SMED30033712

Overview
NameSMED30033712
Smed IDSMED30033712
Length (bp)4130
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30033712 (SMED30033712) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30033712 (SMED30033712) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30033712 (SMED30033712) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30033712 (SMED30033712) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033712

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033712h1SMcG0021920 SmedASXL_011281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033712h1SMcG0021920 SmedASXL_011281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033712 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000289:28792..32921 +20650
Homology
BLAST of SMED30033712 vs. TrEMBL
Match: A0A0X3NME3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR160891 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.496e-6
Identity = 52/198 (26.26%), Postives = 84/198 (42.42%), Query Frame = 2
Query:  113 LNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTE-------------YEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEEN-------LMSTNICNL--CNTAVKMDSQESILDHLLFQHNNA---IICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTF 631
            L T    + I+  E++ G FIC  C    T   T+             +  HL   H   + +SC++C +    S  +SH+  HF E        L S+ IC +  C+  +  +S   +  HLL  HN     I CP C++    ++  + H+      + HCT EGC +K+   + L  H   S H S++     +F
Sbjct:   11 LATKYLSSNISRLESATGCFICLACPLSATAKSTDGYNHINGTWNPETFSMHLSTCHPGLEILSCVFCGLEIPKSSFTSHVAFHFLEYSSRGRGLLPSSYICPIASCSPVLTTNSLRCLRIHLLTHHNPPKPRIACPHCRLTQSSLDSWISHVKTISIRLSHCTAEGCLVKSPSRDLLIDHVRRS-HCSEATVSFKSF 207          
BLAST of SMED30033712 vs. TrEMBL
Match: A0A183SYX3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9421 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.562e-6
Identity = 52/198 (26.26%), Postives = 84/198 (42.42%), Query Frame = 2
Query:  113 LNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTE-------------YEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEEN-------LMSTNICNL--CNTAVKMDSQESILDHLLFQHNNA---IICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTF 631
            L T    + I+  E++ G FIC  C    T   T+             +  HL   H   + +SC++C +    S  +SH+  HF E        L S+ IC +  C+  +  +S   +  HLL  HN     I CP C++    ++  + H+      + HCT EGC +K+   + L  H   S H S++     +F
Sbjct:   11 LATKYLSSNISRLESATGCFICLACPLSATAKSTDGYNHINGTWNPETFSMHLSTCHPGLEILSCVFCGLEIPKSSFTSHVAFHFLEYSSRGRGLLPSSYICPIASCSPVLTTNSLRCLRIHLLTHHNPPKPRIACPHCRLTQSSLDSWISHVKTISIRLSHCTAEGCLVKSPSRDLLIDHVRRS-HCSEATVSFKSF 207          
BLAST of SMED30033712 vs. Planmine SMEST
Match: SMESG000081020.1 (SMESG000081020.1)

