWQWDPLLRPSFAQLYSKLYYICFSQN 510          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016930.1 (SMESG000016930.1)

HSP 1 Score: 245.358 bits (625), Expect = 6.353e-74
Identity = 145/387 (37.47%), Postives = 224/387 (57.88%), Query Frame = 1
Query:   49 SEVHLQSMVWYHGPITRETAEQLLHPRE--EGLFLIRESVNYPGDFTLCVCYQDGVQHYRIIYDKKQRYTIDEEE--------YFSSLEELVEFYISDANGLVTCLTKPLPKSGLPIYPPVIHYFQQAG---WVFPRDGLDLEECLGKGDFAEVFKAHY-KGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKIYLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSIN-VACGMSYLEQKDLVHRDLACRNILLDKNMVAKIADFGLCR----ETDSYEL--GGRVPIKWTAPEAVKNNQFSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCPPEIYSLMDAAWVINPAHRPNFK 1146
            S+  +++  W+   I+R+ +E+LL  +   +G FLIR S   P   +L V Y   V HYR+   +K+R+    EE         F +L ELV+FY ++ANGL   LT+  P+      PPVI    +     W   R+ ++L + LG G+F EV++  + K   +A K +   +      +KEA +M  + H NLV+ + +  D + IY++TE M  GSL+ YLR  GK   T + +LM  ++ +A GM+YLE++  +HRDLA RNIL+ +N + KIADFGL R     +D+Y    G + PIKWTAPEA    +F+  SD+WS+G+VL+EI + G+ P+  ++    + ++E+G+R+P P NCP E+Y +M   W   P +RP FK
Sbjct:  229 SKGSVEAEDWFFYNISRKDSERLLLLKGNIQGTFLIRGSETMPDQLSLSVNYNGTVNHYRV---RKRRFPESMEEGFCITSRKMFFALPELVDFYSTEANGLCCKLTRACPRP-----PPVISDLSRNTRDRWEINRNSIELLKKLGSGNFGEVYQGIWNKTTDVAVKTLKPGTMAKEEFLKEARIMKRLNHSNLVRLYAVCSD-EPIYIVTELMTKGSLLEYLREEGKH--TELKELMDMMSQIANGMAYLEKEGYIHRDLAARNILIGENNICKIADFGLTRVIQGSSDTYNARQGAKFPIKWTAPEAALMGKFTVKSDVWSYGIVLYEIITHGQTPFPAMNNTQTLQQVEKGYRMPKPSNCPQELYKVMLYCWEALPENRPTFK 604          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSK1.902e-11646.15C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC... [more]
CSK1.902e-11646.15C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC... [more]
CSK1.902e-11646.15C-terminal Src kinase [Source:HGNC Symbol;Acc:HGNC... [more]
MATK6.286e-9839.90megakaryocyte-associated tyrosine kinase [Source:H... [more]
MATK2.823e-9739.90megakaryocyte-associated tyrosine kinase [Source:H... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk-12.069e-10540.72Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-12.069e-10540.72Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-11.356e-10440.72Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-11.356e-10440.72Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
abl-14.371e-7637.24Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csk1.379e-12850.26gene:FBgn0262081 transcript:FBtr0300549[more]
Csk1.379e-12850.26gene:FBgn0262081 transcript:FBtr0300547[more]
Csk1.379e-12850.26gene:FBgn0262081 transcript:FBtr0300548[more]
Csk1.379e-12850.26gene:FBgn0262081 transcript:FBtr0299728[more]
Csk4.558e-12850.26gene:FBgn0262081 transcript:FBtr0300546[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk3.512e-11844.36C-terminal Src kinase [Source:ZFIN;Acc:ZDB-GENE-06... [more]
matk5.753e-10341.85megakaryocyte-associated tyrosine kinase [Source:Z... [more]
matk7.826e-10341.85megakaryocyte-associated tyrosine kinase [Source:Z... [more]
abl22.460e-8738.23c-abl oncogene 2, non-receptor tyrosine kinase [So... [more]
abl29.843e-8338.52c-abl oncogene 2, non-receptor tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk5.473e-11745.09C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
