Protein kinase

Overview
NameProtein kinase
Smed IDSMED30033750
Length (bp)6462
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30033750) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30033750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30033750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30033750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033750SMESG000070879.1 SMESG000004448.1 PL05003A1B03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30033750SMESG000070879.1 SMESG000070880.1 dd_Smed_v4_3195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033750SMESG000070879.1 SMESG000070880.1 dd_Smed_v4_3195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033750SMESG000070879.1 SMESG000070880.1 dd_Smed_v4_3195_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 206.068 bits (523), Expect = 3.013e-52
Identity = 114/293 (38.91%), Postives = 167/293 (57.00%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ 1407
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ 480          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 205.682 bits (522), Expect = 5.095e-52
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 204.912 bits (520), Expect = 6.143e-52
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 204.912 bits (520), Expect = 6.540e-52
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. Ensembl Human
Match: WNK1 (WNK lysine deficient protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:14540])

HSP 1 Score: 204.912 bits (520), Expect = 7.163e-52
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 190.274 bits (482), Expect = 5.359e-48
Identity = 109/278 (39.21%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQ--PLIEEIIMSCV 1347
            A+ + I +SK  RFLK+D ++G G +K V++G D +    VAWCE++ + + NK ++Q   +E E++  L HPN+V+ ++  +S      D+ G R   K +V+V ELM  GTLK  +K+        ++I ++  W  QIL  L ++H R  PP+IHRDLK +N F+         SVKIGD GLAT + + S   ++IGT  FMAPE+YEE YD  VD+YAFG+ +LE++T + PY +C N   +  K +    P+  S +    P I EII  C+
Sbjct:  267 AQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQ-ESKLNKTERQRFREEAEMLKDLQHPNIVRFYDYWESA-----DLCGKR---KYIVLVTELMTSGTLKMYLKR-----FKRINIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFIT----GTTGSVKIGDLGLAT-LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCI 524          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 190.274 bits (482), Expect = 5.390e-48
Identity = 109/278 (39.21%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQ--PLIEEIIMSCV 1347
            A+ + I +SK  RFLK+D ++G G +K V++G D +    VAWCE++ + + NK ++Q   +E E++  L HPN+V+ ++  +S      D+ G R   K +V+V ELM  GTLK  +K+        ++I ++  W  QIL  L ++H R  PP+IHRDLK +N F+         SVKIGD GLAT + + S   ++IGT  FMAPE+YEE YD  VD+YAFG+ +LE++T + PY +C N   +  K +    P+  S +    P I EII  C+
Sbjct:  265 AQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQ-ESKLNKTERQRFREEAEMLKDLQHPNIVRFYDYWESA-----DLCGKR---KYIVLVTELMTSGTLKMYLKR-----FKRINIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFIT----GTTGSVKIGDLGLAT-LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCI 522          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 190.274 bits (482), Expect = 5.395e-48
Identity = 109/278 (39.21%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQ--PLIEEIIMSCV 1347
            A+ + I +SK  RFLK+D ++G G +K V++G D +    VAWCE++ + + NK ++Q   +E E++  L HPN+V+ ++  +S      D+ G R   K +V+V ELM  GTLK  +K+        ++I ++  W  QIL  L ++H R  PP+IHRDLK +N F+         SVKIGD GLAT + + S   ++IGT  FMAPE+YEE YD  VD+YAFG+ +LE++T + PY +C N   +  K +    P+  S +    P I EII  C+
Sbjct:  267 AQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQ-ESKLNKTERQRFREEAEMLKDLQHPNIVRFYDYWESA-----DLCGKR---KYIVLVTELMTSGTLKMYLKR-----FKRINIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFIT----GTTGSVKIGDLGLAT-LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCI 524          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 190.274 bits (482), Expect = 5.631e-48
Identity = 109/278 (39.21%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQ--PLIEEIIMSCV 1347
            A+ + I +SK  RFLK+D ++G G +K V++G D +    VAWCE++ + + NK ++Q   +E E++  L HPN+V+ ++  +S      D+ G R   K +V+V ELM  GTLK  +K+        ++I ++  W  QIL  L ++H R  PP+IHRDLK +N F+         SVKIGD GLAT + + S   ++IGT  FMAPE+YEE YD  VD+YAFG+ +LE++T + PY +C N   +  K +    P+  S +    P I EII  C+
Sbjct:  265 AQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQ-ESKLNKTERQRFREEAEMLKDLQHPNIVRFYDYWESA-----DLCGKR---KYIVLVTELMTSGTLKMYLKR-----FKRINIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFIT----GTTGSVKIGDLGLAT-LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCI 522          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 190.274 bits (482), Expect = 6.042e-48
Identity = 109/278 (39.21%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQ--PLIEEIIMSCV 1347
            A+ + I +SK  RFLK+D ++G G +K V++G D +    VAWCE++ + + NK ++Q   +E E++  L HPN+V+ ++  +S      D+ G R   K +V+V ELM  GTLK  +K+        ++I ++  W  QIL  L ++H R  PP+IHRDLK +N F+         SVKIGD GLAT + + S   ++IGT  FMAPE+YEE YD  VD+YAFG+ +LE++T + PY +C N   +  K +    P+  S +    P I EII  C+
Sbjct:  320 AQEKPIDKSKNGRFLKFDEELGRGSFKTVFRGLDTETGVAVAWCELQ-ESKLNKTERQRFREEAEMLKDLQHPNIVRFYDYWESA-----DLCGKR---KYIVLVTELMTSGTLKMYLKR-----FKRINIKVLKSWCRQILKGLSFLHTR-NPPVIHRDLKCDNIFIT----GTTGSVKIGDLGLAT-LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPECFSRIPAQYPEIREIIDRCI 577          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0347540)

HSP 1 Score: 182.185 bits (461), Expect = 2.343e-45
Identity = 117/321 (36.45%), Postives = 169/321 (52.65%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIK--KNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF------QIAPVIVEPFSDDANKFIAVMKL 1473
            +A S C RF KYD ++G G +K VY+G D      VAWCE+  D +  K ++    +E +++ KL HPN+V+ +    ++W      +      K +V+V ELM  GTLK  +K  K  H  +       +  W  QIL  L ++H R Q PIIHRDLK +N F+         SVKIGD GLAT  N  S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+  ++ PY +C+   Q+  K +    P  ++ ++ P + +II  C+      RP+  EL E   F      ++ P   E F  D +  I   +L
Sbjct:  264 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCEL-LDKQVKKSERTRFREEADMLKKLQHPNIVRFY----TYW------EFPIGRKKNIVLVTELMLSGTLKSYLKRFKKIHPKV-------LKSWCRQILKGLNFLHTR-QFPIIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNR-SHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELLESEFFDEDIGIRVEPTASEQFLSDPSISIIEFRL 560          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0346818)

HSP 1 Score: 182.185 bits (461), Expect = 2.822e-45
Identity = 117/321 (36.45%), Postives = 169/321 (52.65%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIK--KNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF------QIAPVIVEPFSDDANKFIAVMKL 1473
            +A S C RF KYD ++G G +K VY+G D      VAWCE+  D +  K ++    +E +++ KL HPN+V+ +    ++W      +      K +V+V ELM  GTLK  +K  K  H  +       +  W  QIL  L ++H R Q PIIHRDLK +N F+         SVKIGD GLAT  N  S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+  ++ PY +C+   Q+  K +    P  ++ ++ P + +II  C+      RP+  EL E   F      ++ P   E F  D +  I   +L
Sbjct:  462 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCEL-LDKQVKKSERTRFREEADMLKKLQHPNIVRFY----TYW------EFPIGRKKNIVLVTELMLSGTLKSYLKRFKKIHPKV-------LKSWCRQILKGLNFLHTR-QFPIIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNR-SHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELLESEFFDEDIGIRVEPTASEQFLSDPSISIIEFRL 758          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0346819)

HSP 1 Score: 182.185 bits (461), Expect = 3.083e-45
Identity = 117/321 (36.45%), Postives = 169/321 (52.65%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIK--KNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF------QIAPVIVEPFSDDANKFIAVMKL 1473
            +A S C RF KYD ++G G +K VY+G D      VAWCE+  D +  K ++    +E +++ KL HPN+V+ +    ++W      +      K +V+V ELM  GTLK  +K  K  H  +       +  W  QIL  L ++H R Q PIIHRDLK +N F+         SVKIGD GLAT  N  S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+  ++ PY +C+   Q+  K +    P  ++ ++ P + +II  C+      RP+  EL E   F      ++ P   E F  D +  I   +L
Sbjct:  462 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCEL-LDKQVKKSERTRFREEADMLKKLQHPNIVRFY----TYW------EFPIGRKKNIVLVTELMLSGTLKSYLKRFKKIHPKV-------LKSWCRQILKGLNFLHTR-QFPIIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNR-SHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELLESEFFDEDIGIRVEPTASEQFLSDPSISIIEFRL 758          
BLAST of Protein kinase vs. Ensembl Fly
Match: Wnk (gene:FBgn0037098 transcript:FBtr0346817)

HSP 1 Score: 182.185 bits (461), Expect = 3.083e-45
Identity = 117/321 (36.45%), Postives = 169/321 (52.65%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIK--KNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF------QIAPVIVEPFSDDANKFIAVMKL 1473
            +A S C RF KYD ++G G +K VY+G D      VAWCE+  D +  K ++    +E +++ KL HPN+V+ +    ++W      +      K +V+V ELM  GTLK  +K  K  H  +       +  W  QIL  L ++H R Q PIIHRDLK +N F+         SVKIGD GLAT  N  S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+  ++ PY +C+   Q+  K +    P  ++ ++ P + +II  C+      RP+  EL E   F      ++ P   E F  D +  I   +L
Sbjct:  462 VAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCEL-LDKQVKKSERTRFREEADMLKKLQHPNIVRFY----TYW------EFPIGRKKNIVLVTELMLSGTLKSYLKRFKKIHPKV-------LKSWCRQILKGLNFLHTR-QFPIIHRDLKCDNIFITGTTG----SVKIGDLGLATLKNR-SHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPAQIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELLESEFFDEDIGIRVEPTASEQFLSDPSISIIEFRL 758          
BLAST of Protein kinase vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 99.7525 bits (247), Expect = 1.311e-20
Identity = 80/283 (28.27%), Postives = 141/283 (49.82%), Query Frame = 1
Query:  577 KIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTI-NHNSKRNTMIGTVGFMAPEVYEE-KYDTKVDIYAFGILMLEVMTNKTPYDDCR--NVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIA 1413
            +IG+G +  V+KG D +    VA   I  D E+ +++   + +EI ++ + D P V K +            + GT+     L I+ E +  G+   ++K    + + I  IL       ++L  L Y+H   +   +HRD+K+ N  L  Q +     VK+ DFG+A  + N  SKRNT +GT  +MAPEV ++ +YD K DI++ GI  +E+   + P  +     V  ++ K+     P  ++       ++ + +C++  P  RPTA+EL ++P  + A
Sbjct:   18 RIGKGSFGEVFKGIDNRTQQVVAIKII--DLEEAEDEIDDIQQEIMVLSQCDSPYVTKYYGSF---------LKGTK-----LWIIMEYLGGGSALDLMKAGSFEEMHIGIIL------REVLKGLDYLHSERK---LHRDIKAANVLLSEQGD-----VKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNN----PPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFIKKA 266          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: si:dkey-151g10.3 (si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-81])

HSP 1 Score: 206.068 bits (523), Expect = 2.880e-55
Identity = 144/436 (33.03%), Postives = 228/436 (52.29%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKI-ILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVN 1824
            A  + +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW  +   + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPI+HRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P     +  P ++EII  C+      R + ++L  H            F++D    + + +  D   KD     L L+I + + + +  K KD+  EA+  S+D+      N S  ++AL+      ++S     +    +  SIR ++  I K+    R RR+  +   + D S++T +
Sbjct:  126 AEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWESV---LRGK----KCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIVHRDLKCDNIF-ITGPTG---SVKIGDLGLATLMR-TSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFDKVNDPEVKEIIEGCIRQNRLERLSVKDLLNHAF----------FAEDTGVRVELAE-EDTGCKD----CLALRIWVEEPKKLKGKHKDN--EAIEFSYDL-----ENDSAEEVALEM-----VKSGFFHESDAKVVGKSIRDRVTLIKKS----RERRLLQHLDERRDSSVLTTS 508          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: si:dkey-151g10.3 (si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-81])