HSP 1 Score: 1864.74 bits (4829), Expect = 0.000e+0
Identity = 1015/1015 (100.00%), Postives = 1015/1015 (100.00%), Query Frame = 2
Query:  101 MIKLLNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTEYEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTFNCLSIDDENKFSFVEDENILPKLDKENSFISINHDNDEIPDRNVSRINFVWQLHCRKDLFNSLYKNDDLEELSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTEKESRTSLRFIEFNKQSSKNLLNRRKSTSRINDNNYPVTRSESASFLLKLKLPSVKRKKSLLNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMRLVQVVDLQNGLVDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMLKLFVRTDLYDEMFKNCSLEIAETLKHKLIPVNDYSIGVAVNKTKKTFYCQLCDYISNYSNWDVRKHILVWHCGINNTDSYKCTKLVEFKQXXXXXXXXXXXXXXXXXXXXXLLTKEPLAKLTLDNKSVFKEKSIIDCFTKSEMVTPFISGTGKLVKMHYLKSELKKVFPIASDEFLKEIESKMENYKAYSLEVTYIXXXXXXXXXXXXXXSHYNQGDIKKHIMSKHCGISGNIVRDCIKLCKKDSLSQSFDDIKLESEMYASPRKIRNRSLILKISRESCPGSVKTDQHLACKQLPKKRSSYFVSQKVEPIVNSDHDRYNDFSENXXXXDEDQQQMKRLSSSLSIPFAELEKRPKLASINLDEPQKIIIEREIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQSKIRVAKKFNSEIFICSHCNWFNWKSMSVVSKHILEMHTGIDQSFILLVEASTKLDSDGQLLSDSELSKLGWNGKPILS 3145
            MIKLLNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTEYEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTFNCLSIDDENKFSFVEDENILPKLDKENSFISINHDNDEIPDRNVSRINFVWQLHCRKDLFNSLYKNDDLEELSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTEKESRTSLRFIEFNKQSSKNLLNRRKSTSRINDNNYPVTRSESASFLLKLKLPSVKRKKSLLNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMRLVQVVDLQNGLVDNEETKESELIEDEDEEDEEEDVDEGEEPKEIESNNISNSVEVKKVKSKLSYMLKLFVRTDLYDEMFKNCSLEIAETLKHKLIPVNDYSIGVAVNKTKKTFYCQLCDYISNYSNWDVRKHILVWHCGINNTDSYKCTKLVEFKQEPIESNDEEDVEEESKIIEESLLTKEPLAKLTLDNKSVFKEKSIIDCFTKSEMVTPFISGTGKLVKMHYLKSELKKVFPIASDEFLKEIESKMENYKAYSLEVTYIKGVKYYVCVVCGYKSHYNQGDIKKHIMSKHCGISGNIVRDCIKLCKKDSLSQSFDDIKLESEMYASPRKIRNRSLILKISRESCPGSVKTDQHLACKQLPKKRSSYFVSQKVEPIVNSDHDRYNDFSENVVVVDEDQQQMKRLSSSLSIPFAELEKRPKLASINLDEPQKIIIEREIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQSKIRVAKKFNSEIFICSHCNWFNWKSMSVVSKHILEMHTGIDQSFILLVEASTKLDSDGQLLSDSELSKLGWNGKPILS
Sbjct:    1 MIKLLNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTEYEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTFNCLSIDDENKFSFVEDENILPKLDKENSFISINHDNDEIPDRNVSRINFVWQLHCRKDLFNSLYKNDDLEELSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTEKESRTSLRFIEFNKQSSKNLLNRRKSTSRINDNNYPVTRSESASFLLKLKLPSVKRKKSLLNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMRLVQVVDLQNGLVDNEETKESELIEDEDEEDEEEDVDEGEEPKEIESNNISNSVEVKKVKSKLSYMLKLFVRTDLYDEMFKNCSLEIAETLKHKLIPVNDYSIGVAVNKTKKTFYCQLCDYISNYSNWDVRKHILVWHCGINNTDSYKCTKLVEFKQEPIESNDEEDVEEESKIIEESLLTKEPLAKLTLDNKSVFKEKSIIDCFTKSEMVTPFISGTGKLVKMHYLKSELKKVFPIASDEFLKEIESKMENYKAYSLEVTYIKGVKYYVCVVCGYKSHYNQGDIKKHIMSKHCGISGNIVRDCIKLCKKDSLSQSFDDIKLESEMYASPRKIRNRSLILKISRESCPGSVKTDQHLACKQLPKKRSSYFVSQKVEPIVNSDHDRYNDFSENVVVVDEDQQQMKRLSSSLSIPFAELEKRPKLASINLDEPQKIIIEREIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQSKIRVAKKFNSEIFICSHCNWFNWKSMSVVSKHILEMHTGIDQSFILLVEASTKLDSDGQLLSDSELSKLGWNGKPILS 1015          
BLAST of SMED30033712 vs. Planmine SMEST
Match: SMESG000081028.1 (SMESG000081028.1)