csk3.985e-11645.09C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
csk1.006e-11444.85C-terminal Src kinase [Source:NCBI gene;Acc:100216... [more]
gpn24.546e-10642.59GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751... [more]
gpn27.618e-10541.31GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csk2.317e-11645.89c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:8... [more]
Csk2.317e-11645.89c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:8... [more]
Csk2.317e-11645.89c-src tyrosine kinase [Source:MGI Symbol;Acc:MGI:8... [more]
Matk2.755e-9840.80megakaryocyte-associated tyrosine kinase [Source:M... [more]
Matk2.755e-9840.80megakaryocyte-associated tyrosine kinase [Source:M... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41239|CSK_CHICK8.882e-11845.62Tyrosine-protein kinase CSK OS=Gallus gallus OX=90... [more]
sp|P41240|CSK_HUMAN9.133e-11646.15Tyrosine-protein kinase CSK OS=Homo sapiens OX=960... [more]
sp|P32577|CSK_RAT1.074e-11545.89Tyrosine-protein kinase CSK OS=Rattus norvegicus O... [more]
sp|P41241|CSK_MOUSE1.621e-11545.89Tyrosine-protein kinase CSK OS=Mus musculus OX=100... [more]
sp|Q0VBZ0|CSK_BOVIN2.242e-11546.15Tyrosine-protein kinase CSK OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443RF528.622e-13550.78Tyrosine-protein kinase OS=Dinothrombium tinctoriu... [more]
A0A1E1XQP72.632e-13250.26Tyrosine-protein kinase OS=Amblyomma sculptum OX=1... [more]
T1JDP93.361e-13248.68Tyrosine-protein kinase OS=Strigamia maritima OX=1... [more]
A0A087UEP13.861e-13249.47Tyrosine-protein kinase (Fragment) OS=Stegodyphus ... [more]
A0A2J7RIA31.355e-13150.27Tyrosine-protein kinase OS=Cryptotermes secundus O... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csk1.276e-11544.83tyrosine-protein kinase CSK [Source:NCBI gene;Acc:... [more]
CSK3.037e-11444.30C-terminal Src kinase [Source:NCBI gene;Acc:103023... [more]
CSK3.598e-11444.30C-terminal Src kinase [Source:NCBI gene;Acc:103023... [more]
matk2.938e-10842.60megakaryocyte-associated tyrosine kinase [Source:N... [more]
matk7.092e-10842.60megakaryocyte-associated tyrosine kinase [Source:N... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abl11.022e-7836.29c-abl oncogene 1, non-receptor tyrosine kinase [So... [more]
frk8.563e-7737.27fyn-related Src family tyrosine kinase [Source:ZFI... [more]
ENSPMAT00000006670.11.585e-7638.26pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
frk4.108e-7536.77fyn-related Src family tyrosine kinase [Source:ZFI... [more]
hck1.953e-7437.60HCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC156.435e-2728.57Protein kinase of the Mitotic Exit Network; locali... [more]
BCK19.969e-2531.10MAPKKK acting in the protein kinase C signaling pa... [more]
KIN11.240e-2031.55Serine/threonine protein kinase involved in regula... [more]
CDC55.630e-2029.44Polo-like kinase; controls targeting and activatio... [more]
TPK31.091e-1927.06cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471951.946e-7240.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354081.262e-5534.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409944.477e-5539.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378865.844e-5434.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337361.683e-5335.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSK1.031e-11846.47C-terminal Src kinase [Source:NCBI gene;Acc:101160... [more]
