LETM1 and EF-hand domain-containing protein 1, mitochondrial

Overview
NameLETM1 and EF-hand domain-containing protein 1, mitochondrial
Smed IDSMED30033722
Length (bp)2713
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LETM1 and EF-hand domain-containing protein 1, mitochondrial (SMED30033722) t-SNE clustered cells

Violin plots show distribution of expression levels for LETM1 and EF-hand domain-containing protein 1, mitochondrial (SMED30033722) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LETM1 and EF-hand domain-containing protein 1, mitochondrial (SMED30033722) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LETM1 and EF-hand domain-containing protein 1, mitochondrial (SMED30033722) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033722

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
ovarySMED30033722SMESG000064220.1 SMED30033722smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30033722SMESG000064220.1 SMED30033722smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30033722SMESG000064220.1 dd_Smed_v4_4348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033722SMESG000064220.1 dd_Smed_v4_4348_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: LETM1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:HGNC Symbol;Acc:HGNC:6556])

HSP 1 Score: 299.286 bits (765), Expect = 1.879e-88
Identity = 230/601 (38.27%), Postives = 353/601 (58.74%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGT--EERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE---DKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIES-AIANLEEAKTLF---------HKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            RV DEL HYYHGF+L + D  +A  +L R+  GH+LTRRER+Q +R  AD+ R+VPFLVF++VPFMEFLLP  +K FP MLPSTF+T+S  +E + ++L+ KLE+AKFLQ+ I E A K K  KG       FS F ++ RE+G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL M++R +K DD++IA EG+D + V ELQ   R RGMR+ GV E+RLR QL QWL L L +++PT+LL+LSR MYLP+TL+P +QLK  +  LP+ V+  A++K      E+VD K KLE   +E+  I +E                E+ K SE   D  P   + + + P T P  E+   V +S+ +      K+  P+    ++    ++   I S A + L+E K             KE++    E  +EI K LS + E   V+  E K+ K L+ ++ +MI +I+  +  +E++ +    +  +  P  E V++V  +             IN    ++ +K + ++    K  ++ + LDE+KDGK+ +D LVK+I+L++  +V + +S++A+++  +
Sbjct:  156 RVLDELKHYYHGFRLLWIDTKIAARMLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSAT--KDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREK------------ELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETL------KDTAPVLEGLKEEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVE--ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAEL-------------INA---MKQVKHIPES----KLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATL 714          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 201.06 bits (510), Expect = 9.627e-56
Identity = 139/270 (51.48%), Postives = 187/270 (69.26%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIK-GDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            ++ DEL +YY+GF L + D  VA  ++ RL  G  LTRRER++L+RT  D  R+VPF+VF+IVPFMEFLLP +LK FP MLPSTF++ESK +E   +K+  KLE+AKFLQE + E A +   K GD    T  S ++KQ  ++G    T++I+RFS LFED++ LE L+   L ALCKLL++ T G   LLRFQL MK++ +K DD++IA EG+  + V ELQ   R RGMRS G+ E +LR QL++W  L L++ VP +LLLLSR  YL
Sbjct:   78 KIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFESESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDAS--TQLSSYVKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYL 344          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 201.06 bits (510), Expect = 2.668e-55
Identity = 139/270 (51.48%), Postives = 187/270 (69.26%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIK-GDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            ++ DEL +YY+GF L + D  VA  ++ RL  G  LTRRER++L+RT  D  R+VPF+VF+IVPFMEFLLP +LK FP MLPSTF++ESK +E   +K+  KLE+AKFLQE + E A +   K GD    T  S ++KQ  ++G    T++I+RFS LFED++ LE L+   L ALCKLL++ T G   LLRFQL MK++ +K DD++IA EG+  + V ELQ   R RGMRS G+ E +LR QL++W  L L++ VP +LLLLSR  YL
Sbjct:  125 KIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFESESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDAS--TQLSSYVKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYL 391          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 162.155 bits (409), Expect = 1.148e-42
Identity = 106/270 (39.26%), Postives = 145/270 (53.70%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIK-GDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            ++ DEL +YY+GF L + D  VA  ++ RL  G  LTRRER++  +    MA                                                 KLE+AKFLQE + E A +   K GD    T  S ++KQ  ++G    T++I+RFS LFED++ LE L+   L ALCKLL++ T G   LLRFQL MK++ +K DD++IA EG+  + V ELQ   R RGMRS G+ E +LR QL++W  L L++ VP +LLLLSR  YL
Sbjct:   78 KIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRREEKQKKKMAV------------------------------------------------KLELAKFLQETMTEMARRNRAKMGDAS--TQLSSYVKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYL 296          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 161.384 bits (407), Expect = 5.127e-42
Identity = 106/270 (39.26%), Postives = 145/270 (53.70%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIK-GDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            ++ DEL +YY+GF L + D  VA  ++ RL  G  LTRRER++  +    MA                                                 KLE+AKFLQE + E A +   K GD    T  S ++KQ  ++G    T++I+RFS LFED++ LE L+   L ALCKLL++ T G   LLRFQL MK++ +K DD++IA EG+  + V ELQ   R RGMRS G+ E +LR QL++W  L L++ VP +LLLLSR  YL
Sbjct:  125 KIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRREEKQKKKMAV------------------------------------------------KLELAKFLQETMTEMARRNRAKMGDAS--TQLSSYVKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYL 343          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Celegans
Match: letm-1 (LETM1 (Leucine zipper, EF-hand, TransMembrane mitochondrial protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XVL7])

HSP 1 Score: 267.314 bits (682), Expect = 4.793e-77
Identity = 228/625 (36.48%), Postives = 356/625 (56.96%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAE-SATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANE-GIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIEL-KSVESPDTAPISEIL-----TVVKESDKVEIQKQDKEPKPIPVVTEQ------VIGAQDLAQIESAIAN--LEEAK--TLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSL-----EKTGDHEKWVTILSLL---DEDKDGKIEMDHLVKMIKLL-NSIEVKLPSSEIAKLLEVIDKEAIIA 2321
            PL  R+  EL HYYHGF+L   +  V+   L  + +G TL+RRER+QLVRT +D+ R+VPF  FIIVPFME  LP ++K FP MLPSTF+  SK++E   +++K ++E+AKFLQ+ I E    +KT   +      F+ F+K+ R  G  V  +++L+FS LFEDE+TL++L+   L++LC+L+ IN++G P +LRFQL MK+R+LK DD+ IA E G+D +   +LQ   R RGMR+ GV+E RL+ QL QWL LSL  KVP  LLLLSR +YLPE ++  ++LK  +  LP  ++ T K K    E  ++D K ++E+I+  +  I  E++  +  K+A         KE  +KA + E  K V+    A + E+       V   S   E     KEP   P   ++       +  +DL+ IE  I    ++EAK   L  +E++   KE   EI+ +     ET        K  K L  KL+ MI++++  V+ +           ED+K  I E++   ++++S    +KKER + + DV++S+  L     E+  D E+   I +LL   DED DG ++   ++++I+LL    +V + ++++A ++  + KE  +A
Sbjct:   90 PLKDRIIHELKHYYHGFRLLALETRVSAKYLWTVLRGATLSRRERQQLVRTVSDLFRLVPFSFFIIVPFMELALPIFIKLFPGMLPSTFQESSKEEEKWRKQVKLRVEMAKFLQDTIEEIGLERKTRNKESTRSLEFALFIKKVRNEGGYVSNEELLKFSKLFEDEITLDNLSMGQLRSLCRLMSINSLGSPEILRFQLNMKIRELKADDKQIAAEGGVDALSSIDLQSACRARGMRAIGVSEERLKEQLVQWLELSLNDKVPPALLLLSRTLYLPEEVSFPDRLKAIVQNLPDGLAETTKQKLTEMEGGQIDHKARIELIRSIESAIANEKKDEEKKKKAAEEALKS--KEEAEKAKVQEKEKLVDVAAQAIVHELKKDIYDAVASTSSTTEA----KEPAAKPSEAKEEKKEDITVDKKDLSHIEEIIVGGPIKEAKHDILGLREKVLEHKEDLMEINSLDGAFAET--------KIAKRLRHKLNSMIEDVDSMVDKL-----------EDEKRNIREMLIDPTVENSVD--LKKEREVRIQDVIDSLAKLKESKGEQADDGEQRERIEALLKTIDEDSDGIVDKQLVLEVIELLEKHTDVHVSAAQMASMIGTLKKEDEVA 687          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Celegans
Match: letm-1 (LETM1 (Leucine zipper, EF-hand, TransMembrane mitochondrial protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XVL7])

HSP 1 Score: 267.314 bits (682), Expect = 6.360e-77
Identity = 228/625 (36.48%), Postives = 356/625 (56.96%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAE-SATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANE-GIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIEL-KSVESPDTAPISEIL-----TVVKESDKVEIQKQDKEPKPIPVVTEQ------VIGAQDLAQIESAIAN--LEEAK--TLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSL-----EKTGDHEKWVTILSLL---DEDKDGKIEMDHLVKMIKLL-NSIEVKLPSSEIAKLLEVIDKEAIIA 2321
            PL  R+  EL HYYHGF+L   +  V+   L  + +G TL+RRER+QLVRT +D+ R+VPF  FIIVPFME  LP ++K FP MLPSTF+  SK++E   +++K ++E+AKFLQ+ I E    +KT   +      F+ F+K+ R  G  V  +++L+FS LFEDE+TL++L+   L++LC+L+ IN++G P +LRFQL MK+R+LK DD+ IA E G+D +   +LQ   R RGMR+ GV+E RL+ QL QWL LSL  KVP  LLLLSR +YLPE ++  ++LK  +  LP  ++ T K K    E  ++D K ++E+I+  +  I  E++  +  K+A         KE  +KA + E  K V+    A + E+       V   S   E     KEP   P   ++       +  +DL+ IE  I    ++EAK   L  +E++   KE   EI+ +     ET        K  K L  KL+ MI++++  V+ +           ED+K  I E++   ++++S    +KKER + + DV++S+  L     E+  D E+   I +LL   DED DG ++   ++++I+LL    +V + ++++A ++  + KE  +A
Sbjct:   90 PLKDRIIHELKHYYHGFRLLALETRVSAKYLWTVLRGATLSRRERQQLVRTVSDLFRLVPFSFFIIVPFMELALPIFIKLFPGMLPSTFQESSKEEEKWRKQVKLRVEMAKFLQDTIEEIGLERKTRNKESTRSLEFALFIKKVRNEGGYVSNEELLKFSKLFEDEITLDNLSMGQLRSLCRLMSINSLGSPEILRFQLNMKIRELKADDKQIAAEGGVDALSSIDLQSACRARGMRAIGVSEERLKEQLVQWLELSLNDKVPPALLLLSRTLYLPEEVSFPDRLKAIVQNLPDGLAETTKQKLTEMEGGQIDHKARIELIRSIESAIANEKKDEEKKKKAAEEALKS--KEEAEKAKVQEKEKLVDVAAQAIVHELKKDIYDAVASTSSTTEA----KEPAAKPSEAKEEKKEDITVDKKDLSHIEEIIVGGPIKEAKHDILGLREKVLEHKEDLMEINSLDGAFAET--------KIAKRLRHKLNSMIEDVDSMVDKL-----------EDEKRNIREMLIDPTVENSVD--LKKEREVRIQDVIDSLAKLKESKGEQADDGEQRERIEALLKTIDEDSDGIVDKQLVLEVIELLEKHTDVHVSAAQMASMIGTLKKEDEVA 687          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Fly
Match: Letm1 (gene:FBgn0284252 transcript:FBtr0072349)

HSP 1 Score: 266.544 bits (680), Expect = 4.891e-75
Identity = 146/310 (47.10%), Postives = 208/310 (67.10%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAG-TEERVD 1460
            PL  R+ DELVHYYHGF+L F D+ +   +L R+  G TLTRRE KQL RT++D+ R++PF VFIIVPFME LLP ++KFFP MLPSTF+T +  +E + Q L  +LE+AKFLQ+ + +   +   +    +   F  F  + R     V   +I++F+  F+DE+TL+SL+ + L ALC++L++NTIG   LLRFQL +K+R L  DD++IA EG+D + + ELQQ  + RGMR+YG+ E RLR+QL +W+ LSL ++VP TLLLLSR M + +     ++LK+ I VLP  V    +   G +E +VD
Sbjct:  180 PLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHK-EHSSEEAKQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAIGESEGKVD 488          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Fly
Match: Letm1 (gene:FBgn0284252 transcript:FBtr0072348)

HSP 1 Score: 266.544 bits (680), Expect = 4.891e-75
Identity = 146/310 (47.10%), Postives = 208/310 (67.10%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAG-TEERVD 1460
            PL  R+ DELVHYYHGF+L F D+ +   +L R+  G TLTRRE KQL RT++D+ R++PF VFIIVPFME LLP ++KFFP MLPSTF+T +  +E + Q L  +LE+AKFLQ+ + +   +   +    +   F  F  + R     V   +I++F+  F+DE+TL+SL+ + L ALC++L++NTIG   LLRFQL +K+R L  DD++IA EG+D + + ELQQ  + RGMR+YG+ E RLR+QL +W+ LSL ++VP TLLLLSR M + +     ++LK+ I VLP  V    +   G +E +VD
Sbjct:  180 PLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHK-EHSSEEAKQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAIGESEGKVD 488          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Fly
Match: Letm1 (gene:FBgn0284252 transcript:FBtr0072347)

HSP 1 Score: 266.544 bits (680), Expect = 4.891e-75
Identity = 146/310 (47.10%), Postives = 208/310 (67.10%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAG-TEERVD 1460
            PL  R+ DELVHYYHGF+L F D+ +   +L R+  G TLTRRE KQL RT++D+ R++PF VFIIVPFME LLP ++KFFP MLPSTF+T +  +E + Q L  +LE+AKFLQ+ + +   +   +    +   F  F  + R     V   +I++F+  F+DE+TL+SL+ + L ALC++L++NTIG   LLRFQL +K+R L  DD++IA EG+D + + ELQQ  + RGMR+YG+ E RLR+QL +W+ LSL ++VP TLLLLSR M + +     ++LK+ I VLP  V    +   G +E +VD
Sbjct:  180 PLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHK-EHSSEEAKQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAIGESEGKVD 488          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:570745])

HSP 1 Score: 328.946 bits (842), Expect = 1.322e-99
Identity = 231/598 (38.63%), Postives = 360/598 (60.20%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE----DKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            RV DE+ HYYHGF+L + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R ++ DD++IA EG+D +   ELQ   R RGMR+ GV E RLR QL QWL L L + +PT+LLLLSR M+LP+TL+P +QLK  +  LP+ ++  A++K    +  +VD KTKLE   +E+  I +E    +  +     LAD   K  E     +A ++E++     D       + V   S+ +    +D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI + LS + +   V+  E K+ + LS +++ MI  ++K +  +E +           K V++  M     DS  +P I  E  I++N+++  +K ++   +H K ++I   LDE+KDGKI++D ++K+++L++  ++ + ++++A+++
Sbjct:  163 RVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKASKGNVTE--EFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENRERELER-----LADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETL----RDTAPVLEGIKGEE-ITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVE--ESKASQRLSKRVNRMIGRMDKIITELEKD-----------KMVLDGQM-----DSETTPPI-GENLISINELITVMKQIQNIPEH-KLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 728          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:570745])

HSP 1 Score: 327.791 bits (839), Expect = 3.267e-99
Identity = 231/603 (38.31%), Postives = 361/603 (59.87%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE----DKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIK-----KERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            RV DE+ HYYHGF+L + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R ++ DD++IA EG+D +   ELQ   R RGMR+ GV E RLR QL QWL L L + +PT+LLLLSR M+LP+TL+P +QLK  +  LP+ ++  A++K    +  +VD KTKLE   +E+  I +E    +  +     LAD   K  E     +A ++E++     D       + V   S+ +    +D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI + LS + +   V+  E K+ + LS +++ MI  ++K +  +E +           K V++  M     DS  +P I      +E  I++N+++  +K ++   +H K ++I   LDE+KDGKI++D ++K+++L++  ++ + ++++A+++
Sbjct:  147 RVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKASKGNVTE--EFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENRERELER-----LADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETL----RDTAPVLEGIKGEE-ITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVE--ESKASQRLSKRVNRMIGRMDKIITELEKD-----------KMVLDGQM-----DSETTPPIGVFLSYRENLISINELITVMKQIQNIPEH-KLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 718          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:570745])

HSP 1 Score: 325.865 bits (834), Expect = 2.855e-98
Identity = 231/608 (37.99%), Postives = 361/608 (59.38%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE----DKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIK----------KERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            RV DE+ HYYHGF+L + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R ++ DD++IA EG+D +   ELQ   R RGMR+ GV E RLR QL QWL L L + +PT+LLLLSR M+LP+TL+P +QLK  +  LP+ ++  A++K    +  +VD KTKLE   +E+  I +E    +  +     LAD   K  E     +A ++E++     D       + V   S+ +    +D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI + LS + +   V+  E K+ + LS +++ MI  ++K +  +E +           K V++  M     DS  +P I           +E  I++N+++  +K ++   +H K ++I   LDE+KDGKI++D ++K+++L++  ++ + ++++A+++
Sbjct:  163 RVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKASKGNVTE--EFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENRERELER-----LADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETL----RDTAPVLEGIKGEE-ITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVE--ESKASQRLSKRVNRMIGRMDKIITELEKD-----------KMVLDGQM-----DSETTPPIGLFFEKRSDLPRENLISINELITVMKQIQNIPEH-KLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 739          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-090521-4])

HSP 1 Score: 204.527 bits (519), Expect = 6.854e-57
Identity = 162/322 (50.31%), Postives = 217/322 (67.39%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEERVDP-KTKLEVIKEEQKVI 1505
            +V DEL HYYHGF+L   D  +A  ++ RL  G  LTRRER++L+RT AD+ R+VPF++F+IVPFMEFLLP +LK FP MLPSTF+TE+K +E   + L  KLE+AKFLQE IAE A + K   GD  +   FS +++Q R +G    T+DI++FS LFEDE+TLE L    L ALCKLL++  IG   LLRFQL M++R +K DD+MIA EG+  + V ELQ   R RGMRS G+  ++LR QL QWL L L++ VP +LLLLSR MYL + LTP+  +   +  L KT  N   ++A T  + +P  + +EV+ +   VI
Sbjct:  122 KVLDELKHYYHGFRLLGIDTKIAGRMVWRLLHGQQLTRRERRRLMRTCADLFRLVPFMLFVIVPFMEFLLPVFLKLFPEMLPSTFETETKKEEKQKKGLAAKLELAKFLQETIAEMARRNKAAVGD--ETQKFSTYVQQVRHTGEQPSTKDIVKFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMQLRTIKADDEMIATEGVSVMTVAELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD-LTPKPPVIPPVPKLEKT--NAPPVEADTSAKGNPLSSSVEVMVDSAPVI 438          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-090521-4])

HSP 1 Score: 160.999 bits (406), Expect = 3.695e-42
Identity = 129/325 (39.69%), Postives = 175/325 (53.85%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEERVDP-KTKLEVIKEEQKVI 1505
            L  +V DEL HYYHGF+L   D  +A  ++ RL  G  LTRRER++  +    +A                                                 KLE+AKFLQE IAE A + K   GD  +   FS +++Q R +G    T+DI++FS LFEDE+TLE L    L ALCKLL++  IG   LLRFQL M++R +K DD+MIA EG+  + V ELQ   R RGMRS G+  ++LR QL QWL L L++ VP +LLLLSR MYL + LTP+  +   +  L KT  N   ++A T  + +P  + +EV+ +   VI
Sbjct:  119 LGQKVLDELKHYYHGFRLLGIDTKIAGRMVWRLLHGQQLTRRERRREEKQKKGLA------------------------------------------------AKLELAKFLQETIAEMARRNKAAVGD--ETQKFSTYVQQVRHTGEQPSTKDIVKFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMQLRTIKADDEMIATEGVSVMTVAELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD-LTPKPPVIPPVPKLEKT--NAPPVEADTSAKGNPLSSSVEVMVDSAPVI 390          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 318.931 bits (816), Expect = 1.646e-95
Identity = 235/609 (38.59%), Postives = 378/609 (62.07%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLK-AGTE-ERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKE------------SDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DE+ HYYHGF+L + D  +A  +L+++  GH ++RRER+Q +R  AD+ R+VPFLVF+IVPFMEFLLP  LK FP MLPSTF+T SK +E + ++L+ KLE+AKFLQ+ I E A + K  KGD      F+ F ++ R +G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R +K DD++IA+EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L++++PT+LLLLSR +YLP+TL+P +QLK  +  LP++V+  A++K A  E E+VD KTKLE   +E++ I +E +  +  +     LAD   KES+  A  ++++S  +P+ A   E+ T   +            S++ EI K D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI K LS + +   ++  E K+ K L+ +++ MI +++K +  +E E K           V++E +   S+         +E  +++N+++  ++ ++K  + +K   I + LDE+KDGKI++D + K+++L++  ++ + +S++A+++E++
Sbjct:  158 KVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNKAAKGDVT--AEFATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMER-----LAD-AAKESQQVAAKVDVQS--APEEAISGEMKTATADTAAEPAVAQMSASEQAEILK-DTAPVLEGIKGEE-ITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQ--ETKASKILTKRVNRMIGQMDKIISELENEEK-----------VLDEHIEKGSVPPVGLYFAFRENLVSINELISIMRHIQKIPE-QKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIMELL 740          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 315.849 bits (808), Expect = 4.339e-95
Identity = 229/599 (38.23%), Postives = 370/599 (61.77%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLK-AGTE-ERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIE--LKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DE+ HYYHGF+L + D  +A  +L+++  GH ++RRER+Q +R  AD+ R+VPFLVF+IVPFMEFLLP  LK FP MLPSTF+T SK +E + ++L+ KLE+AKFLQ+ I E A + K  KGD      F+ F ++ R +G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R +K DD++IA+EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L++++PT+LLLLSR +YLP+TL+P +QLK  +  LP++V+  A++K A  E E+VD KTKLE   +E++ I +E +  +  +     LAD   +  +  A ++   L  VE   T   S+   ++K++  V           +  +  + I  +++  +  A   L+E K L    KEE+  LK       E  +EI K LS + +   ++  E K+ K L+ +++ MI +++K +  +E E K           V++E +   S+     PV   E  +++N+++  ++ ++K  + +K   I + LDE+KDGKI++D + K+++L++  ++ + +S++A+++E++
Sbjct:  117 KVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNKAAKGDVT--AEFATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMER-----LADAAKESQQVAAKVMASLLNGVELCGTGATSQDSEILKDTAPV-----------LEGIKGEEITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQ--ETKASKILTKRVNRMIGQMDKIISELENEEK-----------VLDEHIEKGSV----PPV--GENLVSINELISIMRHIQKIPE-QKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIMELL 677          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 315.849 bits (808), Expect = 6.087e-95
Identity = 233/597 (39.03%), Postives = 367/597 (61.47%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLK-AGTE-ERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DE+ HYYHGF+L + D  +A  +L+++  GH ++RRER+Q +R  AD+ R+VPFLVF+IVPFMEFLLP  LK FP MLPSTF+T SK +E + ++L+ KLE+AKFLQ+ I E A + K  KGD      F+ F ++ R +G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R +K DD++IA+EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L++++PT+LLLLSR +YLP+TL+P +QLK  +  LP++V+  A++K A  E E+VD KTKLE   +E++ I +E +  +  +     LAD   KES+  A             A +   +  +  S++ EI K D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI K LS + +   ++  E K+ K L+ +++ MI +++K +  +E E K  D   E                SS  P+   E  +++N+++  ++ ++K  + +K   I + LDE+KDGKI++D + K+++L++  ++ + +S++A+++E++
Sbjct:  130 KVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNKAAKGDVT--AEFATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMER-----LAD-AAKESQQVA-------------AKVMATVAQMSASEQAEILK-DTAPVLEGIKGEE-ITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQ--ETKASKILTKRVNRMIGQMDKIISELENEEKVLDEHIEK--------------GSSDCPL---ENLVSINELISIMRHIQKIPE-QKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIMELL 683          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 311.612 bits (797), Expect = 1.951e-93
Identity = 231/600 (38.50%), Postives = 369/600 (61.50%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLK-AGTE-ERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIE--LKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPI-PVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DE+ HYYHGF+L + D  +A  +L+++  GH ++RRER+Q +R  AD+ R+VPFLVF+IVPFMEFLLP  LK FP MLPSTF+T SK +E + ++L+ KLE+AKFLQ+ I E A + K  KGD      F+ F ++ R +G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R +K DD++IA+EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L++++PT+LLLLSR +YLP+TL+P +QLK  +  LP++V+  A++K A  E E+VD KTKLE   +E++ I +E +  +  +     LAD   +  +  A ++   L  VE      +SEIL               K+  P+   +  + I  +++  +  A   L+E K L    KEE+  LK       E  +EI K LS + +   ++  E K+ K L+ +++ MI +++K +  +E E K           V++E +   S+     PV   E  +++N+++  ++ ++K  + +K   I + LDE+KDGKI++D + K+++L++  ++ + +S++A+++E++
Sbjct:  133 KVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNKAAKGDVT--AEFATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMER-----LADAAKESQQVAAKVMASLLNGVE------LSEIL---------------KDTAPVLEGIKGEEITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQ--ETKASKILTKRVNRMIGQMDKIISELENEEK-----------VLDEHIEKGSV----PPV--GENLVSINELISIMRHIQKIPE-QKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIMELL 684          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 309.686 bits (792), Expect = 1.055e-92
Identity = 229/599 (38.23%), Postives = 367/599 (61.27%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLK-AGTE-ERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIE--LKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DE+ HYYHGF+L + D  +A  +L+++  GH ++RRER+Q +R  AD+ R+VPFLVF+IVPFMEFLLP  LK FP MLPSTF+T SK +E + ++L+ KLE+AKFLQ+ I E A + K  KGD      F+ F ++ R +G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R +K DD++IA+EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L++++PT+LLLLSR +YLP+TL+P +QLK  +  LP++V+  A++K A  E E+VD KTKLE   +E++ I +E +  +  +     LAD   +  +  A ++   L  VE          L+ +  S++ EI K D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI K LS + +   ++  E K+ K L+ +++ MI +++K +  +E E               E+V+              +E  +++N+++  ++ ++K  + +K   I + LDE+KDGKI++D + K+++L++  ++ + +S++A+++E++
Sbjct:  129 KVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNKAAKGDVT--AEFATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMER-----LADAAKESQQVAAKVMASLLNGVE----------LSQMSASEQAEILK-DTAPVLEGIKGEE-ITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQ--ETKASKILTKRVNRMIGQMDKIISELENE---------------EKVLYFAF----------RENLVSINELISIMRHIQKIPE-QKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIMELL 680          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Match: Letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:1932557])

HSP 1 Score: 295.049 bits (754), Expect = 3.382e-87
Identity = 225/604 (37.25%), Postives = 351/604 (58.11%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAG--TEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAP-------ISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAK---------TLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DEL HYYHGF+L + D  +A  +L R+  GHTLTRRER+Q +R  AD+ R+VPFLVF++VPFMEFLLP  +K FP MLPSTF+T+S  +E + ++L+ KLE+AKFLQ+ I E A K K  KG+      FS F ++ RE+G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL M++R +K DD++I+ EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L  ++PT+LL+LSR MYLP+TL+P +QLK  +  LP+ V+  A++K      E+VD K KLE   +E+  I             E+  A E +K+ + +     L     P+  P        SE+LT             D  P  +  +  + I  +++  +  A + L+E K             KE++    E  +EI K LS + E   ++  E  + K LS ++ +MI +I+  +  +E        +++D K        +    S+P+     E  I++ +++ ++K ++   +H K +++ S LD++KDG I +D LVK+I L+N  +V++ ++++A+++  +
Sbjct:  155 KVLDELRHYYHGFRLLWIDTKIAARMLWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVVVKLFPNMLPSTFETQSIKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGNATK--DFSAFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQWLDLHLHHEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEKVDNKAKLEATLQEEAAIQ-------QEHLEELKRASEAVKDIQPEVAEATLPGRPGPEPQPPVDDVILPSEVLT-------------DTAPV-LEGLKGEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYIE--ESAASKRLSKRVQQMIGQIDGLITQLET-------TQQDGK--------LGPSQSTPT----GESVISITELISAMKQIKHIPEH-KLISLTSALDDNKDGNINIDDLVKVIDLVNKEDVQISTTQVAEIVATL 713          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Match: Letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444979])

HSP 1 Score: 199.904 bits (507), Expect = 3.786e-55
Identity = 137/270 (50.74%), Postives = 186/270 (68.89%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIK-GDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            ++ +EL +YY GF L + D  VA  I+ RL  G+ LTRRER++L+RT AD+ R+VPF+VFIIVPFMEFL+P +LK FP MLPSTF++ESK +E   + +  KLEIAKFLQE + E A +   K GD    +  S ++KQ  ++G    T++I+RFS LF+D++ LE L+   L ALCKLL++ T G   LLRFQL M ++ +K DD++IA EG+  + V ELQ   R RGMRS G+ E +L  QL+ WL L L++ VP +LLLLSR  YL
Sbjct:  123 KIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDAS--SQLSSYVKQV-QTGHKPSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMTLKSIKADDEIIAKEGVKALSVSELQSACRARGMRSLGLTEEQLCQQLTGWLDLHLKENVPPSLLLLSRTFYL 389          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Match: Letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444979])

HSP 1 Score: 81.6481 bits (200), Expect = 2.105e-16
Identity = 79/157 (50.32%), Postives = 107/157 (68.15%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIK-GDGVDLTTFSDFMKQARESGLTVDTQDILRFSH 1013
            ++ +EL +YY GF L + D  VA  I+ RL  G+ LTRRER++L+RT AD+ R+VPF+VFIIVPFMEFL+P +LK FP MLPSTF++ESK +E   + +  KLEIAKFLQE + E A +   K GD    +  S ++KQ    GL V  Q +L +S+
Sbjct:  123 KIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDAS--SQLSSYVKQVM--GL-VPGQRLLGWSY 274          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Match: Letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444979])

HSP 1 Score: 65.855 bits (159), Expect = 2.071e-11
Identity = 56/97 (57.73%), Postives = 74/97 (76.29%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQ 836
            ++ +EL +YY GF L + D  VA  I+ RL  G+ LTRRER++L+RT AD+ R+VPF+VFIIVPFMEFL+P +LK FP MLPSTF++ESK    IL+
Sbjct:  123 KIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKVHGILK 219          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5ZK33|LETM1_CHICK (Mitochondrial proton/calcium exchanger protein OS=Gallus gallus OX=9031 GN=LETM1 PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 2.057e-101
Identity = 234/598 (39.13%), Postives = 362/598 (60.54%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAG--TEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEP-KPIPVVTEQVIG----AQDLAQIESAIANLEEAK------TLFHKEEIGVLKESRKEISKI--LSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            R+ DEL HYYHGF+L + D  +A  +L R+  G+TL+RRER+Q +R  AD+ R+VPFLVF++VPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A K K  KG+      FS F ++ RE+G     ++ILRFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL M++R +K DD+MIA EG+D + V ELQ   R RGMR+ GV E RLR QL QWL L L +++PT+LL+LSR MYLP+TL+P +QLK  +  LP++V+  A++K      E+VD K +LE   +E+  I    + ++  +   I  A E  KE+   A  ++L+S    + A +    + V    K E+ K D E  K    V E + G     +++  +  A   L+E K          +E  G ++E  +++ +I  LS + +   V+  E K+ K L+ +++ MI +I+K +  +E   K  D             + +   DS P+     E  I++ +++ ++K ++K  + EK   I   LDE+KDGKI++D++VK+++L++  +V + +S++A+++
Sbjct:  153 RIVDELKHYYHGFRLLWIDTKIAARMLWRILHGNTLSRRERRQFLRICADLFRLVPFLVFLVVPFMEFLLPVALKLFPNMLPSTFETKSKKEERLKKQLRVKLELAKFLQDTIEEMALKNKAAKGNVT--KDFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRTIKADDKMIAEEGVDSLTVKELQAACRARGMRALGVTEERLREQLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVEGEKVDNKARLEATLQEEAAIR---KENEEKEMERITEAAEKAKETLQVAA-MKLESAVDLEPAVLQVKESQVAMDSKQELAKADMETLKDTAPVLEGIKGEEITKEEIDMLSDACNKLQEQKKSLTKEKEELEELKGDIQEYNEDLQEIKELSKAGQEEVVE--ESKASKRLTKRVNRMIGQIDKIINELETNQKTVD-------------VKLDRGDSPPA----GENLISIAELINAMKQIQKIPE-EKLTRIAEALDENKDGKIDIDNVVKVVELIDKEDVDIGTSQVAEIM 724          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q0VCA3|LETM1_BOVIN (Mitochondrial proton/calcium exchanger protein OS=Bos taurus OX=9913 GN=LETM1 PE=2 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 2.607e-100
Identity = 230/608 (37.83%), Postives = 360/608 (59.21%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGT--EERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLAD-------EVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKE---------EIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            PL  RV DEL HYYHGF+L + D  +A  +L R+  GH+LTRRER+Q +R  AD+ R+VPFL F++VPFMEFLLP  +K FP MLPSTF+T+S  +E + ++L+ KLE+AKFLQ+ I E A K K  KG       FS F ++ RE+G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL M++R +K DD++IA EG+D + V ELQ   R RGMR+ GV E+RLR QL QWL L L +++PT+LL+LSR MYLPETL+P +QLK  +  LP+ V+  A++K      E+VD K KLE   +E+  I +E    +  ++++  +A        EV+ E     P+ EL+  E   T P SE+L   K+S  V           +  + E+ I  +++  + +A + L+E K    KE         ++    +  +EI K LS + E   V+  E K+ K L+ ++ +MI +++  +  +E + K                     +  +       E  I+V++++ ++K ++   +  K +++ S LD++KDGK+++D LVK+I+L++  +V + +S++A+++  +
Sbjct:  138 PLGQRVLDELRHYYHGFRLLWIDTKIAARMLWRILHGHSLTRRERRQFLRICADLFRLVPFLFFVVVPFMEFLLPVAVKLFPNMLPSTFETQSSKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSAT--KDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLELHLHQEIPTSLLILSRAMYLPETLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQRKSQAAVAQAAKEVEPEVVAEGAPGRPVAELQPEEPAVTLP-SEVL---KDSAPV-----------LEGLKEEEITQEEIDVLSNACSKLKEQKKSLTKEKEELELLKGDVQDYSQDLQEIKKELSKTGEEMYVE--ESKASKRLTKRVQQMIGQMDSLLAQLEADQKAG------------------RLGPAAEAAPAGETVISVSELINAMKQIKHIPES-KLLSLASALDDNKDGKVDIDDLVKVIELVDKEDVHISTSQVAEIVATL 707          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q1LY46|LETM1_DANRE (Mitochondrial proton/calcium exchanger protein OS=Danio rerio OX=7955 GN=letm1 PE=3 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 9.982e-99
Identity = 231/598 (38.63%), Postives = 360/598 (60.20%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE----DKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            RV DE+ HYYHGF+L + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R ++ DD++IA EG+D +   ELQ   R RGMR+ GV E RLR QL QWL L L + +PT+LLLLSR M+LP+TL+P +QLK  +  LP+ ++  A++K    +  +VD KTKLE   +E+  I +E    +  +     LAD   K  E     +A ++E++     D       + V   S+ +    +D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI + LS + +   V+  E K+ + LS +++ MI  ++K +  +E +           K V++  M     DS  +P I  E  I++N+++  +K ++   +H K ++I   LDE+KDGKI++D ++K+++L++  ++ + ++++A+++
Sbjct:  163 RVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKASKGNVTE--EFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENRERELER-----LADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETL----RDTAPVLEGIKGEE-ITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVE--ESKASQRLSKRVNRMIGRMDKIITELEKD-----------KMVLDGQM-----DSETTPPI-GENLISINELITVMKQIQNIPEH-KLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 728          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q0VA06|LETM1_XENTR (Mitochondrial proton/calcium exchanger protein OS=Xenopus tropicalis OX=8364 GN=letm1 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.399e-94
Identity = 237/609 (38.92%), Postives = 379/609 (62.23%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLK-AGTE-ERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKE------------SDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLF--HKEEIGVLK-------ESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            +V DE+ HYYHGF+L + D  +A  +L+++  GH ++RRER+Q +R  AD+ R+VPFLVF+IVPFMEFLLP  LK FP MLPSTF+T SK +E + ++L+ KLE+AKFLQ+ I E A + K  KGD      F+ F ++ R +G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL MK+R +K DD++IA+EG+D + V ELQ   R RGMR+ GV E+RL+ QL QWL L L++++PT+LLLLSR +YLP+TL+P +QLK  +  LP++V+  A++K A  E E+VD KTKLE   +E++ I +E +  +  +     LAD   KES+  A  ++++S  +P+ A   E+ T   +            S++ EI K D  P    +  E+ I  +++  +  A   L+E K L    KEE+  LK       E  +EI K LS + +   ++  E K+ K L+ +++ MI +++K +  +E E K           V++E +   S+     PV   E  +++N+++  ++ ++K  + +K   I + LDE+KDGKI++D + K+++L++  ++ + +S++A+++E++
Sbjct:  158 KVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNKAAKGDVT--AEFATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMER-----LAD-AAKESQQVAAKVDVQS--APEEAISGEMKTATADTAAEPAVAQMSASEQAEILK-DTAPVLEGIKGEE-ITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQ--ETKASKILTKRVNRMIGQMDKIISELENEEK-----------VLDEHIEKGSV----PPV--GENLVSINELISIMRHIQKIPE-QKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIMELL 734          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|O95202|LETM1_HUMAN (Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 9.025e-88
Identity = 230/601 (38.27%), Postives = 353/601 (58.74%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGT--EERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE---DKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIES-AIANLEEAKTLF---------HKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVI 2300
            RV DEL HYYHGF+L + D  +A  +L R+  GH+LTRRER+Q +R  AD+ R+VPFLVF++VPFMEFLLP  +K FP MLPSTF+T+S  +E + ++L+ KLE+AKFLQ+ I E A K K  KG       FS F ++ RE+G     ++I+RFS LFEDE+TL++L    L ALCKLL++ +IG    LRFQL M++R +K DD++IA EG+D + V ELQ   R RGMR+ GV E+RLR QL QWL L L +++PT+LL+LSR MYLP+TL+P +QLK  +  LP+ V+  A++K      E+VD K KLE   +E+  I +E                E+ K SE   D  P   + + + P T P  E+   V +S+ +      K+  P+    ++    ++   I S A + L+E K             KE++    E  +EI K LS + E   V+  E K+ K L+ ++ +MI +I+  +  +E++ +    +  +  P  E V++V  +             IN    ++ +K + ++    K  ++ + LDE+KDGK+ +D LVK+I+L++  +V + +S++A+++  +
Sbjct:  156 RVLDELKHYYHGFRLLWIDTKIAARMLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSAT--KDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREK------------ELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETL------KDTAPVLEGLKEEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVE--ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAEL-------------INA---MKQVKHIPES----KLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATL 714          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A4S2LGI3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009031 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 4.740e-121
Identity = 268/672 (39.88%), Postives = 387/672 (57.59%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTA---KLKAGTEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE-------DKAPII------ELKSVES-PDTAPI-----SEILTVVKESDK----------VEIQKQDKEP----------KPIPVVTEQV--------------IGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDET-----APVKQPEEKSVKNLSSKLDEMIDEIEKTVEHI--------------EVEAKKA-DPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKEAIIAE 2324
            LW R K E+VHYYHGF+L   ++ +A GI  RL +GH L+RRERKQLVRT AD+ R+VPF +FIIVPFMEFLLPFYLKFFPFMLPSTFK ++ + E I Q+LK KLE+ +FLQE +  +            +  F DF+K+ +ESG     ++I RFS LFED+VTLESL  K LK LC+LL + TIGP  LLRFQ+ ++VRQLK +D++IA EG+DKIPVWELQ L +ERGMR+ G+ E RLR QL+QWL+L LEK VP TLLL SR +++ +T + +  LK+AI  LP + S  A    L++     +DP+ K+E++++EQ  I   R             +    K          DKAP +      EL+S E+  D API     +E+L  V ++ K          V I   D++P           P PV   +               I A DL QIE+AI+   E+    H+E +  LKE   E +K +   +        PV +   K+   L++++ +MI+E++  +E +              EV  K A +PSE+ +  +++ + A              +R +++ND+L +++ ++K  D  KW  IL +LDED+DGKIE+ H++ +++LL +  VKL S E+ ++LE++D E + AE
Sbjct:  136 LWQRAKKEIVHYYHGFRLLGLEVRIATGICFRLLRGHALSRRERKQLVRTVADIIRLVPFAIFIIVPFMEFLLPFYLKFFPFMLPSTFKDKTSESERIRQRLKAKLEMTRFLQETLHHTTGTALEASGSPTVDEFQDFLKKVQESGQPATAEEITRFSKLFEDQVTLESLEMKQLKMLCQLLSLPTIGPSNLLRFQIWLRVRQLKAEDRLIAKEGLDKIPVWELQSLCQERGMRALGLTEERLRSQLAQWLALHLEKNVPVTLLLFSRALHVTQTSSGDLPLKEAIAQLPPSASEQAAALALESTPHAELDPRAKMELLRKEQASIKAARVQRDQELAELKSTSQAEGKTEPTTDEKLVDKAPTVKGLPKEELESGEAIVDQAPIVAAEKAEVLNTVTDTTKISHISTSEPSVTIAAPDEKPAVDAVTRISEAPAPVAASEPATAVIDKTNEEDTEISADDLNQIETAIS---ESSDALHEEALDGLKEEVAETTKRIKQHEAALVSVDRPVDKRTRKAANRLAARVGQMIEEMDTMIEKLNDERKQLLKNIELREVHVKHATEPSEQTE--MLDAIQA------------DHQRVVDINDLLLALRRIQKVPDDTKWEKILKVLDEDQDGKIELQHVLSVVELLGTENVKLSSKEVKRVLEMVDNEHLAAE 790          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A4S2LFQ1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009031 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 5.790e-119
Identity = 268/677 (39.59%), Postives = 388/677 (57.31%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTA---KLKAGTEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESE-------DKAPII------ELKSVES-PDTAPI-----SEILTVVKESDK----------VEIQKQDKEP----------KPIPVVTEQV--------------IGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDET-----APVKQPEEKSVKNLSSKLDEMIDEIEKTVEHI--------------EVEAKKA-DPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHL-----VKMIKLLNSIEVKLPSSEIAKLLEVIDKEAIIAE 2324
            LW R K E+VHYYHGF+L   ++ +A GI  RL +GH L+RRERKQLVRT AD+ R+VPF +FIIVPFMEFLLPFYLKFFPFMLPSTFK ++ + E I Q+LK KLE+ +FLQE +  +            +  F DF+K+ +ESG     ++I RFS LFED+VTLESL  K LK LC+LL + TIGP  LLRFQ+ ++VRQLK +D++IA EG+DKIPVWELQ L +ERGMR+ G+ E RLR QL+QWL+L LEK VP TLLL SR +++ +T + +  LK+AI  LP + S  A    L++     +DP+ K+E++++EQ  I   R             +    K          DKAP +      EL+S E+  D API     +E+L  V ++ K          V I   D++P           P PV   +               I A DL QIE+AI+   E+    H+E +  LKE   E +K +   +        PV +   K+   L++++ +MI+E++  +E +              EV  K A +PSE+ +  +++ + A              +R +++ND+L +++ ++K  D  KW  IL +LDED+DGKIE+ H+     +++++LL +  VKL S E+ ++LE++D E + AE
Sbjct:  136 LWQRAKKEIVHYYHGFRLLGLEVRIATGICFRLLRGHALSRRERKQLVRTVADIIRLVPFAIFIIVPFMEFLLPFYLKFFPFMLPSTFKDKTSESERIRQRLKAKLEMTRFLQETLHHTTGTALEASGSPTVDEFQDFLKKVQESGQPATAEEITRFSKLFEDQVTLESLEMKQLKMLCQLLSLPTIGPSNLLRFQIWLRVRQLKAEDRLIAKEGLDKIPVWELQSLCQERGMRALGLTEERLRSQLAQWLALHLEKNVPVTLLLFSRALHVTQTSSGDLPLKEAIAQLPPSASEQAAALALESTPHAELDPRAKMELLRKEQASIKAARVQRDQELAELKSTSQAEGKTEPTTDEKLVDKAPTVKGLPKEELESGEAIVDQAPIVAAEKAEVLNTVTDTTKISHISTSEPSVTIAAPDEKPAVDAVTRISEAPAPVAASEPATAVIDKTNEEDTEISADDLNQIETAIS---ESSDALHEEALDGLKEEVAETTKRIKQHEAALVSVDRPVDKRTRKAANRLAARVGQMIEEMDTMIEKLNDERKQLLKNIELREVHVKHATEPSEQTE--MLDAIQA------------DHQRVVDINDLLLALRRIQKVPDDTKWEKILKVLDEDQDGKIELQHVLSLKNLQVVELLGTENVKLSSKEVKRVLEMVDNEHLAAE 795          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. TrEMBL
Match: C1LG65 (Leucine zipper-EF-hand-containing transmembrane protein 1, mitochondrial OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 3.021e-118
Identity = 281/716 (39.25%), Postives = 417/716 (58.24%), Query Frame = 3
Query:  309 HLFAKKFLFGHIHFGFFENNRYL--HTTVFIRCLNDKKESIEKPLGEKMLTSNEDTKGVELXXXXXXXXXXXXXXXXPLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTA---KLKAGTEERVDPKTKLEVIKEEQKVI-----HXXXXXXXXXXXXXIVLADEVLKESEDKAPIIE-LKSVESPDTAP-ISEILTVVKESDKVEIQKQDKEPKPIPVV------------------------------TEQV--IGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVK---NLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKER--YINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKE 2309
            +  A +FLF H+     ++++ +  H    I  +N KK  IE P+ E   T++ +          +  +  K+  K  LW+R+K E+VHYYHG +L   ++G+A GI  R+  GHTLTRRERKQLVRT AD+ R+VPF VFIIVPFME LLPFYLKFFPFMLPSTFK +S +   I Q+LK KLE+  FLQE + ++        D   +  F +F+K+ ++SG     +DI RFS LFED+VTL+SL+ K L+ LC+LL + TIGP  LLRFQ+ M+VRQLK +D++IA+EG+D IP WELQ L +ERGMRS G+ + +L+ QLS+WL+L LE+ VP TLLL SR +++ + L  +  L+QAI  LP + S+ A    L+      +DP TK++V++EEQ  I       ++E  +  K  ++  A   L E +D+AP+++ LK+ E     P +++  T + E+  +++Q     P   PV                               TE++  I A DLA+I SAIA   E+      E I  LKE   E +K+   ++  A  +  +++  K    L S++D +I E++  V+++  +  +   + ED++  I+E    K   S     IK ++   +++ D+L S+K +    D+ KW  IL LLDED DGKIEM HL+ +I+LL +  VKL S EIA++LE+ D E
Sbjct:   58 YFSANRFLFAHV-----QDSKRIEKHIDFPIWIINPKK--IETPIPEVNNTTSSNPSVQPTSEEPNKNNNEKKITKPSLWVRIKKEIVHYYHGIRLLVLEVGIASGICFRVLGGHTLTRRERKQLVRTLADILRLVPFAVFIIVPFMELLLPFYLKFFPFMLPSTFKDKSAEANAIQQRLKAKLELTHFLQETLLQTTGAIKSDSDTPTVDEFQEFIKKVQKSGEQAQAKDITRFSKLFEDQVTLDSLDNKQLRMLCQLLSLPTIGPSHLLRFQIWMRVRQLKAEDKLIASEGVDHIPPWELQSLCQERGMRSVGLPKEKLQSQLSEWLNLHLEQNVPITLLLFSRALHVTQALVDQNPLQQAIAQLPPSASSEAVARVLETTPHGELDPVTKIKVLREEQDSIKAERVQRKQELVEKQKAEQVKTATTGLPE-DDQAPLLKGLKNEELDKFTPGLTDSATSMSETTGIQLQMSKPAPNVQPVAMKEELVTGRLKGDADITPSFVDFEKPKTPDTEEITEISAGDLAEIRSAIA---ESTPELRDETIHELKEQVAETAKLQRQAELVAAEQVSDKRKSKAALRLGSRVDRLIKEMDMMVDNLNDKRVQLLKNIEDREIHIQESTEAKE-RSKIMDEIKADQDLMVDIKDLLISLKRIRNVPDNTKWEKILKLLDEDHDGKIEMKHLLSVIELLGTENVKLSSKEIARILEMFDNE 761          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A4Z2DSX9 (Mitochondrial proton/calcium exchanger protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008746 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 2.416e-117
Identity = 282/716 (39.39%), Postives = 416/716 (58.10%), Query Frame = 3
Query:  309 HLFAKKFLFGHIHFGFFENNRYL--HTTVFIRCLNDKKESIEKPLGEKMLTSNEDTKGVELXXXXXXXXXXXXXXXXPLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTA---KLKAGTEERVDPKTKLEVIKEEQKVIHXXXXXXXX-----XXXXXIVLADEVLKESEDKAPIIE-LKSVESPDTAP-ISEILTVVKESDKVEIQKQDKEPKPIPVV------------------------------TEQV--IGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVK---NLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKER--YINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKE 2309
            +  A +FLF H+     ++++ +  H    I  +N KK  IE P+ E   T++ +          +  +  K+  K  LW+R+K E+VHYYHG +L   ++G+A GI  R+  GHTLTRRERKQLVRT AD+ R+VPF VFIIVPFME LLPFYLKFFPFMLPSTFK +S +   I Q+LK KLE+  FLQE + ++        D   +  F +F+K+ ++SG     +DI RFS LFED+VTL+SL+ K L+ LC+LL + TIGP  LLRFQ+ M+VRQLK +D++IA+EG+D IP WELQ L +ERGMRS G+ + +L+ QLS+WL+L LE+ VP TLLL SR +++ + L  +  L+QAI  LP + S+ A    L+      +DP TK++V++EEQ  I  ER   K       K  ++  A   L E +D+AP+++ LK+ E     P +++  T + E+  +++Q     P   PV                               TE++  I A DLA+I SAIA   E+      E I  LKE   E +K+   ++  A  +  +++  K    L S++D +I E++  V+++  +  +   + ED++  I+E    K   S     IK ++   +++ D+L S+K +    D+ KW  IL +LDED DGKIEM HL+ +I+LL +  VKL S EIA++LE+ D E
Sbjct:   51 YFSANRFLFAHV-----QDSKRIEKHIDFPIWIINPKK--IETPIPEVNNTTSSNPSVQPTSEEPNKNNNEKKITKPSLWVRIKKEIVHYYHGIRLLVLEVGIASGICFRVLGGHTLTRRERKQLVRTLADILRLVPFAVFIIVPFMELLLPFYLKFFPFMLPSTFKDKSAEANAIQQRLKAKLELTHFLQETLLQTTGAIKSDSDTPTVDEFQEFIKKVQKSGEQAQAKDITRFSKLFEDQVTLDSLDNKQLRMLCQLLSLPTIGPSHLLRFQIWMRVRQLKAEDKLIASEGVDHIPPWELQSLCQERGMRSVGLPKEKLQSQLSEWLNLHLEQNVPITLLLFSRALHVTQALVDQNPLQQAIAQLPPSASSEAVARVLETTPHGELDPVTKIKVLREEQDSIKAERVQRKQEFVEKQKAEQVKTATTGLPE-DDQAPLLKGLKNEELDKFTPGLTDSATSMSETTGIQLQISKPAPNVQPVAMKEELVTGRLKGDADITPSFVDFEKPKTPDTEEITEISAGDLAEIRSAIA---ESTPELRDETIHELKEQVAETAKLQRQAELVAAEQVSDKRKSKAALRLGSRVDRLIKEMDMMVDNLNDKRVQLLKNIEDREIHIQESTEAKE-RSKIMDEIKADQDLMVDIKDLLISLKRIRNVPDNTKWEKILKVLDEDHDGKIEMKHLLSVIELLGTENVKLSSKEIARILEMFDNE 754          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A095AGV8 (LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_01288 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 5.589e-117
Identity = 267/658 (40.58%), Postives = 394/658 (59.88%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTA---KLKAGTEERVDPKTKLEVIKEEQKVIHXXXXX--------XXXXXXXXIVLADEVLKESEDKAPIIE-LKSVESPDTAPI-SEILTVVKESDKVEIQKQDKEP--------------------------------KPIPVVTEQV--IGAQDLAQIESAIA----NLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEH-----------IEVEAKKADPSEEDKK--PVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKEAI 2315
            P+WIR+KD +VHYYHGF+L   ++ +A GI  R+  GHTLTRRERKQLVRT AD+ R++PF VFIIVPFME L+PFY+KFFPFMLPSTFK +S +   I Q+LK KLE+  FLQE + ++A       D   +T F +F+K+ ++SG     +DI RFS LFED+VTL+SL+ K L+ LC+LL + TIGP  LLRFQ+ ++VRQLK +D++IANEG+D+IP WELQ L +ERGMRS G+ + +L+ QLS+WL L LEK VP TLLL SR +++ + L  +  L+QAI  LP + S+ A    L+    + +DP TK++V++EEQ  I  ER           K+ K   I+     L E  D+AP+++ LK+ E     P+ ++  T + ES   EIQ + ++P                                KP    TE+V  I A DLA+I SAIA    +L+       KE++  L++ R+  ++++++ + T   K    K+  +L S+L+ +I E++  V+            IEV     + S E K+   +++++ A              +R +++ND+L S+K ++   D  +W  IL +LDED DGKIE++H++ +I+LL S  VKL   EIA++LE+ID E +
Sbjct:  126 PMWIRIKDGIVHYYHGFRLLGLEIRIASGICFRVLGGHTLTRRERKQLVRTLADILRLLPFSVFIIVPFMEILIPFYVKFFPFMLPSTFKDKSTEANAIQQRLKAKLELTHFLQETLMQTAGALKSSSDAPTVTEFQEFIKKVQKSGEQAQAKDITRFSKLFEDQVTLDSLDNKQLRMLCRLLSLPTIGPSHLLRFQIWIRVRQLKAEDKLIANEGVDQIPPWELQSLCQERGMRSVGLPKEKLQSQLSEWLDLHLEKNVPITLLLFSRALHVTQALVDQNPLQQAIAQLPPSASSEAVARVLETTPHDELDPVTKIKVLREEQDSIKAERVQRKQELIEKQKSEKGKTIITG---LPEG-DQAPLLKGLKNEELDKVTPVLTDSATFMSES--TEIQSEIRKPVQNIQPIDTLQTSVNAKSKDDSHIDSLPVKSEKPKTSDTEEVTEISAGDLAEIHSAIAESTRHLDSETIDELKEQVAKLQQKRQ--AELVASEEVTDKRK---SKAALHLESRLERLIKEMDTMVDRLNDKRTQLLKDIEVFESHINESTESKERSKIMDQIKA------------DHDRMVDINDLLISLKRIQNIPDDTRWEKILKVLDEDHDGKIELNHILSVIELLGSENVKLSGKEIARVLEMIDNEHL 760          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:103046373])

HSP 1 Score: 314.309 bits (804), Expect = 2.568e-94
Identity = 224/593 (37.77%), Postives = 356/593 (60.03%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGD-GVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESP-------DTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEE-KSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            RV DE+ HYYHGF+L + D  +A  +L R+  G+ L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ + E A +   K D G     FS F ++ R+SG     + I+RFS LFEDE+TL++L    L ALC+LL++ +IG    LRFQL MK+R ++ DD++IA EG+D + V ELQ   R RGMR+ GV E RL+ QL QWL L L + +PT+LLLLSR M+LP+TL+P +QLK  +  LP+ V+  A++K    +  +VD KTKLE + +E+  I +E    +  +     LAD   K  E +     L SV+         DTAP+ E +    + +++  ++ D        + EQ        +    + +      L + E+   L+E +KE+SK       T   KQ EE K+ K+LS +++ MI  ++K +  +E +           K V++  M      S+ +P +  E  I++N+++  ++ ++   + +K ++I   LDE+KDGKI++D ++K+++L++  ++ + ++++A+++
Sbjct:  169 RVIDEIKHYYHGFRLLWIDTTIAGRMLWRVLNGNALSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTVEEIALRN--KADKGTVTEEFSTFFQKIRDSGERPSNEQIIRFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLNVNELQAACRVRGMRALGVTEERLKEQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIVAKEAQVKVAELDFSKVDNKTKLETMLQEEAAILQENREKEMER-----LADAAEKAKEQQEAEAALSSVDVAIHSETLRDTAPVLEGI----KGEEITKEEIDMLSDACTKLKEQKKLLTKEKEELEELKD----DVLEYSED---LEEIKKELSK-------TGQEKQVEESKASKHLSRRVNRMIGRMDKIINELEKD-----------KLVLDGQMG-----SATTPPV-GENLISINELITVMRHIQSIPE-QKLLSIAEALDENKDGKIDIDDVMKVVELIDKEDIDINTTQVAEIM 718          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:103046373])

HSP 1 Score: 313.538 bits (802), Expect = 7.099e-94
Identity = 224/602 (37.21%), Postives = 358/602 (59.47%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGD-GVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESP-------DTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEE-KSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPV---------IKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLL 2291
            RV DE+ HYYHGF+L + D  +A  +L R+  G+ L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ + E A +   K D G     FS F ++ R+SG     + I+RFS LFEDE+TL++L    L ALC+LL++ +IG    LRFQL MK+R ++ DD++IA EG+D + V ELQ   R RGMR+ GV E RL+ QL QWL L L + +PT+LLLLSR M+LP+TL+P +QLK  +  LP+ V+  A++K    +  +VD KTKLE + +E+  I +E    +  +     LAD   K  E +     L SV+         DTAP+ E +    + +++  ++ D        + EQ        +    + +      L + E+   L+E +KE+SK       T   KQ EE K+ K+LS +++ MI  ++K +  +E +           K V++  M      ++  PV         +++E  I++N+++  ++ ++   + +K ++I   LDE+KDGKI++D ++K+++L++  ++ + ++++A+++
Sbjct:  169 RVIDEIKHYYHGFRLLWIDTTIAGRMLWRVLNGNALSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTVEEIALRN--KADKGTVTEEFSTFFQKIRDSGERPSNEQIIRFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLNVNELQAACRVRGMRALGVTEERLKEQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIVAKEAQVKVAELDFSKVDNKTKLETMLQEEAAILQENREKEMER-----LADAAEKAKEQQEAEAALSSVDVAIHSETLRDTAPVLEGI----KGEEITKEEIDMLSDACTKLKEQKKLLTKEKEELEELKD----DVLEYSED---LEEIKKELSK-------TGQEKQVEESKASKHLSRRVNRMIGRMDKIINELEKD-----------KLVLDGQMG----SATTPPVGLFFEKRSDLQRENLISINELITVMRHIQSIPE-QKLLSIAEALDENKDGKIDIDDVMKVVELIDKEDIDINTTQVAEIM 729          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Match: letm2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:NCBI gene;Acc:103024686])

HSP 1 Score: 204.912 bits (520), Expect = 4.462e-57
Identity = 152/270 (56.30%), Postives = 192/270 (71.11%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            RV DEL HYYHGF+L   D  +A  ++ RL  G  LTRRER++L+RT AD+ R+VPF+VFIIVPFMEFLLP +LK FP MLPSTF+TESK +E   + L  KLE+AKFLQE IAE A + K   GD  +   FS +++Q R +G    T+DI++FS LFEDE+TLE L    L ALCKLL++  IG   LLRFQL M++R +K DD+MI+ EG+  + V ELQ  SR RGMRS G+  ++LR QL QWL L L++ VP +LLLLSR MYL
Sbjct:  117 RVLDELKHYYHGFRLLGIDTKIAGRMVWRLLHGQQLTRRERRRLMRTCADLFRLVPFMVFIIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKQKKGLAAKLELAKFLQETIAEMARRNKAAVGD--ETQQFSTYVQQVRHTGEQPTTKDIVKFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMQLRTIKTDDEMISKEGVAAMTVAELQAASRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYL 384          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000480.1 (pep scaffold:Pmarinus_7.0:GL485460:9771:10305:1 gene:ENSPMAG00000000433.1 transcript:ENSPMAT00000000480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.090e-20
Identity = 58/93 (62.37%), Postives = 69/93 (74.19%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESK 815
            L  RV  EL HYYHGF+L   D  VA  I+ ++  G  L RRER+QL+RT AD+ R++PFLVFIIVPFMEFLLP +LK FP MLPSTF+T SK
Sbjct:   19 LGARVVAELRHYYHGFRLLGIDTRVAARIVWQILHGSQLNRRERRQLLRTCADLFRLLPFLVFIIVPFMEFLLPVFLKLFPNMLPSTFETLSK 111          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Yeast
Match: MDM38 (Mitochondrial protein; forms a complex with Mba1p to facilitate recruitment of mRNA-specific translational activators to ribosomes; roles in protein export and K+/H+ exchange; human ortholog Letm1 implicated in Wolf-Hirschhorn syndrome [Source:SGD;Acc:S000005387])

HSP 1 Score: 138.658 bits (348), Expect = 1.149e-34
Identity = 99/277 (35.74%), Postives = 161/277 (58.12%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAK----FLQEAIAESA--TKKTIKGDGVDLTTFSDFMKQ---ARESG-LTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLS 1337
            L ++VK  L HY +G KL  +++ V+  +L +  +G+ L+RRER QL RT  D+ R++PF  F+I+PF E  LPF LK FP +LPST+++  KDK+    KL   +EI K    FL E + ES   T  TI+ +      F +F ++   A+E   +T    +I   + +F+++  L++L+   L A+ K + +   G   +LR+Q+  K++ +  DD+ I  EG++ +   EL Q    RGM++YGV++  L   L  WL L L +K+P+ L++LS
Sbjct:   83 LMVKVKHALKHYANGTKLLGYEIKVSTKLLIKFAQGYELSRRERNQLRRTMGDVFRLIPFSAFLIIPFAELFLPFALKLFPNLLPSTYES-GKDKQAKRNKL---IEIRKKTSEFLHETLEESNLITYNTIE-NAEKKQKFLNFFRKLYSAKEGKIMTFQHDEISAIAQMFKNDSVLDNLSRPQLAAMSKFMSLRPFGNDNMLRYQIRSKLKDIMNDDKTIDYEGVESLSQEELYQACVSRGMKAYGVSKEDLVDNLKVWLELRLRQKIPSVLMVLS 354          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Yeast
Match: YLH47 (Mitochondrial inner membrane protein; exposed to the mitochondrial matrix; associates with mitochondrial ribosomes; NOT required for respiratory growth; homolog of human Letm1, a protein implicated in Wolf-Hirschhorn syndrome [Source:SGD;Acc:S000006329])

HSP 1 Score: 136.346 bits (342), Expect = 1.408e-34
Identity = 112/381 (29.40%), Postives = 196/381 (51.44%), Query Frame = 3
Query:  534 PLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVD---LTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPE---EQLKQAILVLPKTVSNTAKLKAGTEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTV 1658
            P  ++++  L HY+ G KL   ++ ++  +L +   G+ LTRRE  QL RT+ D+ R+VPF  F+I+PF E LLPF LK FP +LPST+++ SK +E  L+ L+      K + E I  +  K   K + +       F+ F    R +G+    Q ++  + LF D+  L+++   YL AL K +++   G   +LR+++  K+ +LK DD  I  E  +++ + EL+     RG+RS  V  + L   L  WL++ L+ K+P+TLL+++         + E   + L   ++ +P  + +  K+    E+    K KL   K+ ++     +E  +  + A + + DE+  + +DK        V+  DT PI E   +
Sbjct:   80 PFKVKMQKALRHYWDGSKLLGLEIKISSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFLIIPFAELLLPFALKLFPNLLPSTYES-SKKRENKLENLRN---TRKLMSEIIKNN--KSHFKPNNISEEQKALFNRFYTHVRATGVPESRQQLIEVARLFTDDTVLDNVTRPYLIALAKYMNLQPFGTDVMLRYRIRYKMLELKKDDLSIYYEDAEQLSLSELKTACASRGIRSVDVEPSVLYSNLRLWLNMRLKDKIPSTLLIMATAYNYGNVQSKESLYDALCDVLIGIPDELYHEVKVNVVKEDEASAKQKL---KQLREQEEIMKEEEQQEENAIVSVKDELSLDDQDKNIDAAAPDVKPHDTKPIGEAAAI 451          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Nematostella
Match: EDO43248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB3])

HSP 1 Score: 268.47 bits (685), Expect = 9.169e-80
Identity = 157/331 (47.43%), Postives = 228/331 (68.88%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESA-TKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLS-----QWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAG--TEERVDPKTKLEVIK-EEQKV 1502
            LW +VK E VHYY+GFKL +F+  ++  +L ++  G +LTRRER+Q +RT ADM R+VPFLVF+++PFMEFLLP  +K FP MLPSTF+ +SK +E   ++LKGK+E+AKFLQ+ + E A T K  K  G  + +F++F  + R  G     +DIL+FS LFEDE+TL++++   LKA+  LL + + G    LRFQL+MK+RQL+ DD MI  EG+D + V ELQ   + RGMR+ GV E RLR+ L+     QWL L L+++VP +LLL+SR +YLPET++  ++LK+ +  LP  +    ++K    + E VD K +LE+++ EEQK+
Sbjct:    8 LWEKVKHEAVHYYNGFKLLYFETRISLRLLWQVMNGKSLTRRERRQFLRTVADMFRLVPFLVFLVIPFMEFLLPVAVKLFPNMLPSTFEDKSKKEEARRKELKGKIELAKFLQDTVEEMAVTAKQKKNQGA-VVSFANFFDKIRTRGEQPSNEDILKFSKLFEDEITLDNMSRGQLKAINGLLLLPSYGTNNYLRFQLQMKLRQLRTDDLMIKKEGVDSLNVQELQSACQARGMRAIGVPEARLRFFLTLVFILQWLELHLDEEVPISLLLMSRALYLPETVSNVDKLKETLSKLPNNLVGETEVKLAELSGELVDNKLRLEILRLEEQKI 337          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Nematostella
Match: EDO28252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T702])

HSP 1 Score: 135.191 bits (339), Expect = 1.199e-36
Identity = 71/148 (47.97%), Postives = 103/148 (69.59%), Query Frame = 3
Query:  987 TQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLS-----QWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTV 1415
             +DIL+FS LFEDE+TL++++   LKA+  LL + + G    LRFQL+MK+RQL+ DD MI  EG+D + V ELQ   + RGMR+ GV E RLR+ L+     QWL L L+++VP +LLL+SR +YLPET++  ++LK+ +  LP  +
Sbjct:    6 NEDILKFSKLFEDEITLDNMSRGQLKAINGLLLLPSYGTNNYLRFQLQMKLRQLRTDDLMIKKEGVDSLNVQELQSACQARGMRAIGVPEARLRFFLTLVFILQWLELHLDEEVPISLLLMSRALYLPETVSNVDKLKETLSKLPNNL 153          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:101165019])

HSP 1 Score: 320.857 bits (821), Expect = 1.502e-96
Identity = 228/620 (36.77%), Postives = 362/620 (58.39%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXX-----------XIVLADEVLKESEDKAPIIELKSVESP----DTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAK---------TLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIK-----KERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKE 2309
            RV DE+ HYYHGFKL + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I++FS LFEDE+TL++L    L ALC+LL++ +IG    LRFQL MK+R ++ DD++IA EG+  + V E+Q   R RGMR+ GV E RLR QL QWL L L +++PT+LLLLSR MYLP+TL+P +QLK  +  LP+ V+  A+LK    E  +VD KTKLE + +E+  I ++ +  +  + A           E+ LA    + SE +   ++           DTAP+ + L +     +  ++ QD+E           I  +++  +  A + L+E K             K+++    E  +EI K  S S +   ++  E K+ K LS ++  MI  I+K +  +          E DK      V+    +DS  +P +      +E  I++ +++  ++ ++   + EK + I   LD++KDGK+++D ++K+++L++  ++ + +S++A ++ ++ KE
Sbjct:  166 RVVDEIWHYYHGFKLLWIDTTIAGRMLWRILNGHPLSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKAAKGNVTE--EFSTFFQKIRDSGERPSNEQIIKFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVKSLNVNEVQAACRVRGMRALGVTEERLREQLGQWLELHLNQQIPTSLLLLSRAMYLPDTLSPADQLKTTLQTLPEMVTKEAQLKVAEMELSKVDNKTKLETMLQEEAAIRQDTKDREMERLADAAEKAAKEEGELELAASRARYSEAETASLKANGASHSETLRDTAPVVDGLKL-----QTYLRFQDEE-----------ITKEEIDLLSDACSKLKEQKRLLTLEKEELEDLKDDVQEYNEDLEEIKKEFSKSGQEKAIE--ESKASKRLSKRVTRMIGRIDKIITEL----------ENDK------VILDGQVDSGATPPVGLFYTFRENLISITELINVMRQIQNIPE-EKLLRIAEALDDNKDGKVDIDDVIKVVELIDKEDIDVSTSQVADIMVMLQKE 748          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:101165019])

HSP 1 Score: 319.701 bits (818), Expect = 5.650e-96
Identity = 225/615 (36.59%), Postives = 360/615 (58.54%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXX-----------XIVLADEVLKESEDKAPIIELKSVESP----DTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAK---------TLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKE 2309
            RV DE+ HYYHGFKL + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I++FS LFEDE+TL++L    L ALC+LL++ +IG    LRFQL MK+R ++ DD++IA EG+  + V E+Q   R RGMR+ GV E RLR QL QWL L L +++PT+LLLLSR MYLP+TL+P +QLK  +  LP+ V+  A+LK    E  +VD KTKLE + +E+  I ++ +  +  + A           E+ LA    + SE +   ++           DTAP+ + L +     +  ++ QD+E           I  +++  +  A + L+E K             K+++    E  +EI K  S S +   ++  E K+ K LS ++  MI  I+K +  +E +    D   +        +   K  D++      +E  I++ +++  ++ ++   + EK + I   LD++KDGK+++D ++K+++L++  ++ + +S++A ++ ++ KE
Sbjct:  166 RVVDEIWHYYHGFKLLWIDTTIAGRMLWRILNGHPLSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKAAKGNVTE--EFSTFFQKIRDSGERPSNEQIIKFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVKSLNVNEVQAACRVRGMRALGVTEERLREQLGQWLELHLNQQIPTSLLLLSRAMYLPDTLSPADQLKTTLQTLPEMVTKEAQLKVAEMELSKVDNKTKLETMLQEEAAIRQDTKDREMERLADAAEKAAKEEGELELAASRARYSEAETASLKANGASHSETLRDTAPVVDGLKL-----QTYLRFQDEE-----------ITKEEIDLLSDACSKLKEQKRLLTLEKEELEDLKDDVQEYNEDLEEIKKEFSKSGQEKAIE--ESKASKRLSKRVTRMIGRIDKIITELENDKVILDGQVDSGATPPVGLFLTKYSDATSLFYTFRENLISITELINVMRQIQNIPE-EKLLRIAEALDDNKDGKVDIDDVIKVVELIDKEDIDVSTSQVADIMVMLQKE 759          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:101165019])

HSP 1 Score: 319.316 bits (817), Expect = 7.598e-96
Identity = 222/601 (36.94%), Postives = 361/601 (60.07%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATK-KTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEE--RVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKP-IPVVTEQVIGAQDLAQIESAIANLEEAK---------TLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKE 2309
            RV DE+ HYYHGFKL + D  +A  +L R+  GH L+RRER+Q +RT AD+ R++PFLVFIIVPFMEFLLP  LK FP MLPSTF+T+SK +E + ++L+ KLE+AKFLQ+ I E A + K  KG+  +   FS F ++ R+SG     + I++FS LFEDE+TL++L    L ALC+LL++ +IG    LRFQL MK+R ++ DD++IA EG+  + V E+Q   R RGMR+ GV E RLR QL QWL L L +++PT+LLLLSR MYLP+TL+P +QLK  +  LP+ V+  A+LK    E  +VD KTKLE + +E+  I ++ +  +  +     LAD   K ++++   +EL    +   A  SE  T   +++     +  ++  P +  + ++ I  +++  +  A + L+E K             K+++    E  +EI K  S S +   ++  E K+ K LS ++  MI  I+K +  +E +    D   +        +   K  D++      +E  I++ +++  ++ ++   + EK + I   LD++KDGK+++D ++K+++L++  ++ + +S++A ++ ++ KE
Sbjct:  166 RVVDEIWHYYHGFKLLWIDTTIAGRMLWRILNGHPLSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNKAAKGNVTE--EFSTFFQKIRDSGERPSNEQIIKFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVKSLNVNEVQAACRVRGMRALGVTEERLREQLGQWLELHLNQQIPTSLLLLSRAMYLPDTLSPADQLKTTLQTLPEMVTKEAQLKVAEMELSKVDNKTKLETMLQEEAAIRQDTKDREMER-----LADAAEKAAKEEG-ELEL----AASRARYSEAETASLKANGASHSETLRDTAPVVDGLKDEEITKEEIDLLSDACSKLKEQKRLLTLEKEELEDLKDDVQEYNEDLEEIKKEFSKSGQEKAIE--ESKASKRLSKRVTRMIGRIDKIITELENDKVILDGQVDSGATPPVGLFLTKYSDATSLFYTFRENLISITELINVMRQIQNIPE-EKLLRIAEALDDNKDGKVDIDDVIKVVELIDKEDIDVSTSQVADIMVMLQKE 751          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: letm2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:NCBI gene;Acc:101174432])

HSP 1 Score: 201.445 bits (511), Expect = 7.391e-56
Identity = 150/273 (54.95%), Postives = 193/273 (70.70%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTT-FSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            L+ RV DEL HYY+GF+L   D+ +A  ++ RL  G  LTRRER++L+RT AD+ R+VPF+VFIIVPFMEFLLP +LK FP MLPSTF+TESK +E   + L  KLE+AKFLQE I+E A +   K    D T  FS ++++ R +G    T+DI+RFS LFEDE+TLE L    L ALCKLL++  IG   LLRFQL MK+R ++ DD+MI+ EG+  + V ELQ   R RGMRS G+  ++LR QL QWL L L++ VP +LLLLSR MYL
Sbjct:  145 LYQRVVDELKHYYNGFRLLGIDIKIAGRMVWRLLHGQLLTRRERRRLLRTCADLFRLVPFIVFIIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKQKKGLAAKLELAKFLQETISEMALRNRAKAQTEDETQRFSKYVQEVRGTGEQPTTKDIVRFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMKLRGIRSDDEMISAEGVAALSVSELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYL 417          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: letm2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:NCBI gene;Acc:101174432])

HSP 1 Score: 202.216 bits (513), Expect = 8.229e-56
Identity = 150/273 (54.95%), Postives = 193/273 (70.70%), Query Frame = 3
Query:  537 LWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTT-FSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYL 1352
            L+ RV DEL HYY+GF+L   D+ +A  ++ RL  G  LTRRER++L+RT AD+ R+VPF+VFIIVPFMEFLLP +LK FP MLPSTF+TESK +E   + L  KLE+AKFLQE I+E A +   K    D T  FS ++++ R +G    T+DI+RFS LFEDE+TLE L    L ALCKLL++  IG   LLRFQL MK+R ++ DD+MI+ EG+  + V ELQ   R RGMRS G+  ++LR QL QWL L L++ VP +LLLLSR MYL
Sbjct:  145 LYQRVVDELKHYYNGFRLLGIDIKIAGRMVWRLLHGQLLTRRERRRLLRTCADLFRLVPFIVFIIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKQKKGLAAKLELAKFLQETISEMALRNRAKAQTEDETQRFSKYVQEVRGTGEQPTTKDIVRFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMKLRGIRSDDEMISAEGVAALSVSELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYL 417          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000064220.1 (SMESG000064220.1)

HSP 1 Score: 1315.83 bits (3404), Expect = 0.000e+0
Identity = 708/711 (99.58%), Postives = 710/711 (99.86%), Query Frame = 3
Query:  225 MNLKYIIRNAGFSAVLFSPSRKIVNNKNHLFAKKFLFGHIHFGFFENNRYLHTTVFIRCLNDKKESIEKPLGEKMLTSNEDTKGVELXXXXXXXXXXXXXXXXPLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKEAIIAETKKDPTPNENQ 2357
            MNLKYIIRNAGFSA+LFSPSRKIVNNKNHLFAKKFLFGHIHFGFFENNRYLHTTVFIRCLNDKKESIEKPLGEKMLTSNEDTKGVELKSSSS+TSISKEKVKKPLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEFLLPFYLKFFPFMLPSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEERVDPKTKLEVIKEEQKVIHEEREASKASKEAEIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYI VNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKEAIIAETKKDPTPNENQ
Sbjct:    1 MNLKYIIRNAGFSAILFSPSRKIVNNKNHLFAKKFLFGHIHFGFFENNRYLHTTVFIRCLNDKKESIEKPLGEKMLTSNEDTKGVELKSSSSSTSISKEKVKKPLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEFLLPFYLKFFPFMLPSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKAGTEERVDPKTKLEVIKEEQKVIHEEREASKASKEAEIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYIKVNDVLESIKSLEKTGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKEAIIAETKKDPTPNENQ 711          
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000055346.1 (SMESG000055346.1)

HSP 1 Score: 441.425 bits (1134), Expect = 3.091e-143
Identity = 272/591 (46.02%), Postives = 387/591 (65.48%), Query Frame = 3
Query:  546 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEXXXXXXXXXXXXXXXSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAES-ATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKA-GTEERVDPKTKLEVIKEEQKVIHXXXXXXXXXXXXXIVLADEVLKESED--KAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEK-TGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVID 2303
            ++K+E VHYYHGF+LF+ ++G+  GIL RL+ G TLTRRERKQLVRT AD+ R+ PF+VFI VPF+E LLP Y++FFPFM+PSTF+  SKD E   Q LK KLE+AKFLQ+ + E+ +  K      V L +F+ FMKQ RESG T +T DIL+FS LFEDEVTLESL+ + LKALCKLL+I ++GP A L F L +KV  LK+DD+MIA EGIDK+P +ELQQ+ RERGMR+ GV+E RLR+QLSQWL LS+EK+VP +LLLLSR MYLP+ L+PE+QL +AIL LP+ VS  A L++  T+ + D KTK E++ EEQK+I +E+             ADE  KES+   K  +I        DTA I     V  E DK      D + K    ++E+ I   DL QIE+AI ++    T + +EE+  LKE   E+   + T           +K    L+ KL+ MI+E++  ++ ++V+          ++ +I ++   ++ +++      +ER + ++D++ ++K L+  +GD EKW  IL++LDEDKDG IE+ H+ +++ +L S EVKL S ++ +L++ ID
Sbjct:  145 KIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQ-------------ADE--KESQRIVKETLI--------DTAAI-----VAVEKDK----PLDVDSKR-SAISEESISTSDLNQIENAIESISNNNTAWQEEELDELKEQAAELHDQVET-----------KKGSNRLNKKLNNMIEEMDSLLDRLKVK----------QENIIHDIKVGQTSETA------EERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLIDAID 675          
The following BLAST results are available for this feature:
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LETM11.879e-8838.27leucine zipper and EF-hand containing transmembran... [more]
LETM29.627e-5651.48leucine zipper and EF-hand containing transmembran... [more]
LETM22.668e-5551.48leucine zipper and EF-hand containing transmembran... [more]
LETM21.148e-4239.26leucine zipper and EF-hand containing transmembran... [more]
LETM25.127e-4239.26leucine zipper and EF-hand containing transmembran... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
letm-14.793e-7736.48LETM1 (Leucine zipper, EF-hand, TransMembrane mito... [more]
letm-16.360e-7736.48LETM1 (Leucine zipper, EF-hand, TransMembrane mito... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Letm14.891e-7547.10gene:FBgn0284252 transcript:FBtr0072349[more]
Letm14.891e-7547.10gene:FBgn0284252 transcript:FBtr0072348[more]
Letm14.891e-7547.10gene:FBgn0284252 transcript:FBtr0072347[more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
letm11.322e-9938.63leucine zipper-EF-hand containing transmembrane pr... [more]
letm13.267e-9938.31leucine zipper-EF-hand containing transmembrane pr... [more]
letm12.855e-9837.99leucine zipper-EF-hand containing transmembrane pr... [more]
letm26.854e-5750.31leucine zipper-EF-hand containing transmembrane pr... [more]
letm23.695e-4239.69leucine zipper-EF-hand containing transmembrane pr... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anapc11.646e-9538.59anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc14.339e-9538.23anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc16.087e-9539.03anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc11.951e-9338.50anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc11.055e-9238.23anaphase promoting complex subunit 1 [Source:Xenba... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Letm13.382e-8737.25leucine zipper-EF-hand containing transmembrane pr... [more]
Letm23.786e-5550.74leucine zipper-EF-hand containing transmembrane pr... [more]
Letm22.105e-1650.32leucine zipper-EF-hand containing transmembrane pr... [more]
Letm22.071e-1157.73leucine zipper-EF-hand containing transmembrane pr... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZK33|LETM1_CHICK2.057e-10139.13Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q0VCA3|LETM1_BOVIN2.607e-10037.83Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q1LY46|LETM1_DANRE9.982e-9938.63Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q0VA06|LETM1_XENTR1.399e-9438.92Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|O95202|LETM1_HUMAN9.025e-8838.27Mitochondrial proton/calcium exchanger protein OS=... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LGI34.740e-12139.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LFQ15.790e-11939.59Uncharacterized protein OS=Opisthorchis felineus O... [more]
C1LG653.021e-11839.25Leucine zipper-EF-hand-containing transmembrane pr... [more]
A0A4Z2DSX92.416e-11739.39Mitochondrial proton/calcium exchanger protein iso... [more]
A0A095AGV85.589e-11740.58LETM1 and EF-hand domain-containing protein 1, mit... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
letm12.568e-9437.77leucine zipper and EF-hand containing transmembran... [more]
letm17.099e-9437.21leucine zipper and EF-hand containing transmembran... [more]
letm24.462e-5756.30leucine zipper and EF-hand containing transmembran... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000480.11.090e-2062.37pep scaffold:Pmarinus_7.0:GL485460:9771:10305:1 ge... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MDM381.149e-3435.74Mitochondrial protein; forms a complex with Mba1p ... [more]
YLH471.408e-3429.40Mitochondrial inner membrane protein; exposed to t... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO432489.169e-8047.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282521.199e-3647.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
letm11.502e-9636.77leucine zipper and EF-hand containing transmembran... [more]
letm15.650e-9636.59leucine zipper and EF-hand containing transmembran... [more]
letm17.598e-9636.94leucine zipper and EF-hand containing transmembran... [more]
letm27.391e-5654.95leucine zipper and EF-hand containing transmembran... [more]
letm28.229e-5654.95leucine zipper and EF-hand containing transmembran... [more]
back to top
BLAST of LETM1 and EF-hand domain-containing protein 1, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064220.10.000e+099.58SMESG000064220.1[more]
SMESG000055346.13.091e-14346.02SMESG000055346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033722 ID=SMED30033722|Name=LETM1 and EF-hand domain-containing protein 1, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2713bp
TTATCAATGTCCGTATAAATAATGCAAATAGTTAAATTTTTGTTAAATTT
GTTCGAACTTAAGTAACTCAAAAATTTAGAGTTGCTTAATATAAAGTTTC
GTAAATGCCTATTTATTACTAATTTAATTTTAAATCACATAGAAATTTTC
TGCTTCTAAAAGTTTTTCTTCAAAAAATAAACATTATTTTTCAGATTACT
TATTTATTTTTAAGAATTTCTAAAATGAATTTAAAGTACATAATCAGAAA
TGCTGGATTCTCGGCTGTATTATTTTCACCATCTCGAAAAATTGTAAATA
ATAAAAATCATTTATTCGCAAAGAAATTTTTATTTGGACATATCCATTTC
GGATTTTTTGAAAACAATCGATATTTACATACTACTGTGTTTATTAGATG
TTTAAATGACAAAAAAGAAAGCATTGAGAAACCATTGGGTGAAAAGATGT
TGACATCAAATGAAGACACCAAAGGTGTTGAATTAAAATCATCGTCTTCT
ACAACCAGTATTTCAAAAGAAAAGGTTAAGAAACCTTTATGGATTAGAGT
TAAAGATGAATTAGTGCATTACTATCATGGTTTTAAATTATTTTTCTTTG
ATCTTGGAGTTGCTTGTGGAATTTTAAAAAGACTTACCAAGGGACATACT
CTAACAAGACGGGAAAGGAAACAGTTAGTTAGAACATCAGCTGATATGGC
CAGGATGGTTCCATTTTTAGTATTCATTATTGTACCGTTCATGGAGTTCC
TCTTACCATTTTATTTGAAATTTTTTCCGTTTATGTTACCCAGTACTTTC
AAAACCGAATCTAAAGACAAAGAATTCATACTTCAAAAACTGAAAGGAAA
ACTAGAAATCGCGAAATTCTTACAAGAAGCCATTGCTGAAAGTGCGACGA
AAAAGACAATTAAAGGGGATGGCGTAGATTTGACTACATTCAGTGATTTT
ATGAAACAGGCTAGAGAATCGGGTCTTACTGTTGACACGCAAGATATTTT
GCGATTTTCACATTTGTTTGAAGATGAAGTCACCTTAGAGTCGTTAAATC
CAAAATATTTGAAAGCCCTTTGTAAACTTTTGGATATTAATACTATTGGA
CCACCTGCATTATTGAGATTTCAATTGGAAATGAAAGTACGACAATTAAA
AGTTGATGATCAGATGATTGCAAATGAAGGTATTGATAAAATTCCTGTAT
GGGAATTACAACAATTATCTCGAGAAAGAGGAATGAGATCTTATGGTGTT
AATGAAAATCGTTTACGATATCAGCTATCTCAGTGGCTTAGTCTAAGTCT
GGAAAAAAAGGTTCCTACAACACTTCTATTATTATCAAGGGTAATGTATT
TACCAGAAACTCTGACTCCAGAGGAACAGCTGAAACAAGCCATTCTTGTG
TTGCCTAAGACAGTTTCAAATACAGCGAAACTTAAAGCTGGCACTGAAGA
ACGAGTTGATCCTAAAACTAAATTAGAAGTTATCAAAGAAGAGCAAAAAG
TTATCCACGAAGAAAGGGAAGCCAGTAAAGCATCGAAAGAAGCTGAAATT
GTTTTGGCAGATGAAGTTTTAAAGGAATCTGAAGATAAAGCTCCAATAAT
AGAACTAAAATCAGTTGAAAGCCCTGATACTGCCCCAATTTCCGAAATTC
TCACAGTAGTTAAAGAATCCGATAAAGTCGAAATTCAAAAACAAGATAAA
GAACCTAAACCTATCCCTGTTGTAACGGAACAAGTGATAGGTGCTCAAGA
TCTTGCTCAAATCGAATCAGCTATTGCTAATCTTGAAGAGGCCAAAACCT
TATTCCATAAAGAAGAAATTGGTGTTTTGAAAGAAAGCAGAAAAGAAATT
TCTAAAATTTTAAGCACATCTGATGAAACTGCACCAGTAAAACAACCAGA
GGAAAAATCTGTTAAGAATTTATCCAGTAAACTTGATGAGATGATTGATG
AAATTGAAAAAACTGTGGAACACATTGAAGTGGAAGCTAAAAAAGCTGAT
CCCAGCGAAGAGGACAAAAAGCCAGTGATAGAAGAAGTTATGGCAGTGAA
ATCAATTGATAGTAGTCCATCTCCGGTTATCAAAAAAGAACGTTACATAA
ATGTAAATGATGTTCTGGAAAGTATTAAGAGTCTTGAGAAAACTGGTGAT
CATGAGAAATGGGTGACAATTCTGTCTTTATTGGATGAAGATAAAGATGG
GAAAATAGAAATGGACCATTTGGTGAAAATGATCAAATTGTTGAATTCGA
TTGAAGTTAAGCTGCCTTCCTCAGAAATCGCTAAACTTCTGGAGGTTATT
GATAAAGAAGCAATAATTGCTGAGACGAAAAAAGATCCAACACCTAATGA
GAATCAATAAAAGTTTTAGGAATGATTTTGTGTAGCATCGTAATTTATTT
GAATAAACTTAGAATTAATTACTATGAATACAATTTATACAAATTGATGT
TTTCAGTTGGTACTTTTGGTAACGCCTGCAAATGAGTTGTTGAGATTTCC
TTTCCCTCTATCCGAGTATGGCATTTGTTTTGGCAAAAATTATATTGATT
GAATTTGACATGAAAAGAAATCAGTGGTGAAAATTAAAATAAGTTCTTAA
TATTAAAATTAATATTGATCGCATTTCATAAATACATTCCAAATTTGCTA
GGTTATTAAATAGCTTCGGTGAGCAATGGAATATATTCTGAATCTACTTG
GCCTTTGTGAAAT
back to top

protein sequence of SMED30033722-orf-1

>SMED30033722-orf-1 ID=SMED30033722-orf-1|Name=SMED30033722-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=712bp
MNLKYIIRNAGFSAVLFSPSRKIVNNKNHLFAKKFLFGHIHFGFFENNRY
LHTTVFIRCLNDKKESIEKPLGEKMLTSNEDTKGVELKSSSSTTSISKEK
VKKPLWIRVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQ
LVRTSADMARMVPFLVFIIVPFMEFLLPFYLKFFPFMLPSTFKTESKDKE
FILQKLKGKLEIAKFLQEAIAESATKKTIKGDGVDLTTFSDFMKQARESG
LTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQ
LEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQ
LSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNT
AKLKAGTEERVDPKTKLEVIKEEQKVIHEEREASKASKEAEIVLADEVLK
ESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVV
TEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSD
ETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKP
VIEEVMAVKSIDSSPSPVIKKERYINVNDVLESIKSLEKTGDHEKWVTIL
SLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVIDKEAIIAE
TKKDPTPNENQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR011685LETM1
IPR033122LETM1_RBD
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0043022ribosome binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006875cellular metal ion homeostasis
GO:0042407cristae formation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 510..530
NoneNo IPR availableCOILSCoilCoilcoord: 563..587
NoneNo IPR availablePANTHERPTHR14009:SF1MITOCHONDRIAL PROTON/CALCIUM EXCHANGER PROTEINcoord: 86..584
NoneNo IPR availablePANTHERPTHR14009LEUCINE ZIPPER-EF-HAND CONTAINING TRANSMEMBRANE PROTEINcoord: 86..584
NoneNo IPR availableTMHMMTMhelixcoord: 162..184
IPR011685LETM1-likePFAMPF07766LETM1coord: 106..371
e-value: 6.0E-92
score: 307.8
IPR033122Letm1 ribosome-binding domainPROSITEPS51758LETM1_RBDcoord: 204..423
score: 23.621
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 641..676
score: 10.05
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 623..694