HSP 1 Score: 216.083 bits (549), Expect = 5.133e-59
Identity = 139/451 (30.82%), Postives = 244/451 (54.10%), Query Frame = 2
Query:  107 KLLNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTEYEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTFNCLSIDDENKFSFVEDENILPKLDKENSFISINHDNDEIPDRNVSRINFVWQLHCRKDLFNSLYKNDDLEELSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTEKESRTSLRFIEFNKQSSKNLLNRRKSTSRINDNNYPVTRSESASFLLKLKLPSVKRKKSLLNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSI 1459
            + L+ N++L++I++ E + GK+ICP C TF T+SK  +EDHL  NH ++D++ CI C+   D+SK  SH E H +++LM  NICN CN   KMD +ES+L+HLL  HNN + CPLC I++++   L+ H+N +   ++HC+FE C + + +  E+ FHK  + H  D  F+E  FNCL   DEN+  F  D+N L  L+ E + + ++ ++  + ++   +  +V +L CR  LF  +  N  ++     +KKLF+ID Y I +  +  +  Y C  C Y  + SH ++KKHIL+ HC ++       L+    N +             + N N+  V          K K+ +++   S  +     + K + ++ + + +  + + F + + +  +  ++K+  + +  IG+   N K+ F+C+ C +I       V+ HIL  H ++
Sbjct:    4 RCLDKNTYLSRISILEQNTGKYICPTCVTFCTDSKAIFEDHLETNHKEFDKIVCICCSAVLDYSKYCSHFELHCQKDLMFHNICNFCNLYTKMDCRESVLEHLLLCHNNILCCPLCLIQFENELDLIKHVNNSFITIFHCSFENCFVVSTNINEIIFHKKTT-HDYDL-FDEIVFNCLPKIDENRLEF--DQN-LENLNCERNLLFLSGNSGNLSNK---KYLYVRRLKCRIKLFKEII-NSGIDLYETLKKKLFNIDKYDILVCADGLEIFYKCSLCKYLTKKSHSNIKKHILLHHCEISIAHIEMCLKVTYLNNK-------------KFNVNSENVDAE-------KPKVETIEISDSDQSIVENVEQKIDFLVNLEFLEKEYDRSFNEISLNYLIDTRKKMRKINRCPIGI-TENQKRLFFCMKCKFIE-NEISVVKHHILLCHLNV 423          

HSP 2 Score: 85.8853 bits (211), Expect = 1.016e-16
Identity = 109/495 (22.02%), Postives = 205/495 (41.41%), Query Frame = 2
Query: 1679 YMLKLFVRTDLYDEMFKNCSLEIAETLKHKLIPVNDYSIGVAVNKTKKTFYCQLCDYISNYSNWDVRKHILVWHCGINNTDSYKCTKLVEFKQXXXXXXXXXXXXXXXXXXXXXLLTKEPLAKLTLDNKSVFKEKSIIDCFTKSEMVTPFISGTGK----LVKMHYLKSELKKVFPIASDEFLKEIESKMENYKAYSLEVTYIXXXXXXXXXXXXXXSHYNQGDIKKHIMSKHCGISGNIVRDCIKLCKKDSLSQSFDDIKLESEMYASPRKIRNRSLILKISRESCPGSVKTDQHLACKQLPKKRSSYFVSQKVEPIVNSDHDRYNDFSENXXXXDEDQQQMKRLSSSLSIPFAELEKRP-KLASINLDEPQKIIIEREIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQ-SKIRVAKKFNSEIFICSHCNWFNWKSMSVVSKHILEMHTGIDQSFILLVEASTKLDSDGQLLSDSELSKLGWNGKPILS 3145
            Y+ +L  R  L+ E+  N  +++ ETLK KL  ++ Y I V  +  +  + C LC Y++  S+ +++KHIL+ HC I+      C K+                                  K  +++++V  EK  ++    S+     +    +    LV + +L+ E  + F   S  +L +   KM       + +T  +   ++       ++  +   +K HI+  H  +  N++      C  + + + +++ K+E+E         +++ + KI   S   ++ +D+ L  K   +K+S Y +   +E                         Q   + S+    F E  K P KL  +N  E                 +L+ LC  + I+ +F  +++ +  Y   S I      N   + CS+CN FN   +S +  HI   H GI + ++ ++   TK+DS+ +L+SD EL  L WNG+ I S
Sbjct:  219 YVRRLKCRIKLFKEII-NSGIDLYETLKKKLFNIDKYDILVCADGLEIFYKCSLCKYLTKKSHSNIKKHILLHHCEISIAHIEMCLKVTYLNN----------------------------KKFNVNSENVDAEKPKVETIEISDSDQSIVENVEQKIDFLVNLEFLEKEYDRSFNEISLNYLIDTRKKMRKINRCPIGITENQKRLFFCMKCKFIENEISV--VKHHILLCHLNVERNMIE-----CSLNFIKEFWNNNKVENEA--------DKTAVDKIP--SNKVNINSDKSLL-KDSNRKKSEYVIENTIET------------------------QFSLMDSN---NFREPCKSPVKLIDLNYSEY----------------VLKLLCELDGIMFRFKDIQKYMTRYKMCSIITSTNDHNKSYYQCSNCN-FNSDILSTILNHIWLDHVGISERYLTMLRVCTKMDSNNKLMSDEELVNLKWNGQTIKS 622          
BLAST of SMED30033712 vs. Planmine SMEST
Match: SMESG000062598.1 (SMESG000062598.1)

HSP 1 Score: 122.479 bits (306), Expect = 4.688e-28
Identity = 109/477 (22.85%), Postives = 201/477 (42.14%), Query Frame = 2
Query:  260 VSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTFNC-------LSIDD----ENKFSFVEDENILPKLDKENSFISINHDNDEIPDRNVSRI---------------NFVWQLHCRKDLFNSLYKNDDLEEL---------------------SNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTEKESRTSLRFIEFNKQSSKNLLNRRKSTSRIND----NNYPVTRSESAS---FLLKLKLPSVKRKKS----------LLNQTPCSKSK--FNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMRL 1492
            + C  C++    S +  H   H     +S + C  CN  +  ++ E IL+H+++ H     CPLC+ EY  ++ L  H+ ++ K+++HC ++ C  KT+   EL  HK    H+    F E  + C       LS D+    E      E ++++ +++      S+  +N   P  + SR+                F   L    +L  +L  N+D++ +                      +F+ KL  + LY + II + + K + C  C Y  ++SH D+K+H+  +HC ++ K     ++   ++  SS  LL  R     IN     NN    R  S S    + K+  P    K            L+N++P + +   +  +    Y   +  ++   A       F  K+  + ++ + V   N  K + C +C Y+S +SH D+++HI   HC I N +    +++
Sbjct:   17 IMCSICSLDIPTSSMIQHSSVHLSHKGLSADNCLFCNEVISTNNIEDILEHMIYAHEMKSNCPLCKSEYLTMDDLYHHLRKSYKVIHHCCYQDCTFKTDKMRELLKHKKQKRHMKKLTFTESVYGCKYVKVDVLSSDELDFPELPVEIKESKDVINEVELHLELKSV--ENQLNPRNSNSRLKRKSKIFDPSPEPIKRFKSDLRKSINLDFTLNSNEDIKSIVFTYSETVFEKYVAVSNPTITEDFKTKLSKLSLYPMLIISDEKGKNFICNFCKYESRHSHTDIKRHVFRNHCDISNKNIPLMMKIARYD--SSMKLLPDRDLIRFINSDIKMNNLSAHRLISCSDDENVEKISTPQKNFKSKSRISKGDMIKLINESPVTNNTTIYKDLFYFSYSYRVLMKYIAIAKPKPIDNFVEKLEGLSKFPMSVCTRNKVKNYTCENCEYLSVHSHTDIKRHIFRNHCDILNANMSSILKV 489          

HSP 2 Score: 96.6709 bits (239), Expect = 5.255e-20
Identity = 124/486 (25.51%), Postives = 202/486 (41.56%), Query Frame = 2
Query: 1745 IAETLKHKLIPVNDYSIGVAVNKTKKTFYCQLCDYISNYSNWDVRKHILVWHCGINNTDSYKCTKLVEFKQXXXXXXXXXXXXXXXXXXXXXLLTK---------EPLAKLTLDNKSVFKEKSIIDCFTKSEMV-----TPFISGTG---KLVKMHYLKSELKKVFPIASDEFLKEIESKMENYKAYSLEVTYIXXXXXXXXXXXXXXSHYNQGDIKKHIMSKHCGISGNIVRDCIKLCKKDSLSQSFDDIKLESEMYASPRKIRNRSLILKISRESCPGSVKTDQHLACKQLPKKRSSYFVSQKVEPIVNSDHDRYNDFSENXXXXDEDQQQMKRLSSSLSIPFAELEKRPKLASINLDEPQKIIIEREIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQSKIRVAKKFNSEIFICSHCNWFNWKSMSVVSKHILEMHTGIDQS--FI-LLVEASTKLDSDGQLLSDSELSKLGWNGKPIL 3142
            I E  K KL  ++ Y + +  ++  K F C  C Y S +S+ D+++H+   HC I+N +     K+  +        D + +   +  I+ + L+          E + K++   K+ FK KS I   +K +M+     +P  + T     L    Y    L K   IA  + +     K+E    + + V     VK Y C  C Y S ++  DIK+HI   HC I                                      N S ILK+SR S    + +D  L                    I+N++         + ++ D D + M      L  P  + EK  + + +NL       I R+I  +YS NIL+ +C  E  L  F  +K K+  +    +    + NS+I++C +CNW++  S+  V +H L  H  ++    F+  +VE S K++ D  LLSD E+SK GW G+ IL
Sbjct:  256 ITEDFKTKLSKLSLYPMLIISDEKGKNFICNFCKYESRHSHTDIKRHVFRNHCDISNKNIPLMMKIARYDSSMKLLPDRDLIRFINSDIKMNNLSAHRLISCSDDENVEKISTPQKN-FKSKSRI---SKGDMIKLINESPVTNNTTIYKDLFYFSYSYRVLMKYIAIAKPKPIDNFVEKLEGLSKFPMSVCTRNKVKNYTCENCEYLSVHSHTDIKRHIFRNHCDILN-----------------------------------ANMSSILKVSRTSSNMQLLSDSELI------------------RIINNEIS-MKKIDADELLTDSDDESM------LDWPAQKTEKSFEKSRLNL-------ISRKI-FKYSINILKAICYKENFLEHFERLKSKMDVFSTCGVETYYRNNSKIYMCLNCNWYSKISVDEVLRHALNYHAHLENETKFVKKIVETSYKMNKDYCLLSDDEISKKGWKGRIIL 669          