HSP 1 Score: 200.675 bits (509), Expect = 2.932e-54
Identity = 114/295 (38.64%), Postives = 168/295 (56.95%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            A  + +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW  +   + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPI+HRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P     +  P ++EII  C+      R + ++L  H  F
Sbjct:   89 AEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWESV---LRGK----KCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIVHRDLKCDNIF-ITGPTG---SVKIGDLGLATLMR-TSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFDKVNDPEVKEIIEGCIRQNRLERLSVKDLLNHAFF 361          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: CU041388.2 (pep chromosome:GRCz11:CHR_ALT_CTG23_1_26:25152826:25180312:1 gene:ENSDARG00000115009.1 transcript:ENSDART00000191552.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU041388.2)

HSP 1 Score: 201.445 bits (511), Expect = 5.689e-54
Identity = 114/295 (38.64%), Postives = 168/295 (56.95%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            A  + +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW  +   + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPI+HRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P     +  P ++EII  C+      R + ++L  H  F
Sbjct:  126 AEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SWESV---LRGK----KCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIVHRDLKCDNIF-ITGPTG---SVKIGDLGLATLMR-TSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFDKVNDPEVKEIIEGCIRQNRLERLSVKDLLNHAFF 398          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: wnk4b (WNK lysine deficient protein kinase 4b [Source:ZFIN;Acc:ZDB-GENE-131120-119])

HSP 1 Score: 208.764 bits (530), Expect = 2.016e-53
Identity = 117/293 (39.93%), Postives = 170/293 (58.02%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ 1407
            + +A S   RFLK++ +IG G +K VYKG D +   +VAWCE++       E+Q+   +E+E++  L HPN+V+ ++  KS    H          K +++V ELM  GTLK  +K+ F +    + + L+ +W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ +LE+ T++ PY +C+N  Q+  K      PD    +K P ++EII  C+      R T ++L EH  FQ
Sbjct:  168 KAVATSPDGRFLKFNIEIGRGSFKTVYKGLDTETTVEVAWCELQTRRLTKVERQR-FSEEVEMLKCLQHPNIVRFYDSWKSTMKGH----------KCIILVTELMTSGTLKTYLKR-FKE----MKLKLLQRWSNQILKGLHFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNAAQIYRKVTSGMKPDSFYKVKVPELKEIIEGCIRMNKDERYTIQDLLEHTFFQ 438          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: wnk1b (WNK lysine deficient protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2656])

HSP 1 Score: 204.912 bits (520), Expect = 4.194e-52
Identity = 123/317 (38.80%), Postives = 175/317 (55.21%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKG---LVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ-IAPVIVEPFSDDANKFIAV 1464
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW           + +KG   +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +  +S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R   ++L  H  FQ    V VE   +D  + IA+
Sbjct:  203 KAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSRSERQR--FKEEAGMLKGLQHPNIVRFYD---SW----------ESPSKGRKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRSSFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNPAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYAIKDLLNHAFFQEETGVRVELAEEDDGEMIAI 493          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: WNK3 (WNK lysine deficient protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:14543])

HSP 1 Score: 206.453 bits (524), Expect = 1.425e-52
Identity = 114/292 (39.04%), Postives = 167/292 (57.19%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            + +A S   RFLK+D ++G G +K V+KG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW      + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII SC+      R + +EL  H  F
Sbjct:  133 KAVATSPSGRFLKFDIELGRGAFKTVFKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW---ESSLKG----KKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLATLM-RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVSDPEVKEIIESCIRQNKAERLSIKELLNHAFF 402          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: WNK3 (WNK lysine deficient protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:14543])

HSP 1 Score: 206.453 bits (524), Expect = 1.697e-52
Identity = 114/292 (39.04%), Postives = 167/292 (57.19%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            + +A S   RFLK+D ++G G +K V+KG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW      + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII SC+      R + +EL  H  F
Sbjct:  133 KAVATSPSGRFLKFDIELGRGAFKTVFKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW---ESSLKGK----KCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLATLM-RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVSDPEVKEIIESCIRQNKAERLSIKELLNHAFF 402          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: WNK1 (LIM domain transcription factor LMO4.1 [Source:UniProtKB/Swiss-Prot;Acc:Q5FVB2])

HSP 1 Score: 191.045 bits (484), Expect = 1.074e-47
Identity = 109/253 (43.08%), Postives = 155/253 (61.26%), Query Frame = 1
Query:  556 RFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSK--SMGRYLPDVISN 1305
            RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ + ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +  S+  YL D++++
Sbjct:  182 RFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW-------ESTLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKLKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSVSAYLQDLLNH 411          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gna13 (guanine nucleotide binding protein (G protein), alpha 13 [Source:Xenbase;Acc:XB-GENE-6257775])

HSP 1 Score: 149.828 bits (377), Expect = 8.084e-38
Identity = 91/228 (39.91%), Postives = 128/228 (56.14%), Query Frame = 1
Query:  667 HEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCV 1347
            ++D   K++  FKE   MLK L HPN+V+ ++  +S       + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P     +  P I+EII  C+
Sbjct:   22 YKDPAPKKRQRFKEEAEMLKGLQHPNIVRFYDFWESC------LKGK----KYIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLMFLHTRT-PPIIHRDLKCDNIFI----TGPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASFDKVADPEIKEIIGECI 228          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: gna13 (guanine nucleotide binding protein (G protein), alpha 13 [Source:Xenbase;Acc:XB-GENE-6257775])

HSP 1 Score: 149.443 bits (376), Expect = 3.677e-35
Identity = 87/221 (39.37%), Postives = 124/221 (56.11%), Query Frame = 1
Query:  685 KQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCV 1347
            K+Q   +E E++  L HPN+V+ ++  +S       + G     K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P     +  P I+EII  C+
Sbjct:   11 KRQRFKEEAEMLKGLQHPNIVRFYDFWESC------LKGK----KYIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLMFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASFDKVADPEIKEIIGECI 210          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk3 (WNK lysine deficient protein kinase 3 [Source:MGI Symbol;Acc:MGI:2652875])

HSP 1 Score: 203.756 bits (517), Expect = 1.906e-54
Identity = 114/290 (39.31%), Postives = 166/290 (57.24%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+      R + ++L  H  F
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LMRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFF 404          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk3 (WNK lysine deficient protein kinase 3 [Source:MGI Symbol;Acc:MGI:2652875])

HSP 1 Score: 205.682 bits (522), Expect = 2.268e-52
Identity = 113/290 (38.97%), Postives = 165/290 (56.90%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+      R + ++L  H  F
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLATLM-RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFF 404          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk3 (WNK lysine deficient protein kinase 3 [Source:MGI Symbol;Acc:MGI:2652875])

HSP 1 Score: 205.297 bits (521), Expect = 2.508e-52
Identity = 113/290 (38.97%), Postives = 165/290 (56.90%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+      R + ++L  H  F
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLATLM-RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFF 404          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk3 (WNK lysine deficient protein kinase 3 [Source:MGI Symbol;Acc:MGI:2652875])

HSP 1 Score: 205.297 bits (521), Expect = 2.810e-52
Identity = 113/290 (38.97%), Postives = 165/290 (56.90%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+      R + ++L  H  F
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLATLM-RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFF 404          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Wnk1 (WNK lysine deficient protein kinase 1 [Source:MGI Symbol;Acc:MGI:2442092])

HSP 1 Score: 205.682 bits (522), Expect = 3.162e-52
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q80XP9|WNK3_MOUSE (Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3)

HSP 1 Score: 205.297 bits (521), Expect = 1.754e-51
Identity = 113/290 (38.97%), Postives = 165/290 (56.90%), Query Frame = 1
Query:  535 IAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            +A S   RFLK+D ++G G +K VYKG D +   +VAWCE++ D +  K +QQ   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+      R + ++L  H  F
Sbjct:  137 VATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQ-DRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTLKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKPKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLATLM-RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFF 404          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9JIH7|WNK1_RAT (Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 1.955e-51
Identity = 114/293 (38.91%), Postives = 167/293 (57.00%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ 1407
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTRT-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ 480          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q6R2V0|WNK1_PIG (Serine/threonine-protein kinase WNK1 OS=Sus scrofa OX=9823 GN=WNK1 PE=2 SV=3)

HSP 1 Score: 205.682 bits (522), Expect = 2.211e-51
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  208 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 528          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P83741|WNK1_MOUSE (Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 2.212e-51
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9H4A3|WNK1_HUMAN (Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 2.950e-51
Identity = 132/361 (36.57%), Postives = 193/361 (53.46%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAP-VIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFIND-KSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++ D +  K ++Q   +E E++  L HPN+V+ ++   SW       + T    K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L+++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + IA+                  K+ L+ E I   K K    EA+  SFD+ +
Sbjct:  210 KAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQ-DRKLTKSERQRFKEEAEMLKGLQHPNIVRFYD---SW-------ESTVKGKKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLQFLHTR-TPPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAI------------------KLWLRIEDIKKLKGKYKDNEAIEFSFDLER 530          
BLAST of Protein kinase vs. TrEMBL
Match: A0A0R3TYD5 (Protein kinase domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12858 PE=4 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 1.366e-123
Identity = 216/505 (42.77%), Postives = 319/505 (63.17%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ--IAPVIVEP-FSDDANKFIAVMKLMDNLSKDEVL-PILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKK---------NNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEKNVNENDNSENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQI 1995
            A+ RVI  SK  R+LK   KIGEGGYK VY+G+DR +  +VAWCE K +H D KEK+Q MF+E EIMLKL+HPN+V+C++V + W  I ++      + KGL+IVQELM+EGTLK MIKKNF +G CIL   LI +WW+QILD LRY+H   + PIIHRDLKSENCFL    NDD ++VK+GDFGLAT +  +S R TM+GTVGFMAPE+++E YD KVDIYAFG+LMLEVMTN+TPYD+C  +    +K+M  + P+++  +  P I  +I +C+HP+ C+RPTAEEL  HPLFQ  + PV VEP +   A++   + + + +L+  E   P  +L++  +   +  +      E++    DIYK+   ++  L   L+   E ++  + +           N LD+L  SIR+Q+Q+++K ++G RW+ I D+    E  + +  +  E +     + + + +S    + +N E      S + K  ++L+ EI +Y + + +
Sbjct:  133 AKQRVIGYSKGGRWLKNSVKIGEGGYKFVYRGYDRHDAKNVAWCEFKHEHVDTKEKRQVMFRETEIMLKLNHPNIVQCYDVFREW--ISEETVDNPIDEKGLIIVQELMSEGTLKQMIKKNFVNGECILKFQLIVRWWHQILDALRYLHVHCEEPIIHRDLKSENCFLYGTSNDDYINVKVGDFGLATQVG-SSGRKTMLGTVGFMAPEIFDEMYDEKVDIYAFGMLMLEVMTNRTPYDECATLIDAAAKTMSGHGPEIMHLINNPNIAVVISACIHPLACFRPTAEELFCHPLFQPKVMPVEVEPNYEPGADRAEVLERFVKSLANTETRNPRFNLRLRFRDRKMLQELGLDDGESLEFDLDIYKAEDQDIPDLISNLRRDYEDKLSRAFENPKITDRKIITNSLDRLFNSIRMQMQFLVKCLLGRRWKDILDSLTTTEKAAAVK-SKPEGVEGGNPDSSSDSDSNISDVCSNFEIIAKCKSKWSKAKRMLDREIMTYRRAAAL 633          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4Z2CUI9 (Serine/threonine-protein kinase WNK4 OS=Schistosoma japonicum OX=6182 GN=EWB00_007465 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 4.515e-123
Identity = 223/509 (43.81%), Postives = 334/509 (65.62%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ--IAPVIVEPFSDDANKFIAVM-KLMDNLSKDEVL-PILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEI-------QSSIKK--NNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEKN-----VNENDNSENPKLTNNLEEYNFNV-----SMYHKTTKVLNSEIESY 1977
            A+ ++ A+SKC R++K++ KIGEGGYK VY+G+D     +VAWCE KR+H D KEK+Q+MF+E EIMLK++HP++V+CF+V + W  + D  +  + E KG+VI+QELM EGTLK +I+KNF DG CIL   LIT+WW+QILD LRYMH +IQPPI+HRDLK++NCFL    +++ ++VK+GDFGLAT ++ NS R TM+GT+GFMAPE+++EKYD KVDIYAFG+LMLEVMTN+TPYD+C  V QV +K+M    PD++  +  P + E+I +C+ P+ C+RPTA+EL  HPLFQ    PV VEP  D+A     V+ + + +L   E   P  +L++  + + +  +      E++    DIYK+   ++  L   L+   E ++       +   KK  +N LDKL +SIRLQ+Q+++K ++G+RW+ I D+ +             ++ P  +K      V+E+D S+    T+  +  +F +     S +++  K+L  EI +Y
Sbjct:  141 AKQKISAKSKCSRWIKHNLKIGEGGYKFVYRGYDSVEARNVAWCEFKREHVDTKEKRQAMFRETEIMLKMNHPHIVRCFDVFREWIDMEDPNN--QIEEKGVVIIQELMGEGTLKSVIRKNFLDGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVS-NSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVLQVAAKTMSGQGPDIMQMVSNPSLREVISACIQPLTCFRPTADELYFHPLFQPKTLPVEVEPNYDNATDRAEVLDRFVRSLGNPETRNPNFNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKIVSNHLDKLFSSIRLQMQFLVKVLLGKRWKAILDSLV-------------QDQPVRKKQDGASAVDEDDESD----TDAYDTSSFTIIGKYKSKWNRAKKLLEKEIHAY 629          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5K4F2J6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 6.421e-123
Identity = 222/509 (43.61%), Postives = 332/509 (65.23%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ--IAPVIVEPFSDDANKFIAVM-KLMDNLSKDEVL-PILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQ---------LDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEK-----NVNENDNSENPKLTNNLEEYNFNV-----SMYHKTTKVLNSEIESY 1977
            A+ +V A+SKC R++K++ KIGEGGYK VY+G+D     +VAWCE KR+H D KEK+Q+MF+E EIMLK++HP++V+CF+V + W  + D  +  + E KG+VI+QELM EGTLK +I+KNF DG CIL   LIT+WW+QILD LRYMH +IQPPI+HRDLK++NCFL    +++ ++VK+GDFGLAT ++ NS R TM+GT+GFMAPE+++EKYD KVDIYAFG+LMLEVMTN+TPYD+C  V QV +K+M    PD++  +  P + E+I +C+ P+ C+RPTA+EL  HPLFQ    PV VEP  D+A     V+ + + +L   E   P  +L++  + + +  +      E++    DIYK+   ++  L   L+   E ++    +   Q         LDKL +SIRLQ+Q+++K ++G+RW+ I D+ +             ++ P  +K      V+E+D S+    T+  +  +F +     S +++  K+L  EI++Y
Sbjct:  141 AKQKVSAKSKCSRWIKHNLKIGEGGYKFVYRGYDSVEARNVAWCEFKREHVDTKEKRQAMFRETEIMLKMNHPHIVRCFDVFREWIDMEDPNN--QIEEKGVVIIQELMGEGTLKSVIRKNFLDGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVS-NSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVLQVAAKTMSGQGPDIMQMVSNPSLREVISACIQPLTCFRPTADELYFHPLFQPKTLPVEVEPNYDNATDRAEVLDRFVRSLGNPETRNPNFNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKVVSSHLDKLFSSIRLQMQFLVKVLLGKRWKAILDSLV-------------QDQPVRKKQEGASTVDEDDESD----TDAYDTSSFTIIGKYKSKWNRAKKLLEKEIQAY 629          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4S2M643 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002431 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 1.713e-122
Identity = 212/444 (47.75%), Postives = 302/444 (68.02%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ--IAPVIVEPFSDDANKFIAVM-KLMDNLSKDEVL-PILDLKIILK-----TEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQ---------LDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNK 1797
            A+ RV A+SKC R++K++ KIGEGGYK VY+G+D     +VAWCE KR+H D KEK+Q MFKE EIMLK++HP++V+CF+V + W  + D  +  + E KG+VI+QELM EGTLK +I+KNF +G CIL   LIT+WW+QILD LRYMH +IQPPI+HRDLK++NCFL    +++ ++VK+GDFGLAT +N NS R TM+GT+GFMAPE+++EKYD KVDIYAFG+LMLEVMTN+TPYD+C  V QV +K+M    PD++  +  P + E+I +C+ P+ C+RP+AEEL  HPLFQ    PV VEP  D+A     V+ + + +L   E   P  +L++  +      E   D  +  +F+      DIYK+   ++  L   L+   E ++    +   Q         LDKL  SIRLQ+Q+++K ++G+RW+ I D+ +++
Sbjct:  148 AKQRVSAKSKCGRWIKHNLKIGEGGYKFVYRGYDTVEARNVAWCEFKREHVDTKEKRQQMFKETEIMLKMNHPHIVRCFDVFREWIDMEDPNN--QIEEKGVVIIQELMGEGTLKSVIRKNFLEGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVN-NSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVMQVAAKTMSGQGPDIMDKVLNPSLREVISACIQPLTCFRPSAEELYFHPLFQPKTLPVEVEPNYDNATDRAEVLDRFVRSLDVAETRNPNFNLRLRFRDKKMLQELGLDDGESLEFD-----LDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKIVSSHLDKLFNSIRLQMQFLVKVLLGKRWKAILDSLVDE 583          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5K4F284 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 6.757e-122
Identity = 222/518 (42.86%), Postives = 332/518 (64.09%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ-----------IAPVIVEPFSDDANKFIAVM-KLMDNLSKDEVL-PILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQ---------LDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEK-----NVNENDNSENPKLTNNLEEYNFNV-----SMYHKTTKVLNSEIESY 1977
            A+ +V A+SKC R++K++ KIGEGGYK VY+G+D     +VAWCE KR+H D KEK+Q+MF+E EIMLK++HP++V+CF+V + W  + D  +  + E KG+VI+QELM EGTLK +I+KNF DG CIL   LIT+WW+QILD LRYMH +IQPPI+HRDLK++NCFL    +++ ++VK+GDFGLAT ++ NS R TM+GT+GFMAPE+++EKYD KVDIYAFG+LMLEVMTN+TPYD+C  V QV +K+M    PD++  +  P + E+I +C+ P+ C+RPTA+EL  HPLFQ             PV VEP  D+A     V+ + + +L   E   P  +L++  + + +  +      E++    DIYK+   ++  L   L+   E ++    +   Q         LDKL +SIRLQ+Q+++K ++G+RW+ I D+ +             ++ P  +K      V+E+D S+    T+  +  +F +     S +++  K+L  EI++Y
Sbjct:  141 AKQKVSAKSKCSRWIKHNLKIGEGGYKFVYRGYDSVEARNVAWCEFKREHVDTKEKRQAMFRETEIMLKMNHPHIVRCFDVFREWIDMEDPNN--QIEEKGVVIIQELMGEGTLKSVIRKNFLDGQCILKFPLITRWWHQILDALRYMHHKIQPPILHRDLKADNCFLYGASDEEYLNVKVGDFGLATHVS-NSGRKTMLGTLGFMAPEIFDEKYDEKVDIYAFGMLMLEVMTNRTPYDECETVLQVAAKTMSGQGPDIMQMVSNPSLREVISACIQPLTCFRPTADELYFHPLFQKYQEGNDSWPKTLPVEVEPNYDNATDRAEVLDRFVRSLGNPETRNPNFNLRLRFRDKKMLQELGLDDGESLEFDLDIYKAEDQDIPDLIHNLRLGYEDKLWRVFENPKQPDKKVVSSHLDKLFSSIRLQMQFLVKVLLGKRWKAILDSLV-------------QDQPVRKKQEGASTVDEDDESD----TDAYDTSSFTIIGKYKSKWNRAKKLLEKEIQAY 638          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: wnk4b (serine/threonine-protein kinase WNK4-like [Source:NCBI gene;Acc:103036582])

HSP 1 Score: 215.312 bits (547), Expect = 1.725e-55
Identity = 117/293 (39.93%), Postives = 172/293 (58.70%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ 1407
            + +A S   RFLK++ +IG G +K VYKG D +   +VAWCE++       E+Q+   +E+E++  L HPN+V+ ++  KS    H          K +++V ELM  GTLK  +K+ F +    + + L+ +W +QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ +LE+ T++ PY +C+N  Q+  K      PD    ++ P ++EII  C+      R T ++L EHP FQ
Sbjct:  191 KAVATSPDGRFLKFNVEIGRGSFKTVYKGLDTETTVEVAWCELQTRRLTKVERQR-FSEEVEMLKGLQHPNIVRFYDSWKSTVKGH----------KCIILVTELMTSGTLKTYLKR-FKE----MKLKLLQRWSHQILKGLHFLHTRA-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNAAQIYRKVTSGIKPDSFFKVRVPELKEIIEGCIRMNKAERYTIQDLLEHPFFQ 461          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000001896.2 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 202.986 bits (515), Expect = 9.554e-52
Identity = 138/364 (37.91%), Postives = 197/364 (54.12%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKG---LVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ-IAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW           + +KG   +V+V ELM  GTLK  +K+ F +    + I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + +A+ KL         L I D+K       +  K KD+  EA+  SFD++K
Sbjct:  199 KAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW----------ESPSKGKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTR-SPPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEVVAI-KLW--------LRIEDVKK------LKGKYKDN--EAIEFSFDLHK 519          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000050296.1 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 202.986 bits (515), Expect = 1.072e-51
Identity = 138/364 (37.91%), Postives = 197/364 (54.12%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKG---LVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ-IAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW           + +KG   +V+V ELM  GTLK  +K+ F +    + I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + +A+ KL         L I D+K       +  K KD+  EA+  SFD++K
Sbjct:  199 KAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW----------ESPSKGKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTR-SPPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEVVAI-KLW--------LRIEDVKK------LKGKYKDN--EAIEFSFDLHK 519          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000052131.1 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 202.986 bits (515), Expect = 1.080e-51
Identity = 138/364 (37.91%), Postives = 197/364 (54.12%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKG---LVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ-IAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW           + +KG   +V+V ELM  GTLK  +K+ F +    + I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + +A+ KL         L I D+K       +  K KD+  EA+  SFD++K
Sbjct:  199 KAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW----------ESPSKGKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTR-SPPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEVVAI-KLW--------LRIEDVKK------LKGKYKDN--EAIEFSFDLHK 519          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000041214.1 (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:103038802])

HSP 1 Score: 202.986 bits (515), Expect = 1.155e-51
Identity = 138/364 (37.91%), Postives = 197/364 (54.12%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKG---LVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ-IAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYK 1605
            + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW           + +KG   +V+V ELM  GTLK  +K+ F +    + I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ    V VE   +D  + +A+ KL         L I D+K       +  K KD+  EA+  SFD++K
Sbjct:  199 KAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW----------ESPSKGKKYIVLVTELMTSGTLKTYLKR-FKE----MKIKVLRSWCRQILKGLHFLHTR-SPPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEVVAI-KLW--------LRIEDVKK------LKGKYKDN--EAIEFSFDLHK 519          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001965.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 1.086e-36
Identity = 90/248 (36.29%), Postives = 137/248 (55.24%), Query Frame = 1
Query:  661 RDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF 1404
            +D + +K ++Q   +E +++  L HP++V+ ++   SW       + T      +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L ++H R  PPIIHRDLK +N F +  P     SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+      R + ++L  H  F
Sbjct:    2 QDRKLSKPEKQRFREEADMLKGLQHPSIVRFYD---SW-------ESTLKGKHSIVLVTELMTSGTLKTYLKR-----FKVMKTKVLQSWCRQILKGLHFLHTRT-PPIIHRDLKCDNIF-ITGPTG---SVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEHYDEAVDVYAFGMCMLEMATSEYPYSECQNPAQIYRKVTTGVKPASFNKVAMPELKEIIEGCIRTNKDERYSIKDLLNHGFF 228          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001973.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57290:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001973.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 9.505e-36
Identity = 85/229 (37.12%), Postives = 129/229 (56.33%), Query Frame = 1
Query:  661 RDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCV 1347
            +D + +K ++Q   +E +++  L HP++V+ ++   SW       + T      +V+V ELM  GTLK  +K+       ++   ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEE YD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  K      P   + +  P ++EII  C+
Sbjct:    2 QDRKLSKPEKQRFREEADMLKGLQHPSIVRFYD---SW-------ESTLKGKHSIVLVTELMTSGTLKTYLKR-----FKVMKTKVLQSWCRQILKGLHFLHTRT-PPIIHRDLKCDNIFI----TGPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEHYDEAVDVYAFGMCMLEMATSEYPYSECQNPAQIYRKVTTGVKPASFNKVAMPELKEIIEGCI 209          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006100.1 (pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 gene:ENSPMAG00000005510.1 transcript:ENSPMAT00000006100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 2.555e-20
Identity = 72/271 (26.57%), Postives = 125/271 (46.13%), Query Frame = 1
Query:  580 IGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYE-EKYDTKVDIYAFGILMLEVMTNKTPYDDCRN-VFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEEL 1386
            +G G + +V K   R    DVA  +I+ + E     +++   E+  + +++HPN+V+ +    +                 + +V E    G+L  ++     + L         +W  Q    + Y+HC     +IHRDLK  N  L+         +KI DFG A  I  +   N   G+  +MAPEV+E   Y  K D++++GI++ EV+T + P+D+     F+++        P +I NL +P IE ++  C    P  RP+ EE+
Sbjct:   32 VGRGAFGVVCKAKWRGM--DVAIKQIESESE-----RKAFIVELRQLSRVNHPNIVRLYGACLN----------------PVCLVMEYAEGGSLYNVLHGA--EPLPYYTAAHAMRWCLQCAQGVAYLHCMKPKALIHRDLKPPNLLLI----SGGTILKICDFGTACDIQTHMTNNK--GSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKP-IEGLMTRCWDKEPALRPSMEEI 270          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 94.7449 bits (234), Expect = 1.042e-19
Identity = 78/305 (25.57%), Postives = 146/305 (47.87%), Query Frame = 1
Query:  529 RVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFN---VLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHN-SKRNTMIGTVGFMAPEVYEE-KYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRY---LPDVISNLKQ--PLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIA 1413
            +V+       +L+   KIGEG   +V    DR++   VA   +K+ H   +++++ +F E+ IM +  H NVV  +N   V    W++ + ++G    A   ++    MNE  +           +C+            +L  L Y+H +    +IHRD+KS++  L          +K+ DFG    ++   ++R +++GT  +MAPEV     Y  +VD+++ GI+++E++  + PY +     +   ++M R    +P  + N+++  PL+   +   +   P  R TA EL +HP  Q A
Sbjct:  408 QVVDPGDPSEYLENFIKIGEGSTGVVCLAVDRRSGRQVA---VKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVADELWVVMEFLEGG---ALTDIVTHTRMNEEQIAT---------VCV-----------SVLRALAYLHGQG---VIHRDIKSDSILLTAD-----GRIKLSDFGFCAQVSKEVTRRKSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFN-----EPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQNA 673          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: nrbp1 (nuclear receptor binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-041001-146])

HSP 1 Score: 91.6633 bits (226), Expect = 1.198e-19
Identity = 88/311 (28.30%), Postives = 143/311 (45.98%), Query Frame = 1
Query:  532 VIAESKCQRFLKYDCKIGEG---GYKLVYKGFDRKNCCDVAWCEI----KRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGD--------FGLATTINHNSKRNTMIGTVGFMAPEVYE-EKYDTKVDIYAFGILMLEVMTNK-TPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHP-LFQI 1410
            ++ ES C R+ K   ++ +    G    Y G D +   +V W E+    +R+++  +EK +++F     ++ L+H N+VK  N    +W      D   ++A+ ++ + E M+ G+LK  +KK   +    ++     +W  QIL  L Y+H  + PPIIH +L  E  F+  Q N     +KIG                +H          + F+APE  +     T VDIY+FG+  LE+   +  P  D   V Q   ++        I +L+ PL  E I  C+ P    RPTA EL  HP LF++
Sbjct:   28 ILEESPCGRWQKRREEVSQRNVPGIDSAYLGMDTEEGVEVVWNEVQFSERRNYKAQEEKIKTVFNN---LIHLEHANIVKFHN----YW-----ADIKESKAR-VIFITEYMSSGSLKQFLKKTKKNHKT-MNEKAWKRWCTQILSALGYLHSFV-PPIIHANLTCETIFM--QHNG---LIKIGSEWYQMKRRLAPGAINDHVKTFRAEQKDLHFLAPEYADLAGMTTAVDIYSFGMCALEMAVLEIQPNGDSTVVSQEAVQA-------AIGSLEDPLQREFIQRCLCPEAPGRPTARELLFHPALFEV 311          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 95.9005 bits (237), Expect = 4.384e-20
Identity = 69/222 (31.08%), Postives = 112/222 (50.45%), Query Frame = 1
Query:  574 CKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINH-NSKRNTMIGTVGFMAPEVYEEK-YDTKVDIYAFGILMLEVMTNKTPY 1233
             KIG+G    VY  ++      VA   IK+ + + + K++ +  EI +M    HPN+V   N + S+ +  D           L ++ E M  G+L  ++        CIL    I     + L  L ++H +    ++HRD+KS+N  L ++ +     +K+ DFG    IN  N KR TM+GT  +MAPEV   K Y  KVDI++ GI+++E++  + PY
Sbjct:  624 VKIGQGASGGVYTAYEIGTNVSVA---IKQMNLEKQPKKELIINEILVMKGSKHPNIV---NFIDSYVLKGD-----------LWVIMEYMEGGSLTDVVTH------CILTEGQIGAVCRETLSGLEFLHSKG---VLHRDIKSDNILLSMEGD-----IKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 814          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 91.2781 bits (225), Expect = 9.359e-19
Identity = 78/260 (30.00%), Postives = 121/260 (46.54%), Query Frame = 1
Query:  679 KEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKK-----NFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGL-ATTINHNSKRNTMIGTVGFMAPEVYEEK-YDTKVDIYAFGILMLEVMTNKTPY---DDCRNVFQVVSKSMGRYLPDVISNLKQP-----LIEEIIMSCVHPIPCYRPTAEELCEHPLFQIA 1413
            + +++ +  EI +M    H N+V   N L+++    DD          L +V E M  G+L  +I+      N H  L    I  I +   Q L  L   H      IIHRD+KS+N  L     D    VKI DFG  A   +  SKR TM+GT  +MAPEV +++ YD K+D+++ GI+ +E++  + PY   D  + ++ + +    +        LK P      I+  +  C+     YR + EEL  H  F +A
Sbjct:  601 QPRKELIVNEILVMKDSRHKNIV---NFLEAYLRTDDD----------LWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKH------IIHRDIKSDNVLL-----DTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPK--------LKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFNMA 828          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 88.1965 bits (217), Expect = 9.344e-18
Identity = 77/288 (26.74%), Postives = 136/288 (47.22%), Query Frame = 1
Query:  541 ESKCQRFLKYDCK--IGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEK-YDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEH 1395
            +   ++ ++Y  K  IG G Y +VYK  ++     VA   IK    +N E+   +  EI ++  L+H N+VK    ++              ++  L I+ E    G+L+ +I ++   GL   +      +  Q L  L+Y+H      +IHRD+K+ N  L         +VK+ DFG++T +  NS   T+ GT+ +MAPE+   +   T  DI++ G  ++E++T   PY +  +     +     Y P   S+  +PL ++ +  C       RPTA++L +H
Sbjct:   16 QRASEKSVQYHLKQVIGRGSYGVVYKAINKHTDQVVA---IKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIR--------------KSYELYILLEYCANGSLRRLISRS-STGLSENE---SKTYVTQTLLGLKYLHGE---GVIHRDIKAANILLSADN-----TVKLADFGVSTIV--NSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPP--SSFSEPL-KDFLSKCFVKNMYKRPTADQLLKH 269          
BLAST of Protein kinase vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 81.6481 bits (200), Expect = 7.933e-17
Identity = 80/299 (26.76%), Postives = 139/299 (46.49%), Query Frame = 1
Query:  577 KIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATT--INHNSKRNTMIGTVGFMAPEVY--EEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQI-APVIVEPFSDDANKFI 1458
            K+G G Y  VYKG ++     VA  E+K D E+      +  +EI +M +L H N+V+ ++V      IH       TE K L +V E M+    K M  +   +    L++ L+  + +Q+L  L + H   +  I+HRDLK +N  +     +    +K+GDFGLA    I  N+  + ++ T+ + AP+V      Y T +DI++ G ++ E++T K  +    +  Q+      + + D++         E +   V  +P Y P  ++     L Q+  P   EP   +   F+
Sbjct:   12 KLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTP--STAIREISLMKELKHENIVRLYDV------IH-------TENK-LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCH---ENKILHRDLKPQNLLI-----NKRGQLKLGDFGLARAFGIPVNTFSSEVV-TLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQL------KLIFDIMGT-----PNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFL 274          
BLAST of Protein kinase vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 82.0333 bits (201), Expect = 1.382e-16
Identity = 52/187 (27.81%), Postives = 96/187 (51.34%), Query Frame = 1
Query:  688 QQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKN--FHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEK-YDTKVDIYAFGILMLEVMTNKTPYDD 1239
            Q+   +E+EI   L+HPN+ K +         HD+        K + ++ E +  G +  +++ +  F+D       +L + + YQI + L YMH +    IIHRD+K EN  +          +K+ DFG +      ++R T+ GT+ +++PE+ E + YD  +D +A G+L  E++T   P+++
Sbjct:  146 QKQFRREVEIQTSLNHPNLTKSYGYF------HDE--------KRVYLLMEYLVNGEMYKLLRLHGPFND-------ILASDYIYQIANALDYMHKKN---IIHRDIKPENILIGFN-----NVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEE 303          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 97.8265 bits (242), Expect = 6.171e-22
Identity = 76/268 (28.36%), Postives = 131/268 (48.88%), Query Frame = 1
Query:  577 KIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINH-NSKRNTMIGTVGFMAPE-VYEEKYDTKVDIYAFGILMLEVMTNKTP-YDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRP 1371
            KIG G + +VYK     N   VA  +I+     + + +Q   KEI+++ +L+HPNV+K +               +  E   L IV EL + G L  MI K+F     ++    + K++ Q+   L +MH R    ++HRD+K  N F+          VK+GD GL    +   +  ++++GT  +M+PE + E  Y+ K DI++ G L+ E+   ++P Y D  N++ +  K      P + +      +  ++  C++PIP  RP
Sbjct:   26 KIGRGQFSVVYKARCTANNQIVALKKIQIFDMMDAKARQDCIKEIDLLKQLNHPNVIKYY--------------ASFIENNELNIVLELADAGDLSRMI-KHFKKQKRLIPERTVWKYFVQLTAALEHMHSR---RVMHRDIKPANVFITATG-----VVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPAEHYSQQLRHLVSLCINPIPDQRP 270          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 96.6709 bits (239), Expect = 2.101e-21
Identity = 79/288 (27.43%), Postives = 134/288 (46.53%), Query Frame = 1
Query:  577 KIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHN-SKRNTMIGTVGFMAPEVYEEK-YDTKVDIYAFGILMLEVMTNKTPY---------DDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ 1407
            KIGEG   +V    D++    VA   +K+     +++++ +F E+ IM    HPN+V              +M G+      L +V E +  GTL  ++    H  L    +  + +    +L  L ++H +    +IHRD+KS++  L         +VK+ DFG    +  +  +R +++GT  +MAPEV   K Y T+VDI++ GI++LE++  + PY            R++    S++  +  P + S L   LI +         P YR TA EL  HP  +
Sbjct:   34 KIGEGSTGIVCLATDKRTGRQVA---VKKMDLKKQQRRELLFNEVVIMRDYPHPNIV--------------EMYGSHLVGDELWVVMEFLEGGTLTDIVT---HTNLSEEQVACVCR---AVLKALTFLHSQ---GVIHRDIKSDSILLTSNG-----TVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRD---------PLYRATAFELLNHPFIR 281          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 95.9005 bits (237), Expect = 2.917e-21
Identity = 78/277 (28.16%), Postives = 135/277 (48.74%), Query Frame = 1
Query:  577 KIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPP-IIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSK-RNTMIGTVGFMAPE-VYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHP 1398
            +IG G Y +  K   +K+   + W E+        EKQ  +  E+ ++ +L HP++V+ ++ +         +D T T    + IV E    G L  +IKK+  +     + L + K  YQ++  ++  H R     ++HRDLK  N FL     D  ++VK+GDFGLA  ++H++    T +GT  +M+PE V +  Y+ K DI++ G LM E+     P+     +       +GR+ P  I +     + ++I S +      RP+ +EL  +P
Sbjct:   14 RIGSGSYGICKKIRRKKDNKVLVWKELDYGQMSETEKQM-LVSEVNLLRELKHPHIVRYYDRI---------IDRTNTT---IYIVMEFCENGDLGALIKKHKREKRYTAEDL-VWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFL-----DANMNVKLGDFGLARVLSHDTSFAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPFTAMDQIRLEAKIKVGRFHP--IPSHYSSSLSQLINSMLQVNDEMRPSIDELLRNP 269          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 96.2857 bits (238), Expect = 3.592e-21
Identity = 99/335 (29.55%), Postives = 159/335 (47.46%), Query Frame = 1
Query:  577 KIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHN-SKRNTMIGTVGFMAPEVYEE-KYDTKVDIYAFGILMLEVMTNKTPYDDC---RNVFQVVSKSMGRYLPDVISNLKQ--PLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSK 1560
            K+GEG Y  V+K   +++   VA  ++  D +      Q + KEI +M + D P VVK +              G+  +   L IV E    G++  ++K   +  L   +I  + K+    L  L Y+H R +   IHRD+K+ N  L  + +      K+ DFG+A  +    +KRNT+IGT  +MAPEV +E  YD   DI++ GI  +E+   K PY D    R +F + +K      P    +  Q     ++ +  C+   P  R TA EL +H   Q A  I    S    + + +M+  +N   DE+  +  ++II K+  I+DKS+
Sbjct:   29 KLGEGSYGSVFKAMHKESGQVVAIKQVPVDTD-----LQEIIKEISMMQQCDSPYVVKYY--------------GSYFKNTDLWIVMEYCGAGSVSDLMKIR-NKTLTEEEIKCVLKY---TLKGLEYLHLRRK---IHRDIKAGNILLNSEGH-----AKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKP-----PPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQI-SILSSMIQEALTIME-EENARDDEIAYL--IQIICKSS-IHDKSQ 322          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 97.4413 bits (241), Expect = 3.788e-20
Identity = 77/292 (26.37%), Postives = 132/292 (45.21%), Query Frame = 1
Query:  580 IGEGGYKLVYKGFDRKNCC-----DVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKK--NFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFG----LATTINHNSK-RNTMIGTVGFMAPEVYE-EKYDTKVDIYAFGILMLEVMTNKTPYD--DCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQI 1410
            +G G +   Y   D           V++C   +  +D  +  Q++  EI I+ +L HP+++KC               G         I  E M  G++  ++ K   F + + I       ++  QIL  + Y+H   +  ++HRD+K  N  LV     D   ++I DFG    LAT I    + +  ++GT+ FMAPEV   E Y    D+++ G +++E+ T K P++  +  N   ++ K      P  I     P + ++++ C+   P  RP A +L +HPLF I
Sbjct:  583 LGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQD--KVCQTIMDEIAILARLKHPHLIKCL--------------GATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILI-------RYLRQILQGVSYLH---ENQVVHRDIKGAN-ILVDSTGQD---IRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLLQHPLFTI 844          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000027269.1 (pep primary_assembly:ASM223467v1:8:129429:156272:1 gene:ENSORLG00000026732.1 transcript:ENSORLT00000027269.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 3.257e-56
Identity = 121/324 (37.35%), Postives = 180/324 (55.56%), Query Frame = 1
Query:  532 VIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVL 1503
             +A S   RFLK++ +IG G +K VYKG D +   +VAWCE++  H  ++ ++Q   +E+E++  L HPN+V+ F+  KS    H          K  ++V ELM  GTLK M  + F      + + L+ +W +Q+L  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C +  Q+  K      PD    ++ P ++EII  C+      R T ++L EH  FQ    +    +++ +   A +KL   +   E L
Sbjct:   71 AVASSPDGRFLKFNIEIGRGSFKTVYKGLDTETTVEVAWCELQ-THRLSRAERQRFSEEVEMLKALQHPNIVRFFDSWKSALKGH----------KCTILVTELMTSGTLK-MYLRRFRQ----MKLKLLQRWSFQVLRGLHFLHSR-SPPIIHRDLKCDNIFI----TGPSASVKIGDLGLAT-LKKASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMATSEYPYHECHSAAQIYRKVTNGIKPDSFFKVEVPELKEIIEGCIRTRSSERFTVQDLLEHSFFQENTGVHVELAEEDDGSKAALKLWLRMDDKEKL 372          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk1b (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:101172041])

HSP 1 Score: 207.608 bits (527), Expect = 5.375e-53
Identity = 112/277 (40.43%), Postives = 158/277 (57.04%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCV 1347
            A  + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW       +G     K +V++ ELM  GTLK  +K+       ++ I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+
Sbjct:  267 AETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW-------EGPCKGKKCIVLITELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFI----TGPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCI 520          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk1b (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:101172041])

HSP 1 Score: 207.608 bits (527), Expect = 6.221e-53
Identity = 112/277 (40.43%), Postives = 158/277 (57.04%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCV 1347
            A  + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW       +G     K +V++ ELM  GTLK  +K+       ++ I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+
Sbjct:  267 AETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW-------EGPCKGKKCIVLITELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFI----TGPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCI 520          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk1b (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:101172041])

HSP 1 Score: 207.608 bits (527), Expect = 6.790e-53
Identity = 112/277 (40.43%), Postives = 158/277 (57.04%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCV 1347
            A  + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW       +G     K +V++ ELM  GTLK  +K+       ++ I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+
Sbjct:  267 AETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQR--FKEEAGMLKGLQHPNIVRFYD---SW-------EGPCKGKKCIVLITELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFI----TGPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCI 520          
BLAST of Protein kinase vs. Ensembl Medaka
Match: wnk1a (serine/threonine-protein kinase WNK1 [Source:NCBI gene;Acc:101171000])

HSP 1 Score: 206.838 bits (525), Expect = 7.431e-53
Identity = 118/297 (39.73%), Postives = 166/297 (55.89%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLK-LDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQ 1407
            A  + +  S   RFLK+D +IG G +K VYKG D +   +VAWCE++       E+Q+  FKE   MLK L HPN+V+ ++   SW       +G     K +V+V ELM  GTLK  +K+       ++ I ++  W  QIL  L ++H R  PPIIHRDLK +N F+         SVKIGD GLAT +   S   ++IGT  FMAPE+YEEKYD  VD+YAFG+ MLE+ T++ PY +C+N  Q+  +      P     +  P ++EII  C+      R + ++L  H  FQ
Sbjct:  211 AETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKTERQR--FKEEAGMLKGLQHPNIVRFYD---SW-------EGPSKGRKCIVLVTELMTSGTLKTYLKR-----FKVMKIKVLRSWCRQILKGLHFLHTRA-PPIIHRDLKCDNIFIT----GPTGSVKIGDLGLAT-LKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPGSFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ 484          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000070879.1 (SMESG000070879.1)

HSP 1 Score: 3609.31 bits (9358), Expect = 0.000e+0
Identity = 1980/2007 (98.65%), Postives = 1986/2007 (98.95%), Query Frame = 1
Query:  145 MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNICPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKVSXXXXXXXXXXXXXXXXXXXXXXXXARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEKNVNENDNSENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNVKTDYKFQNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKINLTNTSNEQINSIKTIDDKVNEEINPLXXXXXXXXXXLRYQLLTSEIESVPSSTQCQPTSNSISNAQNFMSASKYDTIHFRHFSEPAFTYASNHNCPMTSIHPPVPNFNSGTIPSHSKIQSYQNSCHXXXXXXXXXXXXXXXVGYLGNFNSQTVLGPNNNLYYHSQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIYGGLLYPQAAFIXXXXXXXXXXXXIQYNNPVDHTTRQPTGEPVLTRSLPSIIGNQSALENTMASTLIQNTITPGLPSRTSLINNATGINEIPVPQRQILVPSSSTQKLNPTLMSTPRPVINRSQAAISPIPTSKQPQTLWKTTHTLNNTATGSQLTYPPINDNISVPLVVVKTRXXXXXXXXXXXXXXXXXKVTRGRSFSQVQEXXXXXXXXXXXXXXYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFTCSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSIPLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYLNTNPSHFLGNPLTVXXXXXXXXXXXXXNEDLSWNLSNPMISDQSWLPVSEMEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPSKDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVPAGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPSDGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDCNQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVGDKFDLFDPNQQRRGSGDNNAPGXXXXXXXXXXXXXXXXXYQFVPLTKSGSSKLEFESGPEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSS-XXXXXXXXPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQFVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVPVVLTNQNQIGLNYTPIAPNQMVLSSGMMANXXXXXXXXXXXXXXXXXXXRIATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIPTATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSPLISDHNLRIRMNXXXXXXXXXXXTHMLYYPIQNLATTTVQNPIPAVNTSKLGLSD-XXXXXXXXXXXSYDSIAINNXXXXXXXXXXXXXXXGRFVIRSVTENTEKT 6159
            MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNICPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKVSEERKIERFKKKEKLLFRKFQLEEKARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLI+EIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEE NVNENDN+ENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNVKTDYK+QNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKINLTNTSNEQINSIKTIDDKV+EEINPLSSRSTKSSESLRYQLLTSEIESVP+STQCQPTSNSISNAQNFMSASKYD IHFRHFSEPAFTYASNHN PMTSIHPPVPNFNSGTIPSHSKIQSYQNSCHSNISNLNSNYDLNNSVGYLGNFNSQTVLGPNNNLYY SQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIYGGLLYPQAAFINNHLNSNFMHNNIQYNNPVDHTTRQPTGEPVLTRSLPSIIGNQSALENTMASTLIQNTITPGLPSRT LINNATGINEIPVPQRQILVPSSSTQKLNPTLMSTPRPVINRSQAAISPIPTSKQPQTLWKTTHTLNNTATGSQLTYPPINDNISVPLVVVKTRSESTSSILVSNTSNNNNKVTRGRSFSQVQEKSKPKKPKTRLKSKYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFTCSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSIPLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYLNTNPSHFLGNPLTVSSASSRSLSRHAS EDLSWNLSNPMISDQSWLPVSEMEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPSKDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVPAGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPSDGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDCNQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVG+KFDLFD NQQRRGSGDNNAPGSSSVAQSQSQVQVECVSYQFVPLTKS SSKLEFESGPEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSS QQQQIQQQPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQFVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVPVVLTNQNQIGLNYTPIAPNQMVLSSGMMAN         QQQSQLTNQQRIATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIPTATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSPLISDHNLRIRMNQPSSSQSQSQPTHMLYYPIQNLATTTVQNPIPAVNTSKLGLSD QQ  QQQQQQQSYDSIAINNQISESESKSKTEQTIGRFVIRSVTENTEKT
Sbjct:    1 MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNICPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKVSEERKIERFKKKEKLLFRKFQLEEKARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIKEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEETNVNENDNNENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNVKTDYKYQNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKINLTNTSNEQINSIKTIDDKVSEEINPLSSRSTKSSESLRYQLLTSEIESVPNSTQCQPTSNSISNAQNFMSASKYDAIHFRHFSEPAFTYASNHNYPMTSIHPPVPNFNSGTIPSHSKIQSYQNSCHSNISNLNSNYDLNNSVGYLGNFNSQTVLGPNNNLYYQSQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIYGGLLYPQAAFINNHLNSNFMHNNIQYNNPVDHTTRQPTGEPVLTRSLPSIIGNQSALENTMASTLIQNTITPGLPSRTPLINNATGINEIPVPQRQILVPSSSTQKLNPTLMSTPRPVINRSQAAISPIPTSKQPQTLWKTTHTLNNTATGSQLTYPPINDNISVPLVVVKTRSESTSSILVSNTSNNNNKVTRGRSFSQVQEKSKPKKPKTRLKSKYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFTCSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSIPLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYLNTNPSHFLGNPLTVSSASSRSLSRHASTEDLSWNLSNPMISDQSWLPVSEMEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPSKDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVPAGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPSDGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDCNQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVGEKFDLFDSNQQRRGSGDNNAPGSSSVAQSQSQVQVECVSYQFVPLTKSASSKLEFESGPEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSSQQQQQIQQQPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQFVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVPVVLTNQNQIGLNYTPIAPNQMVLSSGMMAN----QMHIPQQQSQLTNQQRIATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIPTATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSPLISDHNLRIRMNQPSSSQSQSQPTHMLYYPIQNLATTTVQNPIPAVNTSKLGLSDQQQLQQQQQQQQSYDSIAINNQISESESKSKTEQTIGRFVIRSVTENTEKT 2003          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000070879.1 (SMESG000070879.1)

HSP 1 Score: 1939.08 bits (5022), Expect = 0.000e+0
Identity = 1027/1053 (97.53%), Postives = 1036/1053 (98.39%), Query Frame = 1
Query:  145 MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNICPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKVSXXXXXXXXXXXXXXXXXXXXXXXXARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEKNVNENDNSENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNVKTDYKFQNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKINLTNTSNEQINSIKTIDDKVNEEINPLXXXXXXXXXXLRYQLLTSEIESVPSSTQCQPTSNSISNAQNFMSASKYDTIHFRHFSEPAFTYASNHNCPMTSIHPPVPNFNSGTIPSHSKIQSYQNSCHXXXXXXXXXXXXXXXVGYLGNFNSQTVLGPNNNLYYHSQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIYGGLLYPQAAFIXXXXXXXXXXXXIQYNNPVDHTTRQPTGEPVLTRSLPSIIGNQSALENTMASTLIQNTITPGLPSRTSLINNATGINEIPVPQRQILVPSSSTQKLNPTLMSTPRPVINRSQAAISPIPTS--------KQPQTLWKTTHTL 3279
            MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNICPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKVSEERKIERFKKKEKLLFRKFQLEEKARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLI+EIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEE NVNENDN+ENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNVKTDYK+QNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKINLTNTSNEQINSIKTIDDKV+EEINPLSSRSTKSSESLRYQLLTSEIESVP+STQCQPTSNSISNAQNFMSASKYD IHFRHFSEPAFTYASNHN PMTSIHPPVPNFNSGTIPSHSKIQSYQNSCHSNISNLNSNYDLNNSVGYLGNFNSQTVLGPNNNLYY SQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIYGGLLYPQAAFINNHLNSNFMHNNIQYNNPVDHTTRQPTGEPVLTRSLPSIIGNQSALENTMASTLIQNTITPGLPSRT LINNATGINEIPVPQRQILVPSSSTQKLNPTLMSTPRPVINRSQAAISPIPTS        K+P+T  K+ + L
Sbjct:    1 MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNICPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKVSEERKIERFKKKEKLLFRKFQLEEKARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIKEIIMSCVHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEETNVNENDNNENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNVKTDYKYQNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKINLTNTSNEQINSIKTIDDKVSEEINPLSSRSTKSSESLRYQLLTSEIESVPNSTQCQPTSNSISNAQNFMSASKYDAIHFRHFSEPAFTYASNHNYPMTSIHPPVPNFNSGTIPSHSKIQSYQNSCHSNISNLNSNYDLNNSVGYLGNFNSQTVLGPNNNLYYQSQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIYGGLLYPQAAFINNHLNSNFMHNNIQYNNPVDHTTRQPTGEPVLTRSLPSIIGNQSALENTMASTLIQNTITPGLPSRTPLINNATGINEIPVPQRQILVPSSSTQKLNPTLMSTPRPVINRSQAAISPIPTSKVQEKSKPKKPKTRLKSKYLL 1053          

HSP 2 Score: 1579.69 bits (4089), Expect = 0.000e+0
Identity = 891/909 (98.02%), Postives = 893/909 (98.24%), Query Frame = 1
Query: 3439 SQVQEXXXXXXXXXXXXXXYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFTCSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSIPLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYLNTNPSHFLGNPLTVXXXXXXXXXXXXXNEDLSWNLSNPMISDQSWLPVSEMEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPSKDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVPAGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPSDGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDCNQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVGDKFDLFDPNQQRRGSGDNNAPGXXXXXXXXXXXXXXXXXYQFVPLTKSGSSKLEFESGPEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSS-XXXXXXXXPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQFVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVPVVLTNQNQIGLNYTPIAPNQMVLSSGMMANXXXXXXXXXXXXXXXXXXXRIATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIPTATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSPLISDHNLRIRMNXXXXXXXXXXXTHMLYYPIQNLATTTVQNPIPAVNTSKLGLSD-XXXXXXXXXXXSYDSIAINNXXXXXXXXXXXXXXXGRFVIRSVTENTEKT 6159
            S+VQEKSKPKKPKTRLKSKYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFTCSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSIPLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYLNTNPSHFLGNPLTVSSASSRSLSRHAS EDLSWNLSNPMISDQSWLPVSEMEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPSKDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVPAGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPSDGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDCNQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVG+KFDLFD NQQRRGSGDNNAPGSSSVAQSQSQVQVECVSYQFVPLTKS SSKLEFESGPEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSS QQQQIQQQPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQFVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVPVVLTNQNQIGLNYTPIAPNQMVLSSGMMAN         QQQSQLTNQQRIATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIPTATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSPLISDHNLRIRMNQPSSSQSQSQPTHMLYYPIQNLATTTVQNPIPAVNTSKLGLSD QQ  QQQQQQQSYDSIAINNQISESESKSKTEQTIGRFVIRSVTENTEKT
Sbjct: 1032 SKVQEKSKPKKPKTRLKSKYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFTCSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSIPLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYLNTNPSHFLGNPLTVSSASSRSLSRHASTEDLSWNLSNPMISDQSWLPVSEMEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPSKDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVPAGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPSDGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDCNQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVGEKFDLFDSNQQRRGSGDNNAPGSSSVAQSQSQVQVECVSYQFVPLTKSASSKLEFESGPEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSSQQQQQIQQQPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQFVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVPVVLTNQNQIGLNYTPIAPNQMVLSSGMMAN----QMHIPQQQSQLTNQQRIATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIPTATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSPLISDHNLRIRMNQPSSSQSQSQPTHMLYYPIQNLATTTVQNPIPAVNTSKLGLSDQQQLQQQQQQQQSYDSIAINNQISESESKSKTEQTIGRFVIRSVTENTEKT 1936          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000080382.1 (SMESG000080382.1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.827e-119
Identity = 225/543 (41.44%), Postives = 335/543 (61.69%), Query Frame = 1
Query:  520 ARFRVIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLFQIA--PVIVEPFSDDANKFIAVM-KLMDNLSKDEVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLALKTFLEKEI-----------QSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKEDRSLITVNNFENMPAEEKNVNENDNSENPKLTNNLEEYNFNVSMYHKTTKVLNSEIESY----CQESQIKYFSDIFKLINSIKTNNE----EADSINKISIE 2082
            A+ R IA+SKC R++K++ KIGEGGYK VY+G+D +   +VAWCE KR+H D KEK+QSMF+E EIMLK++H ++V+CF+VL+ W +  D    T  + KG+VI+QELM EGTLK +IKKNF +G CIL   LIT+WW+QILD LRYMH +  PPIIHRDLK++NCFL  Q +D+ ++VK+GDFGLAT + H S R TM+GT+GFMAPE+++EKYD  VDIYAFG+LMLEVMTN+TP+D+C  + QV +K++    P VI  +    + EII SC+HP+ C+RPTAEEL  HP+FQ    PV VE   D+ +    V+ + + N+        ++L++  + + +  +      E++    DIYK+   ++  L   L+   E ++           +S+I     LDKL  SI+LQ+Q ++K ++G RWR I D+ +  +   L           E +  + +D  E       + +Y     M+ K  + L+ E+ +Y     +++ + +  + F +     TNNE    E +S+  + +E
Sbjct:  173 AKHRAIAKSKCGRWVKFNIKIGEGGYKFVYRGYDVEEAKNVAWCEFKREHVDTKEKRQSMFRETEIMLKMNHSHIVRCFDVLREWHVYEDPQ--TIIDEKGIVIIQELMGEGTLKNIIKKNFLEGHCILKFPLITRWWHQILDALRYMHLKCDPPIIHRDLKADNCFLYGQTDDEYLNVKVGDFGLATHV-HTSGRKTMLGTLGFMAPEIFDEKYDESVDIYAFGMLMLEVMTNRTPFDECDTIVQVAAKTLSGKGPKVIEMVLDKWLREIINSCIHPLSCFRPTAEELFFHPIFQPKGLPVEVELNYDNISDRTEVIDRFIANIPN---CTKINLRLRFRDKRMLQELGLDDGESLEFDLDIYKAEDQDIPDLIQNLRLEYEDKLSRVYDNPKILDKSTISA--HLDKLFLSIKLQMQCLVKHLLGRRWRDILDSLVANKTAKL----------TEGEMESGDDQDEGMNSFTIISQYK---GMWTKAKRALDKEMVAYRDNSLKDANVSHVENNFHIDGKPSTNNELIQPEIESLENVILE 694          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000046166.1 (SMESG000046166.1)

HSP 1 Score: 380.178 bits (975), Expect = 1.728e-109
Identity = 197/451 (43.68%), Postives = 281/451 (62.31%), Query Frame = 1
Query:  532 VIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF---------QIAPVIVEPFSDDANKFIAVMK-LMDNLSKDEVLPILDLKIILKTEFINDKSKDS----QFEAVIKSFDIYK-------------SYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKED 1803
             I  S C R++K+   +GEGGYK V+KG+D +   +VAWCE K  H D KEKQ ++ KEIEIM+K+DHPN+V C++V   +  + +         K ++++QEL+ EGTLK +IKKNF +G  IL+  LI  W++QI+D L YMH ++ PPIIHRDLK++NCFL  + +D  ++VK+GDFGLAT ++ N +RNTM+GTVGFMAPEVY+EKYD KVDIYAFG+LMLEV+TN+TPYDDC  V QV   +M   LPD+ + +  P   E+I  C+HP+P YRPTA EL  HPLF          I PV + P SD       ++K  ++N+  D    +   K  L+ EF N K + S    + E++    D++K              Y+ NL    +A K+   K +      N QL+K   S+ LQ+++I+K ++G+RW  I +  L+K++
Sbjct:  132 AIGRSVCGRWVKFRQSLGEGGYKTVFKGYDSEKGKNVAWCEFKPHHVDTKEKQVNIMKEIEIMVKMDHPNIVICYDVFDEYIDLRNL--NNPINIKSIILIQELLGEGTLKSVIKKNFINGELILEFSLILYWFHQIIDALAYMHEKLNPPIIHRDLKADNCFLESKSSDKYLNVKVGDFGLATQVS-NKERNTMLGTVGFMAPEVYDEKYDIKVDIYAFGMLMLEVLTNRTPYDDCETVMQVAKHTMSGRLPDIFTLVSDPWTREMISCCIHPLPIYRPTAMELLYHPLFIPSYKYKSKNILPVEITPNSDKCTDRETIIKDFIENIVMDN--SVFQTKFNLRMEFRNKKIQRSFGLDESESLEFDLDVFKDEDVPELISNLKSEYEENLREELIANKSSDAKSV------NTQLEKFFKSMELQMKFIMKMLLGKRWHFILEGLLSKQN 571          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000046166.1 (SMESG000046166.1)

HSP 1 Score: 379.793 bits (974), Expect = 2.101e-109
Identity = 197/451 (43.68%), Postives = 281/451 (62.31%), Query Frame = 1
Query:  532 VIAESKCQRFLKYDCKIGEGGYKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNVVKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDGLCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDDCVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFGILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSCVHPIPCYRPTAEELCEHPLF---------QIAPVIVEPFSDDANKFIAVMK-LMDNLSKDEVLPILDLKIILKTEFINDKSKDS----QFEAVIKSFDIYK-------------SYKANLSTLDLALKTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLNKED 1803
             I  S C R++K+   +GEGGYK V+KG+D +   +VAWCE K  H D KEKQ ++ KEIEIM+K+DHPN+V C++V   +  + +         K ++++QEL+ EGTLK +IKKNF +G  IL+  LI  W++QI+D L YMH ++ PPIIHRDLK++NCFL  + +D  ++VK+GDFGLAT ++ N +RNTM+GTVGFMAPEVY+EKYD KVDIYAFG+LMLEV+TN+TPYDDC  V QV   +M   LPD+ + +  P   E+I  C+HP+P YRPTA EL  HPLF          I PV + P SD       ++K  ++N+  D    +   K  L+ EF N K + S    + E++    D++K              Y+ NL    +A K+   K +      N QL+K   S+ LQ+++I+K ++G+RW  I +  L+K++
Sbjct:  118 AIGRSVCGRWVKFRQSLGEGGYKTVFKGYDSEKGKNVAWCEFKPHHVDTKEKQVNIMKEIEIMVKMDHPNIVICYDVFDEYIDLRNL--NNPINIKSIILIQELLGEGTLKSVIKKNFINGELILEFSLILYWFHQIIDALAYMHEKLNPPIIHRDLKADNCFLESKSSDKYLNVKVGDFGLATQVS-NKERNTMLGTVGFMAPEVYDEKYDIKVDIYAFGMLMLEVLTNRTPYDDCETVMQVAKHTMSGRLPDIFTLVSDPWTREMISCCIHPLPIYRPTAMELLYHPLFIPSYKYKSKNILPVEITPNSDKCTDRETIIKDFIENIVMDN--SVFQTKFNLRMEFRNKKIQRSFGLDESESLEFDLDVFKDEDVPELISNLKSEYEENLREELIANKSSDAKSV------NTQLEKFFKSMELQMKFIMKMLLGKRWHFILEGLLSKQN 557          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNK13.013e-5238.91WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK15.095e-5236.57WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK16.143e-5236.57WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK16.540e-5236.57WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
WNK17.163e-5236.57WNK lysine deficient protein kinase 1 [Source:HGNC... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk-15.359e-4839.21Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-15.390e-4839.21Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-15.395e-4839.21Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-15.631e-4839.21Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-16.042e-4839.21Serine/threonine-protein kinase WNK [Source:UniPr... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnk2.343e-4536.45gene:FBgn0037098 transcript:FBtr0347540[more]
Wnk2.822e-4536.45gene:FBgn0037098 transcript:FBtr0346818[more]
Wnk3.083e-4536.45gene:FBgn0037098 transcript:FBtr0346819[more]
Wnk3.083e-4536.45gene:FBgn0037098 transcript:FBtr0346817[more]
GckIII1.311e-2028.27gene:FBgn0266465 transcript:FBtr0083399[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-151g10.32.880e-5533.03si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
si:dkey-151g10.32.932e-5438.64si:dkey-151g10.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
CU041388.25.689e-5438.64pep chromosome:GRCz11:CHR_ALT_CTG23_1_26:25152826:... [more]
wnk4b2.016e-5339.93WNK lysine deficient protein kinase 4b [Source:ZFI... [more]
wnk1b4.194e-5238.80WNK lysine deficient protein kinase 1b [Source:ZFI... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNK31.425e-5239.04WNK lysine deficient protein kinase 3 [Source:HGNC... [more]
WNK31.697e-5239.04WNK lysine deficient protein kinase 3 [Source:HGNC... [more]
WNK11.074e-4743.08LIM domain transcription factor LMO4.1 [Source:Un... [more]
gna138.084e-3839.91guanine nucleotide binding protein (G protein), al... [more]
gna133.677e-3539.37guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnk31.906e-5439.31WNK lysine deficient protein kinase 3 [Source:MGI ... [more]
Wnk32.268e-5238.97WNK lysine deficient protein kinase 3 [Source:MGI ... [more]
Wnk32.508e-5238.97WNK lysine deficient protein kinase 3 [Source:MGI ... [more]
Wnk32.810e-5238.97WNK lysine deficient protein kinase 3 [Source:MGI ... [more]
Wnk13.162e-5236.57WNK lysine deficient protein kinase 1 [Source:MGI ... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80XP9|WNK3_MOUSE1.754e-5138.97Serine/threonine-protein kinase WNK3 OS=Mus muscul... [more]
sp|Q9JIH7|WNK1_RAT1.955e-5138.91Serine/threonine-protein kinase WNK1 OS=Rattus nor... [more]
sp|Q6R2V0|WNK1_PIG2.211e-5136.57Serine/threonine-protein kinase WNK1 OS=Sus scrofa... [more]
sp|P83741|WNK1_MOUSE2.212e-5136.57Serine/threonine-protein kinase WNK1 OS=Mus muscul... [more]
sp|Q9H4A3|WNK1_HUMAN2.950e-5136.57Serine/threonine-protein kinase WNK1 OS=Homo sapie... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TYD51.366e-12342.77Protein kinase domain-containing protein OS=Rodent... [more]
A0A4Z2CUI94.515e-12343.81Serine/threonine-protein kinase WNK4 OS=Schistosom... [more]
A0A5K4F2J66.421e-12343.61Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4S2M6431.713e-12247.75Protein kinase domain-containing protein OS=Opisth... [more]
A0A5K4F2846.757e-12242.86Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk4b1.725e-5539.93serine/threonine-protein kinase WNK4-like [Source:... [more]
ENSAMXT00000001896.29.554e-5237.91serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
ENSAMXT00000050296.11.072e-5137.91serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
ENSAMXT00000052131.11.080e-5137.91serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
ENSAMXT00000041214.11.155e-5137.91serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001965.11.086e-3636.29pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 g... [more]
ENSPMAT00000001973.19.505e-3637.12pep scaffold:Pmarinus_7.0:GL477178:11064:57290:1 g... [more]
ENSPMAT00000006100.12.555e-2026.57pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 g... [more]
pak41.042e-1925.57p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
nrbp11.198e-1928.30nuclear receptor binding protein 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE204.384e-2031.08Cdc42p-activated signal transducing kinase; involv... [more]
CLA49.359e-1930.00Cdc42p-activated signal transducing kinase; member... [more]
CDC159.344e-1826.74Protein kinase of the Mitotic Exit Network; locali... [more]
PHO857.933e-1726.76Cyclin-dependent kinase; has ten cyclin partners; ... [more]
IPL11.382e-1627.81Aurora kinase of chromosomal passenger complex; me... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346466.171e-2228.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458462.101e-2127.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374132.917e-2128.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428453.592e-2129.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361503.788e-2026.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027269.13.257e-5637.35pep primary_assembly:ASM223467v1:8:129429:156272:1... [more]
wnk1b5.375e-5340.43serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
wnk1b6.221e-5340.43serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
wnk1b6.790e-5340.43serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
wnk1a7.431e-5339.73serine/threonine-protein kinase WNK1 [Source:NCBI ... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070879.10.000e+098.65SMESG000070879.1[more]
SMESG000070879.10.000e+097.53SMESG000070879.1[more]
SMESG000080382.11.827e-11941.44SMESG000080382.1[more]
SMESG000046166.11.728e-10943.68SMESG000046166.1[more]
SMESG000046166.12.101e-10943.68SMESG000046166.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033750 ID=SMED30033750|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=6462bp
ACTTAAATGTAATTACTTTAAATAAAAAGATTGATGCTATAGTTAAATTA
TTTTTTAACTATTCAATTTCTAATTATAATTTCATTTCAAAAGATAAAGA
TTCTTATTAATCCATCTTTAAAAACTATTTTACAAGTTAGACTTATGGAG
GTTAAAAATTTAAAACCAGAAAAAATTCAAGTTTACGATTGTCTAACTTT
TGATCAACAAAGTCCAGATTACCGATCAAATCTTGTAACTTATAATCATA
TTCCTTTATTCCAAAAACCACTTGGAAATATTGACAAAAATATCTGTCCA
AATACTTGTTATTCGTCATCGTTGAATTCTTATGAAATTACTAATTTCCA
AATCCAAAGTTCAGTTTCACCTAAATCCTATCAATCTGATGATAATTCCA
AAGAAATAACTTTCGAAGATAATATTTCCACATTATTGAAAGTTTCAGAA
GAAAGAAAAATCGAGCGATTCAAAAAGAAAGAAAAATTGTTGTTTCGTAA
ATTTCAGTTGGAAGAAAAAGCAAGATTTCGCGTTATTGCCGAATCGAAGT
GTCAGAGGTTTTTGAAATATGACTGCAAAATTGGCGAGGGCGGTTATAAA
TTAGTCTATAAAGGTTTCGATCGAAAGAACTGTTGTGATGTAGCTTGGTG
TGAAATCAAGCGTGACCATGAAGATAATAAAGAAAAACAACAGTCAATGT
TTAAAGAAATCGAAATTATGTTAAAGCTTGATCATCCAAATGTGGTTAAA
TGTTTTAATGTGCTGAAAAGTTGGTGGATTATTCACGATGATATGGACGG
TACAAGAACTGAAGCAAAAGGCCTGGTCATTGTGCAAGAATTAATGAATG
AAGGTACTTTAAAAGGAATGATTAAGAAAAACTTTCATGACGGATTGTGT
ATCCTTGATATTCTTCTTATAACGAAGTGGTGGTATCAGATACTCGATGT
CTTGCGTTATATGCATTGCCGTATCCAGCCACCGATAATACATAGAGATC
TGAAATCAGAAAACTGTTTTCTTGTGGTTCAACCGAATGACGATTGTGTC
AGTGTCAAAATTGGAGATTTTGGATTAGCAACAACGATTAATCATAATAG
CAAACGCAATACAATGATCGGCACTGTGGGTTTCATGGCACCAGAAGTTT
ATGAGGAAAAATATGACACGAAAGTCGACATATATGCTTTTGGAATATTA
ATGCTAGAAGTAATGACGAACAAAACTCCATATGATGATTGTAGAAATGT
ATTTCAAGTAGTTTCTAAATCTATGGGGAGGTATTTGCCAGATGTTATTT
CAAATTTGAAACAGCCTCTAATTGAAGAAATTATTATGTCATGTGTTCAT
CCTATTCCTTGTTATAGACCCACAGCAGAAGAGCTTTGTGAACATCCATT
GTTTCAAATCGCCCCGGTAATTGTCGAACCTTTCAGTGATGATGCAAACA
AATTTATTGCCGTAATGAAATTAATGGATAATTTATCCAAAGATGAAGTT
TTACCGATTCTTGATCTGAAAATCATTCTTAAAACTGAATTCATTAATGA
CAAATCAAAAGATTCACAGTTTGAGGCTGTGATAAAATCCTTTGATATTT
ACAAATCTTACAAAGCGAATTTGTCGACACTAGACTTAGCTTTGAAAACT
TTTCTTGAAAAAGAAATACAAAGTTCTATTAAAAAAAATAATCAATTAGA
CAAACTTTTAACCAGCATTCGTCTGCAAATCCAATATATTATTAAAACAG
TTATTGGTGAAAGGTGGCGACGAATATTTGACAATTTTTTAAACAAAGAA
GATCGAAGTCTAATAACAGTAAATAACTTTGAAAATATGCCAGCTGAAGA
AAAAAATGTAAATGAAAATGACAACAGTGAAAATCCGAAATTAACCAACA
ACTTGGAAGAATATAATTTCAATGTCTCTATGTATCATAAGACAACGAAA
GTTTTGAATTCAGAAATTGAAAGCTATTGTCAGGAATCTCAAATCAAATA
CTTTTCTGACATTTTTAAGTTAATAAATTCTATTAAAACCAATAACGAAG
AAGCAGATTCCATAAATAAAATTTCAATTGAGCCATGGAATGTGAAAACG
GATTATAAATTTCAGAACCAATCTCCCAGAAGTCCAGTTTGTTTGAAAAC
GAAAATTGAGGACATTGAAGTGTCTTCTACCAAGCGGAATAGAAATACAT
CAGAAAATATTTCGAAGACCACACCTGATTCTGATTTCAAAATCAATTTA
ACTAACACATCAAATGAACAAATTAATTCAATAAAAACAATAGACGATAA
AGTCAATGAAGAAATTAATCCTTTATCCAGTAGATCCACTAAATCCTCTG
AATCTCTTCGTTATCAACTATTGACTAGCGAAATAGAAAGTGTTCCCAGC
AGTACTCAATGCCAACCGACTTCTAATTCAATATCCAATGCACAAAACTT
CATGTCAGCATCAAAATATGATACAATTCATTTCCGGCATTTCAGTGAAC
CGGCTTTCACATATGCATCAAATCATAATTGTCCTATGACTTCCATTCAT
CCACCAGTACCTAACTTTAACTCTGGAACTATTCCTTCACATTCAAAAAT
CCAATCATATCAAAACTCTTGTCATTCAAATATTTCAAACCTTAATAGTA
ATTACGATCTAAATAATTCTGTCGGGTATTTAGGAAACTTCAATTCTCAA
ACTGTACTTGGACCAAATAATAATTTATATTATCATTCTCAACATCACAA
TCAGCAATACATAAAATATATCCTTCAAAATCAATCTAATCTAATTTTTT
CTCATCGAAATTCGAGTCTTGGTCATAATATATCCAGCATTTACGGTGGA
CTTTTATATCCTCAAGCTGCATTCATCAATAATCATCTGAATTCTAATTT
CATGCATAATAATATACAATATAATAATCCTGTTGATCACACAACTCGAC
AACCAACTGGAGAACCAGTTCTCACTAGAAGTCTCCCTAGTATAATTGGA
AATCAATCTGCTTTAGAAAACACAATGGCTTCAACACTAATTCAAAATAC
AATTACGCCAGGTTTGCCATCTAGAACATCATTAATTAACAATGCAACTG
GAATCAATGAAATTCCTGTTCCTCAACGCCAGATTCTTGTTCCCAGTAGC
AGTACACAAAAGCTCAATCCAACTTTGATGTCTACTCCAAGACCTGTAAT
TAATCGAAGCCAAGCCGCTATATCTCCAATTCCTACCTCAAAGCAGCCAC
AAACTCTGTGGAAAACTACACACACTCTCAACAATACTGCTACCGGTTCA
CAATTAACCTATCCACCAATCAATGATAATATTTCCGTGCCACTAGTGGT
TGTCAAGACGCGCAGTGAATCGACATCGTCAATACTTGTATCTAATACCT
CAAATAATAACAATAAAGTTACTCGTGGACGTTCTTTTTCTCAAGTTCAA
GAAAAATCTAAACCTAAAAAACCTAAAACGCGGTTAAAATCGAAATATCT
GTTAAGAATAATAGAAATTTTTGAAAATCCAACTAGTAAAGAAATTACAT
TGACGTTTGAGATGATGTTGCCGATGCATCAAATGAGATTTACTTGCTCG
TTGAACAGTGATATTAATCTTTCTAAATGTTTAGGGGACCCAGGTCAAAT
ACCCGGAGAATTACGGAAGAAAGAAATCTTGGAGTCGTTAGTCAGTACAG
TGAAAAAAATCTGCGACTGTTTATCAGAAGATATGAATTCTATTCCTCTA
AATGAAGATTTTGTCTTTCATCCATTCTTTCCAAACTCTGGATTAGTAAA
ATTTTCCGATTGCACTTATCAAATGCAAATTTCTTCGGAAGTCTACGAAT
CTGCTCAATCGGGATCTGGTTTATTGAATCAATTTAATTATCTCAACACA
AATCCTTCGCATTTCCTAGGAAATCCATTAACTGTTAGTTCAGCATCGTC
GCGTTCTCTCTCCAGACACGCAAGCAATGAAGATCTATCTTGGAATTTGA
GTAATCCCATGATTTCCGATCAATCATGGCTACCAGTGTCAGAAATGGAA
ATTATAAACCCAGTTCCATTTGAATGTAGTAAAACAATATCTAATCCCGT
TACAGACATTCAAAAGAAATCCAAATCCGTAACAGAAATCGAAACCAATC
GATATGTAAAAGTGACCAGTAAATGCGGTTGCAATCCACCATCAAAAGAT
TGTTGCGTAAAAATACCGGAATATCTTTTTCCATCAGTTAAACAAATCAT
GGAGAAACTGCAAAACCCTCACACGAAAGGATTGATTGTTTTGCCTCAAC
CCAGTGAGATATGTGTGAGAACTCTGAGAATTCTTGAGGTTCCCGCTGGT
CATATGTTTTTTGGTCTGCCTTGTCCTGATTCCTCATTCAATGTGGTCAA
AGGTAACAAGGATAATGATTTTATCATTGCAAAAGATACCAGGCAGTCGG
AAAGTATCGGTCAAACTAAAAAGTGTGTCTATCAAATTCCAAGTGACGGA
GCAGTGCTGCTGGACTCGACTGGGGAAATACAATATCTGCAACAGCCGAG
TTTGGTTATTCCGTCACATACGCCCCAATCGAAAACTCAAATCAAAGAAT
TGCCATCTGAATTGACCCATAATAAAAACCAATCGCTTGATTGTAATCAA
ATCGTTTCGGTTTTGCAGTCGTTGTCAATGATGCAAAATGCATCAGATTT
CACCAGAGATGAAACTTTTGACAGTCCAGTCATGCTAGAGTCCGTAGCGA
ATCAGCACTCTGCTGTAGGCGATAAATTTGATTTATTCGATCCGAATCAA
CAAAGAAGGGGATCAGGGGACAATAATGCACCGGGTTCTTCTTCAGTGGC
CCAGAGTCAATCACAAGTCCAGGTTGAATGTGTTTCATATCAATTTGTAC
CGTTAACAAAGTCCGGTAGTTCAAAGTTAGAATTCGAATCTGGACCGGAA
TTTATTGATCGAGATTTACCGAGACAGCAAGTACGAAATCGTAAAATTTC
CAATGAATCATTGGATGCTATTTCTCTGCCTCGTGGTCGTGGACCTGGAG
TATATTTGAATGAAATCGATTATTTATCGTCTCAACAACAACAAATACAG
CAACAACCGGTTATTCCGAAAATGGTGGTTAATAATCCAATAGCCATACA
AAATGTTCAACGTACTGTGCCGGTTGGTGCGATTTTAAATCAAGTCCCAG
TTCAAAGATTACCTAATCCCAATCCAGTTGGTCATTCGGGACAGTTCGTC
TTATCTTCGCAAACTACTGTCAATCAGATGCCGTCGAATATTTTGATGCA
TAACCTACCACAGGGAATTGCGCAATACGGAAATCCTACTTCCGGATCTA
CTCCGGTAACAGTGGTCATGTCTCAGAGTAGTAACACAGTACCAGTTGTT
TTAACGAATCAAAATCAAATCGGCCTTAATTACACACCAATTGCTCCTAA
TCAAATGGTGCTTTCATCTGGTATGATGGCAAATCAAATGCATATTCCAC
AACAGCAGCAACAACAGCAGTCTCAACTGACGAATCAACAACGCATTGCC
ACTCCGTCAACTATGTCATTTTCTAGTCAACATCTTTCAAATCTACAAGG
ACTTCCAATGCAAAACTTGATCAATGTTACACAATCAATGATGTCGGGAT
CAATTTTACCTGGATACACTACTTCAATGCATAACTCTATTCCAACTGCT
ACTTCAGAAGCCCATTTCGTTCCAGTATCTCACCCAACTGAATTCATTGG
CCTTAAAGATCAAGTACGTCAAATGCCTCCTGTTAATATTCGTCAAATAC
CTGTGGGAAATCCACCATTTTATGACCCCGGTTATAACAGTCCTCTAATA
TCAGATCATAATTTACGAATTAGGATGAATCAACCCAGTTCAAGTCAATC
GCAATCACAACCTACACATATGCTTTATTATCCGATTCAGAATCTTGCTA
CAACAACTGTACAAAACCCAATTCCAGCAGTTAATACATCAAAACTCGGC
CTTTCAGATCAGCAGCAGTTACAACAGCAGCAACAGCAACAATCATACGA
TTCTATTGCAATAAACAATCAAATATCAGAATCTGAAAGTAAATCAAAAA
CTGAACAAACTATTGGTCGATTTGTGATCAGATCTGTTACGGAAAATACA
GAAAAAACATAATTCGTTTGATTTTTAACTTGTTCAATGTTATCGATTAA
ATTTATCCTGTTTCTAATTGTGTGATGAAAATGATTACTTAGAAAAACTC
GAAATTAAAAAATAAAATAAAATCAGCAATTGGGAGCATTTACTTATTTA
TAATTACTGACATAAGATGATTATGATGACATCACAGTATGGAATAATAA
TTGATTTCAAACAGTCTAGATTTATTTTATGTTATTATCGCGTGTCGTGT
CCTTGGCCTGATTATTAATTTTTCATGCTTTTTACAAATCGATTATGATA
ATAATTTATTTG
back to top

protein sequence of SMED30033750-orf-1

>SMED30033750-orf-1 ID=SMED30033750-orf-1|Name=SMED30033750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2006bp
MEVKNLKPEKIQVYDCLTFDQQSPDYRSNLVTYNHIPLFQKPLGNIDKNI
CPNTCYSSSLNSYEITNFQIQSSVSPKSYQSDDNSKEITFEDNISTLLKV
SEERKIERFKKKEKLLFRKFQLEEKARFRVIAESKCQRFLKYDCKIGEGG
YKLVYKGFDRKNCCDVAWCEIKRDHEDNKEKQQSMFKEIEIMLKLDHPNV
VKCFNVLKSWWIIHDDMDGTRTEAKGLVIVQELMNEGTLKGMIKKNFHDG
LCILDILLITKWWYQILDVLRYMHCRIQPPIIHRDLKSENCFLVVQPNDD
CVSVKIGDFGLATTINHNSKRNTMIGTVGFMAPEVYEEKYDTKVDIYAFG
ILMLEVMTNKTPYDDCRNVFQVVSKSMGRYLPDVISNLKQPLIEEIIMSC
VHPIPCYRPTAEELCEHPLFQIAPVIVEPFSDDANKFIAVMKLMDNLSKD
EVLPILDLKIILKTEFINDKSKDSQFEAVIKSFDIYKSYKANLSTLDLAL
KTFLEKEIQSSIKKNNQLDKLLTSIRLQIQYIIKTVIGERWRRIFDNFLN
KEDRSLITVNNFENMPAEEKNVNENDNSENPKLTNNLEEYNFNVSMYHKT
TKVLNSEIESYCQESQIKYFSDIFKLINSIKTNNEEADSINKISIEPWNV
KTDYKFQNQSPRSPVCLKTKIEDIEVSSTKRNRNTSENISKTTPDSDFKI
NLTNTSNEQINSIKTIDDKVNEEINPLSSRSTKSSESLRYQLLTSEIESV
PSSTQCQPTSNSISNAQNFMSASKYDTIHFRHFSEPAFTYASNHNCPMTS
IHPPVPNFNSGTIPSHSKIQSYQNSCHSNISNLNSNYDLNNSVGYLGNFN
SQTVLGPNNNLYYHSQHHNQQYIKYILQNQSNLIFSHRNSSLGHNISSIY
GGLLYPQAAFINNHLNSNFMHNNIQYNNPVDHTTRQPTGEPVLTRSLPSI
IGNQSALENTMASTLIQNTITPGLPSRTSLINNATGINEIPVPQRQILVP
SSSTQKLNPTLMSTPRPVINRSQAAISPIPTSKQPQTLWKTTHTLNNTAT
GSQLTYPPINDNISVPLVVVKTRSESTSSILVSNTSNNNNKVTRGRSFSQ
VQEKSKPKKPKTRLKSKYLLRIIEIFENPTSKEITLTFEMMLPMHQMRFT
CSLNSDINLSKCLGDPGQIPGELRKKEILESLVSTVKKICDCLSEDMNSI
PLNEDFVFHPFFPNSGLVKFSDCTYQMQISSEVYESAQSGSGLLNQFNYL
NTNPSHFLGNPLTVSSASSRSLSRHASNEDLSWNLSNPMISDQSWLPVSE
MEIINPVPFECSKTISNPVTDIQKKSKSVTEIETNRYVKVTSKCGCNPPS
KDCCVKIPEYLFPSVKQIMEKLQNPHTKGLIVLPQPSEICVRTLRILEVP
AGHMFFGLPCPDSSFNVVKGNKDNDFIIAKDTRQSESIGQTKKCVYQIPS
DGAVLLDSTGEIQYLQQPSLVIPSHTPQSKTQIKELPSELTHNKNQSLDC
NQIVSVLQSLSMMQNASDFTRDETFDSPVMLESVANQHSAVGDKFDLFDP
NQQRRGSGDNNAPGSSSVAQSQSQVQVECVSYQFVPLTKSGSSKLEFESG
PEFIDRDLPRQQVRNRKISNESLDAISLPRGRGPGVYLNEIDYLSSQQQQ
IQQQPVIPKMVVNNPIAIQNVQRTVPVGAILNQVPVQRLPNPNPVGHSGQ
FVLSSQTTVNQMPSNILMHNLPQGIAQYGNPTSGSTPVTVVMSQSSNTVP
VVLTNQNQIGLNYTPIAPNQMVLSSGMMANQMHIPQQQQQQQSQLTNQQR
IATPSTMSFSSQHLSNLQGLPMQNLINVTQSMMSGSILPGYTTSMHNSIP
TATSEAHFVPVSHPTEFIGLKDQVRQMPPVNIRQIPVGNPPFYDPGYNSP
LISDHNLRIRMNQPSSSQSQSQPTHMLYYPIQNLATTTVQNPIPAVNTSK
LGLSDQQQLQQQQQQQSYDSIAINNQISESESKSKTEQTIGRFVIRSVTE
NTEKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 140..420
e-value: 1.8E-49
score: 180.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 144..420
e-value: 3.8E-50
score: 170.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 140..420
score: 38.336
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 220..434
e-value: 6.3E-44
score: 151.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 128..214
e-value: 1.6E-21
score: 78.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1080..1112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1080..1100
NoneNo IPR availablePANTHERPTHR13902SERINE/THREONINE-PROTEIN KINASE WNK WITH NO LYSINE -RELATEDcoord: 122..1975
NoneNo IPR availablePANTHERPTHR13902:SF12WNK KINASE, ISOFORM Mcoord: 122..1975
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 281..293
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 144..421