CSK1.740e-11846.42C-terminal Src kinase [Source:NCBI gene;Acc:101160... [more]
ENSORLT00000006131.21.255e-11644.36tyrosine-protein kinase CSK [Source:NCBI gene;Acc:... [more]
matk5.634e-9840.21megakaryocyte-associated tyrosine kinase [Source:N... [more]
matk5.634e-9840.21megakaryocyte-associated tyrosine kinase [Source:N... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059351.10.000e+099.75SMESG000059351.1[more]
SMESG000016115.13.258e-9538.81SMESG000016115.1[more]
SMESG000042606.11.284e-7635.35SMESG000042606.1[more]
SMESG000056885.16.407e-7635.42SMESG000056885.1[more]
SMESG000016930.16.353e-7437.47SMESG000016930.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033752 ID=SMED30033752|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1445bp
TCTATATAAATCTTATATGATTCAAAATACATGTTGAATACGAATAAAAG
CGAGGTTCATTTGCAATCCATGGTTTGGTATCATGGGCCAATAACTCGAG
AAACTGCCGAACAATTGTTACATCCTCGAGAAGAAGGATTATTTTTAATA
AGAGAAAGTGTTAATTATCCTGGTGATTTTACATTGTGTGTTTGTTATCA
AGATGGCGTTCAACATTATAGAATAATATATGATAAAAAACAACGATATA
CGATTGATGAAGAGGAGTATTTTTCTAGTTTGGAAGAATTAGTAGAATTT
TATATTTCTGATGCAAATGGATTAGTAACTTGTTTGACTAAACCATTACC
GAAATCTGGACTTCCTATTTATCCGCCAGTAATTCATTATTTTCAACAAG
CCGGATGGGTTTTTCCAAGAGACGGTTTAGATCTTGAAGAATGTTTAGGA
AAAGGCGATTTTGCAGAAGTCTTTAAAGCTCATTACAAGGGGAAAATATT
AGCAGCAAAGTGCGTAATACAAAGCAGTGATCTAACTTTTGTTGGAATCA
AAGAAGCATCCGTTATGACAACTGTGAGACATCAAAATTTAGTACAGTTC
CACGGTTTAGTAATAGATTCAGATAAAATCTATTTATTAACCGAATACAT
GCTAAATGGATCTCTTGTGAATTATTTGCGAACTCGTGGAAAATCCGGAA
TCACTCCCATAAACCAGTTGATGTTTTCAATAAACGTAGCCTGTGGAATG
TCATATTTAGAACAAAAGGATCTAGTCCATCGTGATCTTGCCTGTAGAAA
TATCCTGCTGGATAAAAACATGGTGGCTAAAATCGCCGATTTCGGTTTGT
GTAGAGAAACCGATTCCTATGAACTCGGCGGACGAGTTCCCATCAAATGG
ACCGCTCCAGAAGCTGTTAAAAATAATCAATTCAGTCCCATGTCAGATAT
GTGGTCGTTCGGTGTAGTGCTATGGGAGATATACAGCTTCGGCAAACTGC
CGTATTCCGGAATCTCGGTCCAACATGTCATGTCAGAAATTGAGCAAGGC
TTTCGGTTACCATGCCCACAAAATTGCCCCCCGGAAATCTATTCCCTAAT
GGATGCAGCCTGGGTTATCAATCCGGCACATCGACCGAACTTTAAACAGG
CTCACAAAGTGCTAACTACAATTCTTAATTCCAAAAACTCAATTCTTTCC
TCTCGGTGTTAGTGTGAATTTTTATTTTCCATCTGGGTGTGTTTCTCTCT
GTTTGGCATTGATTAGCTGGCATTTGATATTGATCTGCACTTTTGTAAAT
TATTTATAGATATTTTATTACGCTATTCAAACAGTAGAAATTATTCTATT
GACTAACAGAATCAAACCTTTTTTATCACAATGTAATCTTCGGAACGGTT
ATTTAGAACTTTATCAACATTGATGATATCTTTACGTGTTTATAG
back to top

protein sequence of SMED30033752-orf-1

>SMED30033752-orf-1 ID=SMED30033752-orf-1|Name=SMED30033752-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
MLNTNKSEVHLQSMVWYHGPITRETAEQLLHPREEGLFLIRESVNYPGDF
TLCVCYQDGVQHYRIIYDKKQRYTIDEEEYFSSLEELVEFYISDANGLVT
CLTKPLPKSGLPIYPPVIHYFQQAGWVFPRDGLDLEECLGKGDFAEVFKA
HYKGKILAAKCVIQSSDLTFVGIKEASVMTTVRHQNLVQFHGLVIDSDKI
YLLTEYMLNGSLVNYLRTRGKSGITPINQLMFSINVACGMSYLEQKDLVH
RDLACRNILLDKNMVAKIADFGLCRETDSYELGGRVPIKWTAPEAVKNNQ
FSPMSDMWSFGVVLWEIYSFGKLPYSGISVQHVMSEIEQGFRLPCPQNCP
PEIYSLMDAAWVINPAHRPNFKQAHKVLTTILNSKNSILSSRC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000980SH2
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity