Guanine nucleotide-binding protein G(Q) subunit alpha

Overview
NameGuanine nucleotide-binding protein G(Q) subunit alpha
Smed IDSMED30033719
Length (bp)1767
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein G(Q) subunit alpha (SMED30033719) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(Q) subunit alpha (SMED30033719) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein G(Q) subunit alpha (SMED30033719) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(Q) subunit alpha (SMED30033719) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033719

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30033719SMESG000081983.1 SMESG000023274.1 dd_Smed_v4_5082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033719SMESG000081983.1 SMESG000023274.1 dd_Smed_v4_5082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30033719SMESG000023332.1 SMESG000023274.1 Contig36178newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033719SMESG000023332.1 SMESG000023274.1 Contig36178uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Human
Match: GNAQ (G protein subunit alpha q [Source:HGNC Symbol;Acc:HGNC:4390])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 283/351 (80.63%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   +IRAM+ LKIPY+   N  +A+ +R++D E V+ FE  ++ A +SLWND G++ECYDRRREYQL+DS KYYL+DLDR+  P YLPT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Human
Match: GNA11 (G protein subunit alpha 11 [Source:HGNC Symbol;Acc:HGNC:4379])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 283/351 (80.63%), Postives = 314/351 (89.46%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC S+E KE  RIN EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG GYS++DKR F KL+YQNI+ A   +IRAME LKI Y+   N   A  +R++D E VTTFE  ++ A ++LW D G++ECYDRRREYQL+DSAKYYL D+DRI T  YLPT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLE+KI YSHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Human
Match: GNA14 (G protein subunit alpha 14 [Source:HGNC Symbol;Acc:HGNC:4382])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 256/350 (73.14%), Postives = 300/350 (85.71%), Query Frame = 2
Query:  116 ACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
             CC S E KE  RI+ EIE+QL+RDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+D++ F KL+YQNI+ A   +IRAM+ L+I Y    N E A+ +R+++ + V+      + A + LW D G++ECYDRRREYQL+DSAKYYL D+DRI TP ++PT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFESVTSI+FLVALSEYDQVL E DNENRMEESKALF+TIITYPWF +SSVILFLNKKDLLEEKI YSHL+ YFP++ GP++D  AARDFILK++ D NPD EK+IYSHFTCATDT+NIRFVFAAVKDTILQLNL+E+N
Sbjct:    4 CCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFN 353          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Human
Match: GNA11 (G protein subunit alpha 11 [Source:HGNC Symbol;Acc:HGNC:4379])

HSP 1 Score: 387.497 bits (994), Expect = 2.567e-132
Identity = 185/205 (90.24%), Postives = 198/205 (96.59%), Query Frame = 2
Query:  551 LTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            L+DSAKYYL D+DRI T  YLPT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLE+KI YSHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    2 LSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 206          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Human
Match: GNA15 (G protein subunit alpha 15 [Source:HGNC Symbol;Acc:HGNC:4383])

HSP 1 Score: 392.119 bits (1006), Expect = 5.026e-132
Identity = 190/360 (52.78%), Postives = 255/360 (70.83%), Query Frame = 2
Query:  122 CNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDL------NPDPEKI------IYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            C +E+ K  +R+++EI + L   KK  R ELKLLLLG GESGKSTFIKQMRIIHG GYS+++++ F  L+YQNI+++   +I AME L+IP+  P++  +A  +   D   VTTFE  +  A + LW D+G++ CY+RRRE+ L DSA YYL  L+RI    Y+PT QD+LR R+PTTGI EY F +     R+VDVGGQ+SER+KWIHCFE+V ++++L +LSEYDQ L E++ ENRM+ES ALF TI+  PWF+ +SVILFLNK D+LEEKI  SHL  YFP F+GP++DAEAA+ FIL M+  +       P+  K       ++SH+TCATDT+NIR VF  V+D++L   L E N
Sbjct:   13 CLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEIN 372          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Celegans
Match: egl-30 (EGL-30; Heterotrimeric G protein alpha subunit [Source:UniProtKB/TrEMBL;Acc:G5EGU1])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 274/353 (77.62%), Postives = 311/353 (88.10%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDN--LEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE +EQ RIN+EIEKQL+RDK++ARRELKLLLLGTGESGKSTFIKQMRIIHG GYS++DKR+ I+L+YQN+++A  ++IRAM+ L I + N      E A  +R++D+E+VT+FE  ++   + LW DSG++ECYDRRREYQLTDSAKYYL DL R+  PDYLPT QDILRVRVPTTGIIEYPFDL+ IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVE DNENRMEESKALFRTIITYPWF +SSVILFLNKKDLLEEKI YSHL DYFP+++GP RD  AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYN 353          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Celegans
Match: egl-30 (EGL-30; Heterotrimeric G protein alpha subunit [Source:UniProtKB/TrEMBL;Acc:G5EGU1])

HSP 1 Score: 483.026 bits (1242), Expect = 2.899e-169
Identity = 230/301 (76.41%), Postives = 262/301 (87.04%), Query Frame = 2
Query:  269 MRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDN--LEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MRIIHG GYS++DKR+ I+L+YQN+++A  ++IRAM+ L I + N      E A  +R++D+E+VT+FE  ++   + LW DSG++ECYDRRREYQLTDSAKYYL DL R+  PDYLPT QDILRVRVPTTGIIEYPFDL+ IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVE DNENRMEESKALFRTIITYPWF +SSVILFLNKKDLLEEKI YSHL DYFP+++GP RD  AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYN 301          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 330.102 bits (845), Expect = 1.301e-108
Identity = 169/350 (48.29%), Postives = 224/350 (64.00%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDI--DYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
            M C  S+E +     ++ IEK LK D   A +++KLLLLG GESGKST +KQM+IIH +G++ +D + +  ++Y N   +   ++RAM  L + + + D    AK + D+    E    F    + + + LW D+GV++C+ R  EYQL DSAKY+LDDL+R+    Y PT QDILR RV TTGI+E  F   ++ F++ DVGGQRSER+KWIHCFE VT+I+F VA+SEYDQVL E +  NRM ES  LF +I    WF D+S+ILFLNKKDL EEKI+ S L   FP++ G Q D   A  +I   F   N    K IY H TCATDT NI+FVF AV D I+  NL+
Sbjct:    1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQ-DYHEASAYIQAQFEAKNKSANKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLR 349          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Celegans
Match: gpa-16 (Guanine nucleotide-binding protein alpha-16 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V6])

HSP 1 Score: 329.331 bits (843), Expect = 3.828e-108
Identity = 175/356 (49.16%), Postives = 234/356 (65.73%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFE---PSHIVA-TRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLN----PDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
            M C  S+E +   R +K+I++ LK D +++ R +KLLLLG GESGKST +KQMRIIH  GY+ ++++ F  ++Y NI L+   +I AME LKI +     L++  D R +   + T  E   P  +V   +S+W+DSG+++  +R REYQL DSA YYL  LDRI  P+Y+PT  DILR R+ TTGI+E  F     +F + DVGGQRSER+KWIHCFE VT+++F VALSEYD VLVE    NRM ES  LF +I    WF ++S+ILFLNKKDL EEKI  S L   FP++ G   + E A  +I + F D+N     +  + IY+ FTCATDT NIRFVF AV D I++ NL+
Sbjct:    1 MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTT---LDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGAN-NYEEASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLR 352          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Celegans
Match: gpa-7 (Guanine nucleotide-binding protein alpha-7 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q21917])

HSP 1 Score: 324.709 bits (831), Expect = 1.642e-106
Identity = 162/348 (46.55%), Postives = 225/348 (64.66%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
            M  C S++ KE  R+N+ I++Q+K+D+  + R +KLLLLG GESGKST +KQMRI+H  G+S  D      ++Y N   +  +++RAM  L+I Y  PD +  ++ +    +            A + LW+D GV+ECY R  EYQ+ DSAKY+LD+L R+ +P+Y+P+ QD+LR R+ TTGI E  F+L  + FR++DVGGQRSER+KWIHCF++V +I+F+ +LSEYDQ L E +  NRM+ES  LF +I   PWF D   ILFLNKKDL  EKI  S L   FP+++G Q   E   ++I   F  LN   ++ IY H TCATDT N++FV  A  D I+  NLK
Sbjct:    1 MGHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHSMLSILRAMFHLQIEYGEPDRVRDSQLVFATVHANKEELTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPRLSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTNRMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECI-NYIQWKFEQLNRSSQREIYCHHTCATDTNNVQFVLDACLDMIIAKNLK 347          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087833)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE KEQ RIN+EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR +IKL++QNI++A  ++I+AM++LKI Y   ++ E A  +  IDYETVTTFE  ++ A ++LW+D+G++ECYDRRREYQLTDSAKYYL DLDR+  P YLPT QDILRVRVPTTGIIEYPFDL+ I FRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQ+L ESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA  AR+FIL+MFVDLNPD EKIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087830)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE KEQ RIN+EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR +IKL++QNI++A  ++I+AM++LKI Y   ++ E A  +  IDYETVTTFE  ++ A ++LW+D+G++ECYDRRREYQLTDSAKYYL DLDR+  P YLPT QDILRVRVPTTGIIEYPFDL+ I FRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQ+L ESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA  AR+FIL+MFVDLNPD EKIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087829)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE KEQ RIN+EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR +IKL++QNI++A  ++I+AM++LKI Y   ++ E A  +  IDYETVTTFE  ++ A ++LW+D+G++ECYDRRREYQLTDSAKYYL DLDR+  P YLPT QDILRVRVPTTGIIEYPFDL+ I FRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQ+L ESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA  AR+FIL+MFVDLNPD EKIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0304955)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE KEQ RIN+EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR +IKL++QNI++A  ++I+AM++LKI Y   ++ E A  +  IDYETVTTFE  ++ A ++LW+D+G++ECYDRRREYQLTDSAKYYL DLDR+  P YLPT QDILRVRVPTTGIIEYPFDL+ I FRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQ+L ESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA  AR+FIL+MFVDLNPD EKIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087831)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE KEQ RIN+EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR +IKL++QNI++A  ++I+AM++LKI Y   ++ E A  +  IDYETVTTFE  ++ A ++LW+D+G++ECYDRRREYQLTDSAKYYL DLDR+  P YLPT QDILRVRVPTTGIIEYPFDL+ I FRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQ+L ESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA  AR+FIL+MFVDLNPD EKIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Zebrafish
Match: gna11b (guanine nucleotide binding protein (G protein), alpha 11b (Gq class) [Source:ZFIN;Acc:ZDB-GENE-041121-9])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 277/351 (78.92%), Postives = 308/351 (87.75%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG GY+D+DKR F KL+YQNI+ +   +IRA E LKI Y+   N   A  ++++D E V +F+  +I A + LW+D G++E YDRRREYQL+DS KYYL DLDRI    YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYTDEDKRGFTKLVYQNIFTSMQAMIRATETLKIGYKYEQNKANAMLVKEVDIEKVMSFDHPYINAVKMLWSDPGIQEAYDRRREYQLSDSTKYYLSDLDRIAESSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Zebrafish
Match: gnaq (guanine nucleotide binding protein (G protein), q polypeptide [Source:ZFIN;Acc:ZDB-GENE-081104-25])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 273/351 (77.78%), Postives = 311/351 (88.60%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI++QL+RDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYS++D++ F KL+YQNI+ ++ ++IRAM+ L+I Y+   N   A  +R++D E V  F   ++ A +SLWND G++ECYDRRREYQL+DS KYYL+ LDRI  P Y+PT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI +SHLVDYFP+++GPQRDA+ AR+FILKMFVDLNPD EKIIYSHFTCATDTENIRFVFAAVKDTILQL LKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIDRQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDRKGFTKLVYQNIFTSSQSMIRAMDTLQILYKYEHNKANANIVREVDVEKVFLFVNPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNSLDRIANPSYIPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMFSHLVDYFPEYDGPQRDAQTAREFILKMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQLTLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Zebrafish
Match: gna11a (guanine nucleotide binding protein (G protein), alpha 11a (Gq class) [Source:ZFIN;Acc:ZDB-GENE-050208-597])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 275/351 (78.35%), Postives = 307/351 (87.46%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGY+D+DKR + KL+YQNI+ +   +IRA E LKIP+   DN + A  +R++D E V +FE  ++ A   LW D G++E YDRRREYQL+DS KYYL DL+RI  P YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI  SHLVDYFP+F+GPQ DA++AR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    7 MACCMSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGYTKLVYQNIFTSMQAMIRATEHLKIPFRFEDNKKNALLVREVDVEKVCSFEQPYVAAINKLWMDPGIQEAYDRRREYQLSDSTKYYLSDLERISDPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKILCSHLVDYFPEFDGPQNDAQSAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Zebrafish
Match: gna11a (guanine nucleotide binding protein (G protein), alpha 11a (Gq class) [Source:ZFIN;Acc:ZDB-GENE-050208-597])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 275/351 (78.35%), Postives = 307/351 (87.46%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGY+D+DKR + KL+YQNI+ +   +IRA E LKIP+   DN + A  +R++D E V +FE  ++ A   LW D G++E YDRRREYQL+DS KYYL DL+RI  P YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI  SHLVDYFP+F+GPQ DA++AR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    7 MACCMSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGYTKLVYQNIFTSMQAMIRATEHLKIPFRFEDNKKNALLVREVDVEKVCSFEQPYVAAINKLWMDPGIQEAYDRRREYQLSDSTKYYLSDLERISDPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKILCSHLVDYFPEFDGPQNDAQSAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Zebrafish
Match: gna11a (guanine nucleotide binding protein (G protein), alpha 11a (Gq class) [Source:ZFIN;Acc:ZDB-GENE-050208-597])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 273/351 (77.78%), Postives = 309/351 (88.03%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGY+D+DKR + KL+YQNI+ +   +IRA E LKIP+   DN + A  +R++D E V +FE  ++ A   LW D G++E YDRRREYQL+DS KYYL+DL+RI +  Y+PT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI  SHLVDYFP+F+GPQ DA++AR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    7 MACCMSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGYTKLVYQNIFTSMQAMIRATEHLKIPFRFEDNKKNALLVREVDVEKVCSFEQPYVAAINKLWMDPGIQEAYDRRREYQLSDSTKYYLNDLERISSRGYMPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKILCSHLVDYFPEFDGPQNDAQSAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Xenopus
Match: gna11 (guanine nucleotide binding protein (G protein), alpha 11 (Gq class) [Source:NCBI gene;Acc:394755])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 315/351 (89.74%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIEKQL+RDKKD+RRELKLLLLGTGESGKSTFIKQMRIIHG+GYS++DKR F KL++QNI+ A  ++IRAM+ LKIPY+   N   A+ +R++D E V TFE  ++ A ++LW+D G++ECYDRRREYQL+DSAKYYL D+DRI  P YLPT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLE+KI YSHLVDYFP+F+GPQRDA  AR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    7 MACCLSEEVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDKRGFTKLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVVREVDVEKVCTFEQPYVNAIKNLWSDPGIQECYDRRREYQLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKIMYSHLVDYFPEFDGPQRDAATAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Xenopus
Match: gnaq (guanine nucleotide binding protein (G protein), q polypeptide [Source:NCBI gene;Acc:733773])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 314/351 (89.46%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   +IRAM+ LKIPY+   N  +A  +R++D E V +FE  ++ A + LWND G++E YDRRREYQL+DS KYYL+DLDRI +  YLP+ QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    4 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKGHALLIREVDVEKVASFENPYVDAIKYLWNDPGIQEAYDRRREYQLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 354          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Xenopus
Match: gnaq (guanine nucleotide binding protein (G protein), q polypeptide [Source:NCBI gene;Acc:733773])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 280/351 (79.77%), Postives = 314/351 (89.46%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   +IRAM+ LKIPY+   N  +A  +R++D E V +FE  ++ A + LWND G++E YDRRREYQL+DS KYYL+DLDRI +  YLP+ QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKGHALLIREVDVEKVASFENPYVDAIKYLWNDPGIQEAYDRRREYQLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Xenopus
Match: adprh (ADP-ribosylarginine hydrolase [Source:Xenbase;Acc:XB-GENE-5783598])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 256/350 (73.14%), Postives = 306/350 (87.43%), Query Frame = 2
Query:  116 ACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
             CC + E KE  RIN EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GY+D+D++ F KL+YQNI+ +   +IRAM+ L+I Y +  N+E A  +R+++ + V++ E  H+ A + LW D G++ECYDRRREYQL+DS KYYL D+DRI  P ++PT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQVL E DNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLL+EKI YSHL+DYFP+F GP++D+++ARDFILK++ D NPD EK+IYSHFTCATDTENIRFVFAAVKDTILQLNL+E+N
Sbjct:    3 GCCLTAEEKESQRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDEDRKGFTKLVYQNIFTSMQAMIRAMDTLRIQYSSEQNMENALTVREVEVDKVSSLERKHVEAIKKLWEDEGIQECYDRRREYQLSDSTKYYLSDIDRISNPSFIPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLQEKIMYSHLIDYFPEFTGPKQDSQSARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFN 352          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Xenopus
Match: gnao1 (G protein subunit alpha o1 [Source:NCBI gene;Acc:549749])

HSP 1 Score: 342.428 bits (877), Expect = 5.247e-113
Identity = 177/350 (50.57%), Postives = 225/350 (64.29%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDI--DYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
            M C  S E +     +K+IEK LK D   A +++KLLLLG GESGKST +KQM+IIH  G+S +D + +  ++Y N   +   ++RAM+ L I Y + +    AK + D+    E    F P  + A   LW DSG++EC++R REYQL DSAKYYLD LDRI   DY PT QDILR RV TTGI+E  F   ++ FR+ DVGGQRSER+KWIHCFE VT+I+F VALS YDQVL E +  NRM ES  LF +I    WF D+S+ILFLNKKD+ +EKI+ S L   FP + GP    EA    I   +   N    K IY+H TCATDT+NI+FVF AV D I+  NL+
Sbjct:    1 MGCTLSAEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERRADAKMVCDVVSRMEDTEPFSPELLSAMMRLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFQEKIKSSPLTICFPDYTGPNSFTEAVA-HIQHQYESRNKSQTKEIYTHVTCATDTQNIQFVFDAVTDVIIANNLR 349          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Mouse
Match: Gnaq (guanine nucleotide binding protein, alpha q polypeptide [Source:MGI Symbol;Acc:MGI:95776])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 283/351 (80.63%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   +IRAM+ LKIPY+   N  +A+ +R++D E V+ FE  ++ A +SLWND G++ECYDRRREYQL+DS KYYL+DLDR+  P YLPT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Mouse
Match: Gna11 (guanine nucleotide binding protein, alpha 11 [Source:MGI Symbol;Acc:MGI:95766])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 281/351 (80.06%), Postives = 315/351 (89.74%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC S+E KE  RIN EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG GYS++DKR F KL+YQNI+ A   ++RAME LKI Y+   N   A  +R++D E VTTFE  ++ A ++LW+D GV+ECYDRRRE+QL+DSAKYYL D+DRI T  YLPT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLE+KI +SHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Mouse
Match: Gna14 (guanine nucleotide binding protein, alpha 14 [Source:MGI Symbol;Acc:MGI:95769])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 257/350 (73.43%), Postives = 300/350 (85.71%), Query Frame = 2
Query:  116 ACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
             CC S E KE  RI+ EIE+QL+RDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+D++ F KL+YQNI+ A   +IRAM+ L+I Y    N E A+ +R+++ + VT      + A + LW D G++ECYDRRREYQL+DSAKYYL D++RI  P ++PT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFESVTSI+FLVALSEYDQVL E DNENRMEESKALFRTIITYPWF +SSVILFLNKKDLLEEKI YSHL+ YFP++ GP++D +AARDFILK++ D NPD EK+IYSHFTCATDTENIRFVFAAVKDTILQLNL+E+N
Sbjct:    4 CCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVTALSRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIERIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFN 353          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Mouse
Match: Gna14 (guanine nucleotide binding protein, alpha 14 [Source:MGI Symbol;Acc:MGI:95769])

HSP 1 Score: 469.929 bits (1208), Expect = 7.158e-164
Identity = 216/299 (72.24%), Postives = 256/299 (85.62%), Query Frame = 2
Query:  269 MRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MRIIHG+GYSD+D++ F KL+YQNI+ A   +IRAM+ L+I Y    N E A+ +R+++ + VT      + A + LW D G++ECYDRRREYQL+DSAKYYL D++RI  P ++PT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFESVTSI+FLVALSEYDQVL E DNENRMEESKALFRTIITYPWF +SSVILFLNKKDLLEEKI YSHL+ YFP++ GP++D +AARDFILK++ D NPD EK+IYSHFTCATDTENIRFVFAAVKDTILQLNL+E+N
Sbjct:    1 MRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVTALSRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIERIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFN 299          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Mouse
Match: Gna15 (guanine nucleotide binding protein, alpha 15 [Source:MGI Symbol;Acc:MGI:95770])

HSP 1 Score: 384.03 bits (985), Expect = 5.771e-129
Identity = 196/360 (54.44%), Postives = 258/360 (71.67%), Query Frame = 2
Query:  122 CNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDL---NPDPE---------KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            C +EE K  +RI++EI + L   KK  R ELKLLLLG GESGKSTFIKQMRIIHG GYS++D+R+F  LIYQNI+++   +I AM+ L+IP+  PD+ ++A  +   D   V+TFE  + VA + LW D+G++ CY+RRRE+ L DSA YYL  L+RI    Y+PT QD+LR R+PTTGI EY F +     R+VDVGGQRSERRKWIHCFE+V ++++L +LSEYDQ L E+D ENRMEES ALF TI+  PWF+ +SVILFLNK D+LE+KI  SHL  YFP F+GP+RDAEAA+ FIL M+  +     +P+         +  ++HFTCATDT+++R VF  V+D++L   L E N
Sbjct:   13 CLTEEEKTAARIDQEINRILLEQKKQEREELKLLLLGPGESGKSTFIKQMRIIHGVGYSEEDRRAFRLLIYQNIFVSMQAMIDAMDRLQIPFSRPDSKQHASLVMTQDPYKVSTFEKPYAVAMQYLWRDAGIRACYERRREFHLLDSAVYYLSHLERISEDSYIPTAQDVLRSRMPTTGINEYCFSVKKTKLRIVDVGGQRSERRKWIHCFENVIALIYLASLSEYDQCLEENDQENRMEESLALFSTILELPWFKSTSVILFLNKTDILEDKIHTSHLATYFPSFQGPRRDAEAAKSFILDMYARVYASCAEPQDGGRKGSRARRFFAHFTCATDTQSVRSVFKDVRDSVLARYLDEIN 372          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. UniProt/SwissProt
Match: sp|O15975|GNAQ_MIZYE (Guanine nucleotide-binding protein G(q) subunit alpha OS=Mizuhopecten yessoensis OX=6573 GN=SCGQA PE=2 SV=1)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 285/351 (81.20%), Postives = 321/351 (91.45%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KEQ RIN EIEK+L++ K+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGYS++DKR FIK++YQNI++A +++IRAM+ +KI +E  DN E A  +R +DYETVTT +   + A  SLW D+G++ECYDRRREYQLTDSAKYYLD +DRI  P+YLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI +SHLVDYFP+F+G ++DA+ AR+FIL+MFVDLNPDP+KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MACCLSEEAKEQKRINCEIEKELRKAKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSEEDKRGFIKIVYQNIFMAMHSMIRAMDTIKISFEVADNEENAIMIRQVDYETVTTLDSQSVEAILSLWADAGIQECYDRRREYQLTDSAKYYLDAVDRIAEPNYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMHSHLVDYFPEFDGQKKDAQGAREFILRMFVDLNPDPDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. UniProt/SwissProt
Match: sp|P38411|GNAQ_LYMST (Guanine nucleotide-binding protein G(q) subunit alpha OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 288/351 (82.05%), Postives = 318/351 (90.60%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC  +E KEQ RIN+EIE+QLKRDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG GYSD+DKRS IK++YQNI++A + +IRAM+ L I Y NP N E    +R IDYETVTTF+   + A  SLWND G++ECYDRRREYQLTDSAKYYLD ++RI   DYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI +SHLVDYFP+F+GP+++A  AR+FILKMFV+LNPDP+KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MACCIPDELKEQKRINQEIERQLKRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSDEDKRSHIKIVYQNIFMAMHAMIRAMDTLNIQYINPANRENGNMIRQIDYETVTTFDKPCVDAIISLWNDDGIQECYDRRREYQLTDSAKYYLDSVERISQQDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMHSHLVDYFPEFDGPKKEASTAREFILKMFVELNPDPDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. UniProt/SwissProt
Match: sp|P21279|GNAQ_MOUSE (Guanine nucleotide-binding protein G(q) subunit alpha OS=Mus musculus OX=10090 GN=Gnaq PE=1 SV=4)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 283/351 (80.63%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   +IRAM+ LKIPY+   N  +A+ +R++D E V+ FE  ++ A +SLWND G++ECYDRRREYQL+DS KYYL+DLDR+  P YLPT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. UniProt/SwissProt
Match: sp|P82471|GNAQ_RAT (Guanine nucleotide-binding protein G(q) subunit alpha OS=Rattus norvegicus OX=10116 GN=Gnaq PE=2 SV=2)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 282/351 (80.34%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   ++RAM+ LKIPY+   N  +A+ +R++D E V+ FE  ++ A +SLWND G++ECYDRRREYQL+DS KYYL+DLDR+  P YLPT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMVRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. UniProt/SwissProt
Match: sp|Q2PKF4|GNAQ_PIG (Guanine nucleotide-binding protein G(q) subunit alpha OS=Sus scrofa OX=9823 GN=GNAQ PE=2 SV=3)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 283/351 (80.63%), Postives = 317/351 (90.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKR F KL+YQNI+ A   +IRAM+ LKIPY+   N  +A+ +R++D E V+ FE  ++ A +SLWND G++ECYDRRREYQL+DS KYYL+DLDR+  P YLPT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. TrEMBL
Match: A0A158QHW9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8239 PE=4 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 307/352 (87.22%), Postives = 335/352 (95.17%), Query Frame = 2
Query:  110 SMACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            SM+CC SEE+KEQ+RINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+++RS IKL+YQNIYLA YTLIRAME LKIPYENP N E+A+  R+IDYETVTT +P+H+VA +SLW+D G+KECYDRRREYQL DSAKYYLD++DRI   DYLPTLQDILR+RVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFV+LNPDPEK+IYSH TCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:   33 SMSCCRSEEYKEQNRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEERRSLIKLVYQNIYLAMYTLIRAMETLKIPYENPVNREHAEQAREIDYETVTTLDPAHVVAIKSLWSDPGIKECYDRRREYQLADSAKYYLDNIDRIAASDYLPTLQDILRLRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQESSVILFLNKKDLLEEKILYSHLVDYFPEYDGPQRDAKAAREFILKMFVELNPDPEKVIYSHITCATDTENIRFVFAAVKDTILQLNLKEYN 384          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. TrEMBL
Match: A0A564XXY7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1064 PE=4 SV=1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 307/351 (87.46%), Postives = 334/351 (95.16%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M+CC SEE+KEQ+RINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+D+RS IKL+YQNIYLA YTLIRAME LKIPYENP N E+A+  R+IDYETVTT +P+H+VA +SLW+D G+KECYDRRREYQL DSAKYYLD++DRI   DYLPTLQDILR+RVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFV+LNPDPEK+IYSH TCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MSCCRSEEYKEQNRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRRSLIKLVYQNIYLAMYTLIRAMETLKIPYENPVNREHAEQAREIDYETVTTLDPAHVVAIKSLWSDPGIKECYDRRREYQLADSAKYYLDNIDRIAASDYLPTLQDILRLRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQESSVILFLNKKDLLEEKILYSHLVDYFPEYDGPQRDAKAAREFILKMFVELNPDPEKVIYSHITCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. TrEMBL
Match: A0A5K3FJF2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 307/351 (87.46%), Postives = 334/351 (95.16%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M+CC SEE+KEQ+RINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+++RS IKL+YQNIYLA YTLIRAME LKIPYENP N E+A+  R+IDYETVTT +PSH+VA +SLW+D G+KECYDRRREYQL DSAKYYLD++DRI   DYLPTLQDILR+RVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFV+LNPDPEK+IYSH TCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MSCCRSEEYKEQNRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEERRSLIKLVYQNIYLAMYTLIRAMETLKIPYENPVNREHAEQAREIDYETVTTLDPSHVVAIKSLWSDPGIKECYDRRREYQLADSAKYYLDNIDRISAGDYLPTLQDILRLRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQESSVILFLNKKDLLEEKILYSHLVDYFPEYDGPQRDAKAAREFILKMFVELNPDPEKVIYSHITCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. TrEMBL
Match: A0A158RF38 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8723 PE=4 SV=1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 306/351 (87.18%), Postives = 334/351 (95.16%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M+CC SEE+KEQ+RINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+++RS IKL+YQNIYLA YTLIRAME LKIPYENP N E+A+  R+IDYETVTT +P+H+VA +SLW+D G+KECYDRRREYQL DSAKYYLD++DRI   DYLPTLQDILR+RVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFV+LNPDPEK+IYSH TCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MSCCRSEEYKEQNRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEERRSLIKLVYQNIYLAMYTLIRAMETLKIPYENPINREHAEQAREIDYETVTTLDPAHVVAIKSLWSDPGIKECYDRRREYQLADSAKYYLDNIDRIAASDYLPTLQDILRLRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQESSVILFLNKKDLLEEKILYSHLVDYFPEYDGPQRDAKAAREFILKMFVELNPDPEKVIYSHITCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. TrEMBL
Match: A0A4Z2D402 (Guanine nucleotide-binding protein G(Q) subunit alpha OS=Schistosoma japonicum OX=6182 GN=EWB00_004796 PE=4 SV=1)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 306/351 (87.18%), Postives = 333/351 (94.87%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE+KEQ+RINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG GYSDD++R+FIK++YQNIY+A +T++RA+E LKIPYENP N  Y + +R+IDYETVT  EPSH+VA +SLW+D G+KECYDRRREYQLTDSAKYYLD+LDRI  PDYLPTLQDILRVRVPTTGI+EY FDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEK+ YSHLVDYFP+++GPQRDAEAARDFILKMFV+LNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MFCCRSEEYKEQNRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSDDERRTFIKIVYQNIYMAMFTMVRAVESLKIPYENPANKAYGEAIREIDYETVTNMEPSHVVAIKSLWDDPGIKECYDRRREYQLTDSAKYYLDNLDRISQPDYLPTLQDILRVRVPTTGIVEYLFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQESSVILFLNKKDLLEEKVLYSHLVDYFPEYDGPQRDAEAARDFILKMFVELNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Cavefish
Match: gna11b (guanine nucleotide-binding protein subunit alpha-11 [Source:NCBI gene;Acc:103033252])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 277/351 (78.92%), Postives = 311/351 (88.60%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGY+D+DKR F KL+YQNI+ +  ++IRA E LKI Y+   N   A  ++++D E V++F+  +  A + LW+D G++E YDRRREYQL+DS KYYL DLDRI   +YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGFTKLVYQNIFTSMQSMIRATETLKIGYKYEQNKANAMLVKEVDIEKVSSFDQPYTSAIKMLWSDPGIQEAYDRRREYQLSDSTKYYLSDLDRIAESNYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Cavefish
Match: gna11b (guanine nucleotide-binding protein subunit alpha-11 [Source:NCBI gene;Acc:103033252])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 273/351 (77.78%), Postives = 311/351 (88.60%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGY+D+DKR F KL+YQNI+ +  ++IRA E LKI Y+   N   A  ++++D E V++F+  +  A + LW+D G++E YDRRREYQL+DS KYYL DL+R+    Y+PT QD+LRVRVPTTGIIEYPFDL+++IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGFTKLVYQNIFTSMQSMIRATETLKIGYKYEQNKANAMLVKEVDIEKVSSFDQPYTSAIKMLWSDPGIQEAYDRRREYQLSDSTKYYLTDLERVTASGYIPTQQDVLRVRVPTTGIIEYPFDLENVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000044487.1 (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:103042808])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 273/351 (77.78%), Postives = 312/351 (88.89%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+Q++RDKKD+RRELKLLLLGTGESGKSTFIKQMRIIHG+GYS++DK+ F KL+YQNI+ +  ++IRAM+ L+IPY+   N   A  +R++D E V+ F   ++ A +SLWND G++ECYDRRREYQL+DS KYYL+ LDRI    Y+PT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI +SHLVDYFP+++GPQRDA+A R+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQIRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDKKGFTKLVYQNIFTSVQSMIRAMDTLQIPYKYEHNKGNANIVREVDVEKVSGFANPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNSLDRISDSCYVPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMFSHLVDYFPEYDGPQRDAQAGREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Cavefish
Match: gna11b (guanine nucleotide-binding protein subunit alpha-11 [Source:NCBI gene;Acc:103033252])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 277/394 (70.30%), Postives = 311/394 (78.93%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYL-------------------------------------------DDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHGTGY+D+DKR F KL+YQNI+ +  ++IRA E LKI Y+   N   A  ++++D E V++F+  +  A + LW+D G++E YDRRREYQL+DS KYYL                                            DLDRI   +YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+F+GPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGFTKLVYQNIFTSMQSMIRATETLKIGYKYEQNKANAMLVKEVDIEKVSSFDQPYTSAIKMLWSDPGIQEAYDRRREYQLSDSTKYYLTDLERVTASGYIPTQQDVLRVRVPTTGIIEYPFDLENVIFSYLSDLDRIAESNYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 400          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Cavefish
Match: gna14a (guanine nucleotide-binding protein subunit alpha-14 [Source:NCBI gene;Acc:103045202])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 255/350 (72.86%), Postives = 301/350 (86.00%), Query Frame = 2
Query:  116 ACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
             CC S E KE  RIN+EI+KQL+RDKKD+RRELKLLLLGTGESGKSTFIKQMRIIHG+GY+++D++SF KL+YQNI  A  ++IRAME+L I   +P N   A  L +++ + V   + +++ A RSLW+D G++ECYDRRREYQL+DSAKYYL DL+RI TP Y+PT QDILRVRVPTTGIIEYPFDL+++IFRMVDVGGQRSERRKWIHCFE+VTSI+FLVALSEYDQVL E DNENRMEESKALF+TIITYPWFQ SSVILFLNK D+L+EKI YSHL +YFP+F GPQ D +AA++FILKM+ + NPD EK IYSHFTCATDTENIRFVFAAVKDTIL+ NLKE+N
Sbjct:    3 GCCMSAEEKECQRINQEIDKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYTEEDRKSFTKLVYQNIVTAMQSMIRAMEMLNISLSSPANQAQANLLNELEVDKVMDLDQNYVEAIRSLWSDQGIQECYDRRREYQLSDSAKYYLSDLERISTPTYVPTEQDILRVRVPTTGIIEYPFDLENVIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFQQSSVILFLNKTDILKEKITYSHLANYFPEFTGPQNDPKAAQEFILKMYQEQNPDREKTIYSHFTCATDTENIRFVFAAVKDTILRHNLKEFN 352          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 245/316 (77.53%), Postives = 281/316 (88.92%), Query Frame = 2
Query:  218 LLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            L  +GTGESGKSTFIKQMRIIHG+GY++DDKRSFIKL++QN++ A   +IRAME L IPY N  N  +A+ LR++D E + + +  +I A R LW D G++ECYDRRRE+QLTDSAKYYL+DL RI   +YLPT QDILRVR+PTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESD+ENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI +SHLVDYFP F+GPQ+D +AAR+FIL+MFV+LNPD EK+IYSHFTCATDTENIRFVFAAVKD ILQLNLKEYN
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREVDVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDGPQQDPQAAREFILRMFVELNPDTEKVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYN 316          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 511.146 bits (1315), Expect = 1.510e-180
Identity = 243/317 (76.66%), Postives = 278/317 (87.70%), Query Frame = 2
Query:  218 LLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFE-GPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            L  +GTGESGKSTFIKQMRIIHG+GY++DDKRSFIKL++QN++ A   +IRAME L IPY N  N  +A+ LR++D E + + +  +I A R LW D G++ECYDRRRE+QLTDSAKYYL+DL RI   +YLPT QDILRVR+PTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESD+ENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI +SHLVDYFP F+   Q D +AAR+FIL+MFV+LNPD EK+IYSHFTCATDTENIRFVFAAVKD ILQLNLKEYN
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREVDVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDVRNQFDPQAAREFILRMFVELNPDTEKVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYN 317          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007638.1 (pep scaffold:Pmarinus_7.0:GL482059:22195:26033:1 gene:ENSPMAG00000006878.1 transcript:ENSPMAT00000007638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 493.812 bits (1270), Expect = 4.464e-174
Identity = 230/295 (77.97%), Postives = 262/295 (88.81%), Query Frame = 2
Query:  224 LLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIR 1108
            L GTGESGKSTFIKQMRIIHG+GY+++D+R FIKL+YQNI++A   + RAME LKIPY    N E+A+ +R++D E V +F+  ++ A R LW+D G++ECYDRRREYQL+DS KYYL  +DRI  P+YLPT QD+LRVRVPTTGIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVL ESDNENRMEESKALFRTIITYPWF  SSVILFLNKKDLLEEKI YSHLVDYFP+FEGPQRDA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIR
Sbjct:    1 LAGTGESGKSTFIKQMRIIHGSGYTEEDRRGFIKLVYQNIFIAMQAMCRAMETLKIPYTYEYNKEHAQLVREVDIEKVCSFDKPYVEAVRCLWDDPGIEECYDRRREYQLSDSTKYYLSAIDRISGPNYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLAESDNENRMEESKALFRTIITYPWFHSSSVILFLNKKDLLEEKIMYSHLVDYFPEFEGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIR 295          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Sea Lamprey
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 330.872 bits (847), Expect = 1.341e-109
Identity = 171/336 (50.89%), Postives = 219/336 (65.18%), Query Frame = 2
Query:  158 NKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATR-SLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPE-KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            +KE+EK+L  D +   R +KLLLLG GESGKST +KQM+IIH  GYS+ +   F  +IY N   +   ++RAME   I Y +P      + L ++         P+ + A    LW D+GV+  +DR  EYQL DSA YYL+DLDR++ P YLP  QD+LR RV TTGIIE  F    + FRM DVGGQRSER+KWIHCFE VT I+F  ALS YD VLVE D  NRM ES  LF +I  + +F D+S++LFLNKKDL EEK++  HL   FP ++GP    +A   +I   F+DLN   E K IYSH TCATDT+N++FVF AV D I++ NLK+
Sbjct:    3 SKELEKKLAEDAEKEARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEAECLEFKAIIYSNTLQSILAIVRAMETFSIDYGDPARAADGRQLFNLADSLEEGSMPNELSAIIIRLWKDTGVQASFDRASEYQLNDSASYYLNDLDRLMNPSYLPNEQDVLRSRVKTTGIIEDSFCFKDLQFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFNDTSIVLFLNKKDLFEEKVKKVHLNICFPDYDGPNTFDDAGA-YIKNQFLDLNLRKEAKEIYSHLTCATDTQNVKFVFDAVTDIIIKNNLKD 337          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 326.25 bits (835), Expect = 1.553e-107
Identity = 170/353 (48.16%), Postives = 230/353 (65.16%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDL---RDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPE-KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            M C  S E K     ++ I++ L+ D + A RE+KLLLLG GESGKST +KQM+IIH  GY++++ + +  ++Y N   +   +IRAM  L+I + +    + A+ L        + + T E + ++  + LW D GV+ C+ R REYQL DSA YYL+DL+RI  P Y+PT QD+LR RV TTGI+E  F    + F+M DVGGQRSER+KWIHCFE VT+I+F VALS YD VL E +  NRM ES  LF +I    WF ++S+ILFLNKKDL EEK+  S L   +P++ G     EAA  +I   F +LN   E K IY+HFTCATDT+N++FVF AV D I++ NLK+
Sbjct:    1 MGCTLSTEDKAAVERSRMIDRNLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDARQLFVLAGSAEDGLMTPELAQVI--KRLWADPGVQACFRRAREYQLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKVIRSPLTICYPEYTGGNTYEEAAA-YIQTQFENLNKRKESKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD 350          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 249.98 bits (637), Expect = 3.796e-77
Identity = 143/326 (43.87%), Postives = 198/326 (60.74%), Query Frame = 2
Query:  206 RELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDL-RDIDYETVTTFE---PSHIVATRS-LWNDSGVKECYD--RRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDS-IIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            +ELK+LLLG GESGKST ++Q++I+H  G+S+ + + +I LIYQN+      LI+A     +  E P+     +DL R + YE    +    P  I    S LW     ++  +     ++ L DS  Y++++  RI +P+Y PT QDILR R  T+GI +   D+ S I   + DVGGQRSER+KWIHCF++VT ++F V+LSEYDQ L+E  N+NR +ES  LF  I+   WF  +SV+LFLNK DL  EK+    + +YFP + G   D   A  +IL  FV LN      IY H T ATDT NIR VFAA+K+TIL+  LK+
Sbjct:  122 KELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLE-PECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKLSKVPMENYFPDYTG-GSDINKAAKYILWRFVQLN-RANLSIYPHVTQATDTSNIRLVFAAIKETILENTLKD 444          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 236.884 bits (603), Expect = 7.748e-72
Identity = 110/226 (48.67%), Postives = 158/226 (69.91%), Query Frame = 2
Query:  485 ATRSLWN-DSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            A + LWN D G+K+C+ R  E+QL  SA YY D++++  +P+Y+ T +DIL+ R+ TTGI E  F++ S  F+++D GGQRSER+KWIHCFE +T+++F++A+SEYDQ+L E +  NRM ES  LF T++   WF+D+  ILFLNK DL EEK++   +  YFP ++G   DAEA   +  K+F+ LN    K IY   TCATDT+ ++FV +AV D I+Q NLK+
Sbjct:  244 AIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKSMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLNK-TNKPIYVKRTCATDTQTMKFVLSAVTDLIIQQNLKK 468          

HSP 2 Score: 67.0106 bits (162), Expect = 3.231e-12
Identity = 50/163 (30.67%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  128 SEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKI------PYENPDNLEYAKDL---RDIDYETVTTFEPSHIVATRSLWNDSGVK--ECYDRRREYQLTDSAKYYLDD 583
            S+ F +  R N  IE+ L+ +K+  + E+KLLLLG GESGKST +KQ++++H  G+S  ++  + ++I+ +   +   LI     L I      P  N D     + L   + +DY   +      +       ND  +K  E Y+ RR  Q T  AK   D+
Sbjct:   14 SDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLGIQLDCDDPINNKDLFACKRILLKAKALDYINAS------VAGGSDFLNDYVLKYSERYETRRRVQSTGRAKAAFDE 170          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 50.447 bits (119), Expect = 1.057e-7
Identity = 29/99 (29.29%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  632 LRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDL 928
            ++   PT G         ++ F M DVGGQ+  R  W H F + T+++F          +++S   NRMEE+K    +II     ++  ++++ NK+DL
Sbjct:   42 IKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIF----------VIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDL 130          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 277/351 (78.92%), Postives = 316/351 (90.03%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SEE KE+ RIN EIEKQ+++DK++ RRELKLLLLGTGESGKSTFIKQMRIIHG GYSD+DKR +I L+YQNI  A ++L RAME LKIPY++  NLE A  +R +D + VTTFE  +  AT+SLW+D+G++ECYDRRREYQL+DSAKYYL DLDR+  PDYLPT QD+LR R PT+GIIEYPFDL++IIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESD+ENRMEESKALFRTIITYPWFQ+SS+ILFLNKKDLLEEKI +SHLV+YFP+F+GPQ DA+AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MDCCLSEEAKERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKASYIRTVDPKNVTTFEREYYEATKSLWSDAGMQECYDRRREYQLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKIMFSHLVEYFPEFDGPQCDAQAAREFILKMFVDLNPDTDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 340.887 bits (873), Expect = 4.636e-113
Identity = 179/352 (50.85%), Postives = 232/352 (65.91%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDI--DYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPE-KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            M C  S E K  +  +K I+K L+ D + A RE+KLLLLG GESGKST +KQM+IIH  GYS ++   + +++Y N   +   +IRAM  LKI + +PD  + A+++  +    E V  F    I   + LW+DSG++ C+ R REYQL DSA YYL+ LDR+ +PDY+PT QD+LR RV TTGI+E  F    + F+M DVGGQRSER+KWIHCFE VT+I+F VALS YD VL E +  NRM ES  LF +I    WF D+S+ILFLNKKDL  EKI  S L   FP++ G     EAA  +I   F +LN   + K IY+HFTCATDT NI+FVF AV D I++ NLK+
Sbjct:    1 MGCTLSAEDKAAAERSKMIDKNLRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDAREMFALAGSMEDVK-FTAELISIMKRLWSDSGIQACFARSREYQLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKIVKSPLTICFPEYTGSNTYEEAAA-YIQMQFENLNKRKDTKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNLKD 350          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 340.887 bits (873), Expect = 4.893e-113
Identity = 183/350 (52.29%), Postives = 228/350 (65.14%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTT--FEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
            M C  S E +     +K IEK LK +   A R++KLLLLG GESGKST +KQMRIIH  G+S +D   +  L++ N   +  T+IRAM+ L+I +EN   L  AK + D+      T  F P    +   LW D+GV++C+ R REYQL DSAKYYLD L RI  P+Y  T QD+LR RV TTGI+E  FD   + F++ DVGGQRSER+KWIHCFE VT+I++ VALS YD  L E ++ NRMEES  LF +II   WF D+SVILFLNKKDL EEKI    L   FP++ GP    E A+ +I K F   N + EK IY+H TCATDT+NI FVF AV DTI+  NLK
Sbjct:    1 MGCTLSAEERAAIARSKAIEKNLKLEGARAERDVKLLLLGAGESGKSTIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRIDFENDARLMDAKLVFDVIARADDTEPFTPELTESMERLWKDAGVQQCFHRSREYQLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYDLTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKISKFPLTLCFPEYSGPSTFDEGAK-YIRKQFESKNLNDEKEIYTHLTCATDTQNINFVFNAVTDTIIANNLK 349          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 330.872 bits (847), Expect = 3.796e-109
Identity = 165/349 (47.28%), Postives = 233/349 (66.76%), Query Frame = 2
Query:  116 ACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDY--ETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
             CC ++E  EQ   +++I+KQ+ ++K   RR++K+LLLG GESGKSTF+KQMRII+G  +  D  + +  ++Y NI      L  A   L+I ++ PDN  +A+ +  +       T F   +  + R LW D+G+++ +DRRRE+QL DS +Y+LD LDRI   DY+PT QD+L  R  T GI+E+ F + SI F+MVDVGGQRS+R KW  CF+ VTSI+FLV+ S YDQVL+E    NR+ ES  +F TI+   +F + S+ILFLNK DLL EK++++++ D+FP F+G     E  ++FIL+MF     +  K ++ HFT A DTENI+FVF AVKDTILQ NLK
Sbjct:    5 GCCLTQEEAEQRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWDAPDNEMHAERILTLQAPPRIDTEFFLQYAESVRRLWTDAGIRDSFDRRREFQLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVLMEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKVKHTNIKDFFPAFQGDPHKLEDVQNFILQMFDSKRRERSKALFHHFTTAVDTENIKFVFHAVKDTILQENLK 353          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 279.641 bits (714), Expect = 6.717e-89
Identity = 164/358 (45.81%), Postives = 220/358 (61.45%), Query Frame = 2
Query:  167 IEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGT-GYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYE--NPDN---LEYAKDLR---DIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQY--SHLVDYFPQFE------------GPQRDAEAARDFILKMFVDLNP---DPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEY 1162
            IE+QLK DK   R   +LLLLG GESGKST +KQMRI+H   G+++ +KR  I+ I +NI  A  T+  AM  L  P +  NP+N   L+Y  ++    D DY       P     T+ LW D+GV ECY+R  EYQL D A+Y+LD +D I   DYLPT QD+LR RV T+GIIE  F++D + F M DVGGQR ERRKWI CF  VT+I+F+VA S Y+ VL E  ++NR++ES  LF++I    W +  SVILFLNK+DLL++K++   S + DYFP F             G +     A+ FI   F+ ++    D +   Y HFTCA DTENIR VF   +D I +++L++Y
Sbjct:   26 IERQLKEDKIAYRATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTLTPPVKLANPNNQFRLDYVHEVATAPDFDYP------PEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEAVTRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQY 377          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Medaka
Match: gna11b (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101161353])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 278/351 (79.20%), Postives = 311/351 (88.60%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+D+RRELKLLLLGTGESGKSTFIKQMRIIHG GYSD+DKR FI+L+YQNI+ +   +IRA E LKIPY+  +N   A  ++++D E +  F+  ++VA +SLW D G++E YDRRREYQL+DS KYYL DLDRI  P YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+F+GPQRD +AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIDKQLRRDKRDSRRELKLLLLGTGESGKSTFIKQMRIIHGAGYSDEDKRGFIRLVYQNIFTSMQAMIRATETLKIPYKYEENRANAMLVKEVDIEKINGFDQHYVVAIKSLWADPGIQEAYDRRREYQLSDSTKYYLTDLDRIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDPQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Medaka
Match: gna11b (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101161353])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 273/351 (77.78%), Postives = 312/351 (88.89%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EI+KQL+RDK+D+RRELKLLLLGTGESGKSTFIKQMRIIHG GYSD+DKR FI+L+YQNI+ +   +IRA E LKIPY+  +N   A  ++++D E +  F+  ++VA +SLW D G++E YDRRREYQL+DS KYYL+D+DR+    Y+PT QD+LRVRVPTTGIIEYPFDL+++IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+F+GPQRD +AAR+FILKMFVDLNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIDKQLRRDKRDSRRELKLLLLGTGESGKSTFIKQMRIIHGAGYSDEDKRGFIRLVYQNIFTSMQAMIRATETLKIPYKYEENRANAMLVKEVDIEKINGFDQHYVVAIKSLWADPGIQEAYDRRREYQLSDSTKYYLNDIDRLTAEGYVPTQQDVLRVRVPTTGIIEYPFDLENVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKISYSHLVDYFPEFDGPQRDPQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 357          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000007129.2 (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101168718])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 277/351 (78.92%), Postives = 309/351 (88.03%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIE+QL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG GYSD+DKR F KL+YQNI+ +   +IRAME LKIPY+   N   A  ++++D E VT F+  ++ A +SLWND G++E YDRRREYQL+DS KYYL+ LDRI    YLPT QD+LRVRVPTTGIIEYPFDL S+IFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+++GPQRDA+AAR+FILKMFVDLNP  + +IYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSDEDKRGFTKLVYQNIFTSMQAMIRAMETLKIPYKYEHNKANANIVKEVDVEVVTVFQNPYVDAIKSLWNDPGIQESYDRRREYQLSDSTKYYLNALDRIAESSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPS-DTVIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 356          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000033394.1 (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101158934])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 275/351 (78.35%), Postives = 305/351 (86.89%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GY+++DKR F KL+YQNI+ +   +I A E L IPY+  +N   A  +RD+D E ++ FE  +I A R LW+D G+ E YDRRREYQL+DS KYYL  LDRI  P YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+FEGP+RDA+A R+FILKMF+DLNPD  K+IYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTEEDKRGFTKLVYQNIFTSMQAMIHAAENLNIPYKYEENKNNALLVRDVDVEMISRFEQPYIKAIRMLWSDPGIMEAYDRRREYQLSDSTKYYLSALDRIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEFEGPRRDAQAGREFILKMFLDLNPD--KVIYSHFTCATDTENIRFVFAAVKDTILQFNLKEYN 355          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000043083.1 (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101158934])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 275/351 (78.35%), Postives = 305/351 (86.89%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACC SEE KE  RIN EIEKQL+RDK+DARRELKLLLLGTGESGKSTFIKQMRIIHG+GY+++DKR F KL+YQNI+ +   +I A E L IPY+  +N   A  +RD+D E ++ FE  +I A R LW+D G+ E YDRRREYQL+DS KYYL  LDRI  P YLPT QD+LRVR+PTTGIIEYPFDL SIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ+SSVILFLNKKDLLEEKI YSHLVDYFP+FEGP+RDA+A R+FILKMF+DLNPD  K+IYSHFTCATDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    7 MACCLSEEAKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTEEDKRGFTKLVYQNIFTSMQAMIHAAENLNIPYKYEENKNNALLVRDVDVEMISRFEQPYIKAIRMLWSDPGIMEAYDRRREYQLSDSTKYYLSALDRIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEFEGPRRDAQAGREFILKMFLDLNPD--KVIYSHFTCATDTENIRFVFAAVKDTILQFNLKEYN 355          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Planmine SMEST
Match: SMESG000023274.1 (SMESG000023274.1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 351/351 (100.00%), Postives = 351/351 (100.00%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN
Sbjct:    1 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Planmine SMEST
Match: SMESG000022892.1 (SMESG000022892.1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 297/351 (84.62%), Postives = 324/351 (92.31%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYN 1165
            M CC SE  KEQ RINKEIEKQLK+DKK++RRELKLLLLGTGESGKSTFIKQMRIIHG+GYSD+DKRSFIKL+YQNIYLA YTLI AME L I Y NP+NL Y  ++++IDYE+V+T EP H++A +SLW D GVKECYDRRRE+QLTDSAKYYLD LDRI TP++LPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFE+VTSIMFLVALSEYDQ LVESDN+NRMEESKALFRTIITYPWF ++SVILFLNKKDLLEEKI YSHLVDYFP++EGPQRDAEAARDFILKMF++LNPD EKIIYSHFTC TDTENIRFVFAAVKDTILQ NLKEYN
Sbjct:    1 MGCCLSELDKEQKRINKEIEKQLKKDKKESRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRSFIKLVYQNIYLAIYTLILAMENLAISYSNPENLSYIDEIKNIDYESVSTLEPDHVIAIKSLWADVGVKECYDRRREFQLTDSAKYYLDSLDRIATPNFLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQGLVESDNDNRMEESKALFRTIITYPWFHNASVILFLNKKDLLEEKIIYSHLVDYFPEYEGPQRDAEAARDFILKMFIELNPDQEKIIYSHFTCGTDTENIRFVFAAVKDTILQCNLKEYN 351          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Planmine SMEST
Match: SMESG000017017.1 (SMESG000017017.1)

HSP 1 Score: 351.288 bits (900), Expect = 7.995e-117
Identity = 184/355 (51.83%), Postives = 242/355 (68.17%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSH-----IVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDP-EKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            M C NS +   Q   +KEIEKQL+ D++ A RE+KLLLLG GE GKST +KQM IIHG GYSD++K+ FI +IY NI  +   +++AM++L+IP EN  NL   K+     +E++   E        I A   LW D+GV+E ++R +EYQL DSA+YYL DL+RI + +Y+PT+QDILR R+ TTGIIE  F    + F++ DVGGQRSER+KW+HCFE VT+I+FLVALSEYD  LVE    NRM ES  LF +I   PWF ++SVILFLNK DL E KIQ S L   FP++ GP    + + ++I + F  LN     K+IY+HFTCATDT N++ VF AV D I++ NLK+
Sbjct:    1 MGCINSTKNVVQEEAHKEIEKQLRIDQEKAMREIKLLLLGAGECGKSTILKQMSIIHGGGYSDEEKKEFIPIIYANIVQSMGAILKAMDILEIPLENA-NLGTEKNTV---HESMKNAEEGGMTINTIKALTVLWKDTGVQEAFNRSKEYQLNDSAEYYLIDLERIASDNYIPTVQDILRSRIKTTGIIETYFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVALSEYDLRLVEDSTTNRMHESMKLFDSICNSPWFVNTSVILFLNKVDLFEIKIQRSPLTICFPEYLGPNTFVDTS-NYIREKFEGLNKKKNSKVIYTHFTCATDTTNVQVVFDAVIDIIIKNNLKD 350          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Planmine SMEST
Match: SMESG000026676.1 (SMESG000026676.1)

HSP 1 Score: 341.658 bits (875), Expect = 4.931e-113
Identity = 173/350 (49.43%), Postives = 231/350 (66.00%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDI--DYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK 1156
            M C  S++ +E    ++ I+K+LK D   A +++KLLLLG GESGKST +KQM+IIH  G++++D + +  ++Y N   +   ++RAM  L I + +PD    AK + D+    E    F    + AT+ LW DSGV+EC++R  EYQL DSAKY+LDD+DR+   DY+PT QDILR R+ TTGI+E  F   ++ F++ DVGGQRSER+KWIHCFE VT+I+F VA+SEYDQVL E +  NRM+ES  LF +I    WF  +S+ILFLNKKDL  EKI+ S L   F ++ G Q   EAA  +I   F   N  P K IY H TCATDT NI+FVF AV D I+  NL+
Sbjct:    1 MGCALSKDEREALDKSRNIDKKLKEDGVQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTNEDNKQYKPVVYSNTTQSMIAILRAMTTLNISFGDPDRSADAKIVSDVIQAMEDTEPFSEELLEATKRLWADSGVQECFNRSNEYQLNDSAKYFLDDIDRLGAGDYMPTEQDILRTRIKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTQTSIILFLNKKDLFAEKIKRSPLTVCFSEYTGRQTYEEAAA-YIQASFEAKNNSPNKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLR 349          
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Planmine SMEST
Match: SMESG000026774.1 (SMESG000026774.1)

HSP 1 Score: 337.421 bits (864), Expect = 2.299e-111
Identity = 173/351 (49.29%), Postives = 230/351 (65.53%), Query Frame = 2
Query:  113 MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYAKDLRDIDYETVTTFEPSHIVATRSL-WNDSGVKECYDRRREYQLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDPE-KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKE 1159
            M C  S   K+Q   NKEIE+QL++D + A +E+KLLLLG GE GKST +KQM IIHG GY +++++ ++ +IY N+  +  T++ AME L I  EN   +E +K ++           P  + +  +L W D  V+ CY R +EYQL DSA YYLD LDR+  P Y+PT QD+LR RV TTGI+E  F    + F++ DVGGQRSER+KW+HCFE VT+I+FLVA+SEYD  LVE  + NRM ES  LF +I    WF ++S+ILFLNKKDL  EK+  S L   FP++ G     EA+  +I   F +LN   E K IY+HFTCATDT NI+ VF AV D I++ NLK+
Sbjct:    1 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASA-YIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKD 350          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNAQ0.000e+080.63G protein subunit alpha q [Source:HGNC Symbol;Acc:... [more]
GNA110.000e+080.63G protein subunit alpha 11 [Source:HGNC Symbol;Acc... [more]
GNA140.000e+073.14G protein subunit alpha 14 [Source:HGNC Symbol;Acc... [more]
GNA112.567e-13290.24G protein subunit alpha 11 [Source:HGNC Symbol;Acc... [more]
GNA155.026e-13252.78G protein subunit alpha 15 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-300.000e+077.62EGL-30; Heterotrimeric G protein alpha subunit [S... [more]
egl-302.899e-16976.41EGL-30; Heterotrimeric G protein alpha subunit [S... [more]
goa-11.301e-10848.29Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-163.828e-10849.16Guanine nucleotide-binding protein alpha-16 subuni... [more]
gpa-71.642e-10646.55Guanine nucleotide-binding protein alpha-7 subunit... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galphaq0.000e+079.77gene:FBgn0004435 transcript:FBtr0087833[more]
Galphaq0.000e+079.77gene:FBgn0004435 transcript:FBtr0087830[more]
Galphaq0.000e+079.77gene:FBgn0004435 transcript:FBtr0087829[more]
Galphaq0.000e+079.77gene:FBgn0004435 transcript:FBtr0304955[more]
Galphaq0.000e+079.77gene:FBgn0004435 transcript:FBtr0087831[more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna11b0.000e+078.92guanine nucleotide binding protein (G protein), al... [more]
gnaq0.000e+077.78guanine nucleotide binding protein (G protein), q ... [more]
gna11a0.000e+078.35guanine nucleotide binding protein (G protein), al... [more]
gna11a0.000e+078.35guanine nucleotide binding protein (G protein), al... [more]
gna11a0.000e+077.78guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna110.000e+079.77guanine nucleotide binding protein (G protein), al... [more]
gnaq0.000e+079.77guanine nucleotide binding protein (G protein), q ... [more]
gnaq0.000e+079.77guanine nucleotide binding protein (G protein), q ... [more]
adprh0.000e+073.14ADP-ribosylarginine hydrolase [Source:Xenbase;Acc:... [more]
gnao15.247e-11350.57G protein subunit alpha o1 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnaq0.000e+080.63guanine nucleotide binding protein, alpha q polype... [more]
Gna110.000e+080.06guanine nucleotide binding protein, alpha 11 [Sour... [more]
Gna140.000e+073.43guanine nucleotide binding protein, alpha 14 [Sour... [more]
Gna147.158e-16472.24guanine nucleotide binding protein, alpha 14 [Sour... [more]
Gna155.771e-12954.44guanine nucleotide binding protein, alpha 15 [Sour... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15975|GNAQ_MIZYE0.000e+081.20Guanine nucleotide-binding protein G(q) subunit al... [more]
sp|P38411|GNAQ_LYMST0.000e+082.05Guanine nucleotide-binding protein G(q) subunit al... [more]
sp|P21279|GNAQ_MOUSE0.000e+080.63Guanine nucleotide-binding protein G(q) subunit al... [more]
sp|P82471|GNAQ_RAT0.000e+080.34Guanine nucleotide-binding protein G(q) subunit al... [more]
sp|Q2PKF4|GNAQ_PIG0.000e+080.63Guanine nucleotide-binding protein G(q) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QHW90.000e+087.22Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A564XXY70.000e+087.46Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3FJF20.000e+087.46Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158RF380.000e+087.18Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A4Z2D4020.000e+087.18Guanine nucleotide-binding protein G(Q) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna11b0.000e+078.92guanine nucleotide-binding protein subunit alpha-1... [more]
gna11b0.000e+077.78guanine nucleotide-binding protein subunit alpha-1... [more]
ENSAMXT00000044487.10.000e+077.78guanine nucleotide-binding protein G(q) subunit al... [more]
gna11b0.000e+070.30guanine nucleotide-binding protein subunit alpha-1... [more]
gna14a0.000e+072.86guanine nucleotide-binding protein subunit alpha-1... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007354.10.000e+077.53pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007349.11.510e-18076.66pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007638.14.464e-17477.97pep scaffold:Pmarinus_7.0:GL482059:22195:26033:1 g... [more]
gnat21.341e-10950.89guanine nucleotide binding protein (G protein), al... [more]
gnai31.553e-10748.16guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
GPA23.796e-7743.87Nucleotide binding alpha subunit of the heterotrim... [more]
GPA17.748e-7248.67Subunit of the G protein involved in pheromone res... [more]
ARF31.057e-729.29Glucose-repressible ADP-ribosylation factor; GTPas... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414650.000e+078.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496924.636e-11350.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325404.893e-11352.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479933.796e-10947.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491936.717e-8945.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna11b0.000e+079.20guanine nucleotide-binding protein G(q) subunit al... [more]
gna11b0.000e+077.78guanine nucleotide-binding protein G(q) subunit al... [more]
ENSORLT00000007129.20.000e+078.92guanine nucleotide-binding protein G(q) subunit al... [more]
ENSORLT00000033394.10.000e+078.35guanine nucleotide-binding protein G(q) subunit al... [more]
ENSORLT00000043083.10.000e+078.35guanine nucleotide-binding protein G(q) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(Q) subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023274.10.000e+0100.00SMESG000023274.1[more]
SMESG000022892.10.000e+084.62SMESG000022892.1[more]
SMESG000017017.17.995e-11751.83SMESG000017017.1[more]
SMESG000026676.14.931e-11349.43SMESG000026676.1[more]
SMESG000026774.12.299e-11149.29SMESG000026774.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033719 ID=SMED30033719|Name=Guanine nucleotide-binding protein G(Q) subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1767bp
AGGTCATATTTGTTTTAATACTTTGTATAGATTATTATAAATAATAATAA
CACTAGTGATTATAAAATGATTTTTTAAGTCTTAGTATATTTTTAAATAA
TAATATTAAAGTATGGCATGTTGTAATAGTGAAGAATTTAAAGAACAAAG
TAGAATTAATAAGGAAATAGAAAAGCAGTTGAAACGAGACAAAAAAGATG
CACGTCGTGAATTAAAACTTTTACTTTTAGGAACTGGAGAATCTGGTAAA
AGTACATTTATTAAACAAATGAGAATTATTCATGGTACCGGTTATTCTGA
TGATGATAAACGTAGTTTCATAAAGTTGATCTACCAAAATATCTATCTAG
CCACATACACTCTAATTAGAGCGATGGAAGTACTGAAGATTCCATATGAA
AATCCCGATAATTTGGAATATGCAAAAGACCTTCGAGATATTGATTATGA
GACAGTTACGACGTTTGAACCAAGCCACATTGTCGCTACTAGGTCATTGT
GGAACGATTCTGGGGTTAAAGAATGCTATGACCGTCGAAGAGAGTATCAG
CTAACGGATTCTGCTAAATACTACCTCGATGATCTCGATAGAATAGTTAC
TCCTGATTACTTACCGACTTTGCAAGATATTCTCCGAGTACGGGTTCCTA
CAACTGGGATCATTGAATATCCATTTGATCTAGACTCAATTATATTTAGA
ATGGTTGATGTTGGAGGTCAGAGATCTGAAAGAAGAAAATGGATTCATTG
TTTCGAAAGTGTGACAAGCATTATGTTTCTCGTTGCCTTGTCAGAATATG
ACCAAGTTCTTGTGGAATCAGATAATGAAAATCGAATGGAAGAAAGCAAA
GCCTTGTTTCGTACTATTATCACATATCCATGGTTTCAAGATTCATCAGT
CATATTATTTTTGAATAAAAAAGACCTTCTCGAAGAGAAAATTCAATATT
CACATTTAGTAGACTATTTTCCTCAATTTGAAGGACCCCAAAGAGATGCT
GAAGCTGCTAGAGATTTCATTTTAAAAATGTTCGTTGATCTTAATCCCGA
TCCTGAAAAGATCATTTATTCTCATTTCACTTGTGCAACTGATACAGAAA
ATATTAGATTCGTATTTGCTGCTGTGAAAGATACGATTCTTCAATTGAAC
CTGAAGGAATATAATTTGGTATAGATTATTTGCTTGCACTTGACACTTGT
CTGAATAATAACAACAACAACAACAACAAAACGCTACACTGAAAAGTAAC
CACATCTTCTGATATATTAAAAAGGCAATAGAAATCAATTTTATCTCATC
AGAAATATTTAAAACAAAGATGTTGTTTAAAAGTGTGATTTCTCAAAACG
TTTTGCTGATATATAATTGATTTGTATATAAATATCAATATTTATTATAA
TAATAATGATAATAATAATTCTTGGACAATCAAATAATTGACAAGAGTAA
ATTGCTGTTTTAGATCTGTGTTTATAAGTCTGAGATTAATAATAATAATA
ATAATAATTGGCTTGTGTATGTGTGTGTTTGTGTTTGTTTGTTTCGGAGA
ATATTAACGAAAGGAAAACGCACAATTTGTTTATTGTATTTTTCTCGATG
TAAAATCAATGTATTTTTATGGTAAGCAAATTAATGACATTGGTAAACAT
TTATTTATTGATTTTTTTGTTTTATTATAATATATATGCCTTGATTATTG
GGCATTGATTTTGATAACAATTGATATTCGTCAATCGGACAGTGTTTTGT
TGTAAGCCAAAATTATT
back to top

protein sequence of SMED30033719-orf-1

>SMED30033719-orf-1 ID=SMED30033719-orf-1|Name=SMED30033719-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MACCNSEEFKEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFI
KQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDN
LEYAKDLRDIDYETVTTFEPSHIVATRSLWNDSGVKECYDRRREYQLTDS
AKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDV
GGQRSERRKWIHCFESVTSIMFLVALSEYDQVLVESDNENRMEESKALFR
TIITYPWFQDSSVILFLNKKDLLEEKIQYSHLVDYFPQFEGPQRDAEAAR
DFILKMFVDLNPDPEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEY
NLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000654Gprotein_alpha_Q
IPR011025GproteinA_insert
IPR027417P-loop_NTPase
IPR001019Gprotein_alpha_su
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0003924GTPase activity
GO:0004871signal transducer activity
GO:0019001guanyl nucleotide binding
GO:0005525GTP binding
GO:0001664G-protein coupled receptor binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPRINTSPR00318GPROTEINAcoord: 35..50
score: 80.72
coord: 217..245
score: 61.97
coord: 166..188
score: 64.27
coord: 195..212
score: 82.13
coord: 263..272
score: 82.71
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitSMARTSM00275galpha_1coord: 13..352
e-value: 1.7E-202
score: 688.6
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPFAMPF00503G-alphacoord: 14..342
e-value: 1.6E-114
score: 382.7
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 1..353
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitCDDcd00066G-alphacoord: 34..347
e-value: 0.0
score: 560.607
IPR000654G-protein alpha subunit, group QPRINTSPR00442GPROTEINAQcoord: 291..301
score: 68.6
coord: 305..316
score: 76.14
coord: 253..263
score: 88.43
coord: 3..17
score: 64.24
coord: 75..85
score: 44.21
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 18..344
e-value: 1.9E-149
score: 499.2
NoneNo IPR availablePANTHERPTHR10218:SF316GUANINE NUCLEOTIDE-BINDING PROTEIN G(Q) SUBUNIT ALPHAcoord: 1..353
NoneNo IPR availablePROSITEPS51882G_ALPHAcoord: 32..353
score: 107.553
IPR011025G protein alpha subunit, helical insertionGENE3DG3DSA:1.10.400.10coord: 62..179
e-value: 1.9E-149
score: 499.2
IPR011025G protein alpha subunit, helical insertionSUPERFAMILYSSF47895Transducin (alpha subunit), insertion domaincoord: 61..180
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 32..347