HSP 3 Score: 64.3142 bits (155), Expect = 5.929e-10
Identity = 58/221 (26.24%), Postives = 95/221 (42.99%), Query Frame = 2
Query:  845 LSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTE-------KESRTSLRFIEFNKQSSKNLLNRRKSTSRINDNNYPVTRSESASFLLKLKLPSVKRKKSL------LNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNK 1468
            + NF +KL  +  + + +   ++ K Y C  C+Y   +SH D+K+HI  +HC +         K SRTS      +      ++N   S  +I D +  +T S+  S L     P+ K +KS       L      K   N +  I Y+++    F R          K K+       +     NN K + CL+CN+ S  S  +V +H LN+H  + N+
Sbjct:  425 IDNFVEKLEGLSKFPMSVCTRNKVKNYTCENCEYLSVHSHTDIKRHIFRNHCDILNANMSSILKVSRTSSNMQLLSDSELIRIINNEISMKKI-DADELLTDSDDESML---DWPAQKTEKSFEKSRLNLISRKIFKYSINILKAICYKENFLEHFER---------LKSKMDVFSTCGVETYYRNNSKIYMCLNCNWYSKISVDEVLRHALNYHAHLENE 632          

HSP 4 Score: 55.8398 bits (133), Expect = 2.065e-7
Identity = 47/164 (28.66%), Postives = 77/164 (46.95%), Query Frame = 2
Query: 1013 KESRTSLRFIEFNKQ--SSKNLLNRRKSTSRINDNNYPVTRSESASFLLKLKLPSVKRKKSLLNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMRLVQ 1498
            KES+  +  +E + +  S +N LN R S SR+   +     S       K  L    RK   L+ T  S     SI+   Y + +F ++   +N +    FK K+S +  Y + ++     K F C  C Y S +SH D+++H+   HC ISNK+    M++ +
Sbjct:  165 KESKDVINEVELHLELKSVENQLNPRNSNSRLKRKSKIFDPSPEPIKRFKSDL----RKSINLDFTLNSNEDIKSIV-FTYSETVFEKYVAVSNPTITEDFKTKLSKLSLYPMLIISDEKGKNFICNFCKYESRHSHTDIKRHVFRNHCDISNKNIPLMMKIAR 323          
BLAST of SMED30033712 vs. Planmine SMEST
Match: SMESG000075452.1 (SMESG000075452.1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.234e-16
Identity = 111/512 (21.68%), Postives = 201/512 (39.26%), Query Frame = 2
Query:  137 KIAVQEASLGKFICPKC---------STFFTNSKTEYEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNN-AIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTNDNEELNFHKNVSGHISDSCFEEHTFNCLSIDDENKFSFVEDENILPKLDK-ENSFISINHDNDE------IP--DRNVSRINFVWQLHCRKDLFNSLYKNDDLEELSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTEKESRTSLR----------------FIEFNKQSSKNL-------LNRRKSTSRINDNNYPVTRSESASFLLKLK--------LPSVKRKKSLLNQTPCSK-----------------SKFNSILKIRYRKDLFGQFFRDANSSSAVA-FKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNK 1468
            KI++ E     F+C  C           F T++ + + +H R  H   ++  C+YC        +  HI++HF ++     +C  C + +K++   +I DH+   H +    CP C+ ++ D   LL H  ++   ++HC+FE C +K+++   +  H     H    C +     CL I    + SF    N L  L +   S + IN  + +      +P   R +S+++  +    R+DL         + + S F+ +L  +D           +K + C  C Y   +S  DV+KHIL  HCS++   +R  LR                 I F  +  K          N   S  ++ D++ P   S   +    +K        + S+KR K    Q+  +K                  K + ++ + Y   +  +          +   ++K+     + I +   N K+ F C  C   S +   D+RKHIL  H  +  +
Sbjct:    6 KISILEKVNQMFVCSICCDNKSGSNPKPFATSNPSLFLEHHRCCHPSINEFECVYCCSHLPSVNLMQHIQNHFTDSASPRYVCPHCCSRIKININSTI-DHMELDHPDLPFDCPHCRNQFSDRTDLLTHFKKHFLCIFHCSFENCFVKSHNMIGVLAHMK-RMHNGSRCMK---VECL-ITCTERISFKSQCNCLASLQQSPQSPMKINSPSVDDCQMIALPYSTRVLSKLSSGFDERLREDL------TCKMAQYSKFKVRLEIVD----------GQKQFVCSTCQYRSVHSLADVRKHILGCHCSVSTSYTRLCLRASRLDTNTFSLFSDRKLISFANEKLKRAESGTGWDANGDTSAMQLLDDSEPEQESPIDTISRPIKRVAISSGAVGSIKRAKLTQRQSHSAKMRPDSPVPEVGQPLERNEKIDRVIHLNYSWHVLERLVAGQCPERYLPILQQKMDVYALHRILLTRRNGKRYFLCSHCPNCSPHGMNDIRKHILGVHARLPER 495          

HSP 2 Score: 57.7658 bits (138), Expect = 5.427e-8
Identity = 32/109 (29.36%), Postives = 57/109 (52.29%), Query Frame = 2
Query: 2792 IEREIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQSKIRVAKKFNSEIFICSHCNWFNWKSMSVVSKHILEMHTGIDQSFILLVEASTKLDSDG-QLLSDSELSK 3115
            I+R I L YS ++L +L   +      P++++K+  Y   +I + ++     F+CSHC   +   M+ + KHIL +H  + + F       ++++ D   LLSD EL K
Sbjct:  413 IDRVIHLNYSWHVLERLVAGQCPERYLPILQQKMDVYALHRILLTRRNGKRYFLCSHCPNCSPHGMNDIRKHILGVHARLPERFKAAAMYCSRMNRDNYGLLSDDELLK 521          

HSP 3 Score: 52.7582 bits (125), Expect = 1.901e-6
Identity = 30/110 (27.27%), Postives = 52/110 (47.27%), Query Frame = 2
Query: 1193 LNQTPCSKSKFNS-------ILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMRLVQV 1501
            L Q+P S  K NS       ++ + Y   +  +     +         K++   ++ + + + + +K F C +C Y S +S  DVRKHIL  HCS+S    R C+R  ++
Sbjct:  197 LQQSPQSPMKINSPSVDDCQMIALPYSTRVLSKLSSGFDERLREDLTCKMAQYSKFKVRLEIVDGQKQFVCSTCQYRSVHSLADVRKHILGCHCSVSTSYTRLCLRASRL 306          
BLAST of SMED30033712 vs. Planmine SMEST
Match: SMESG000016820.1 (SMESG000016820.1)

HSP 1 Score: 77.411 bits (189), Expect = 6.547e-14
Identity = 52/179 (29.05%), Postives = 87/179 (48.60%), Query Frame = 2
Query:  110 LLNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTEYEDHLRENHIDYDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQESILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMKTN--DNEELNFHKNVSGHISDSCFEEHTFNCL 640
            +L    + +K+ + E SL K++C  CS F TN   E+  H  E H +   ++C+YC  +   ++  SH++ H      S   C +CN + K+   ESI  H    H++   CP+C  E+       +HI  +++ +YHC  + C + ++  DN   +F  N      DS  EE   +CL
Sbjct:    1 MLEPIRYYSKVQLLENSL-KYVCTFCSKFSTNRPEEFLKHCAEFHEEIRMINCVYCCQNVIITQYVSHVDQHVSFMGRSKFFCLICNNSFKLTKTESITAHNSIFHDHKNQCPVCLAEFAGTADFCNHIEGSVETLYHCGNKKCLVMSHNKDNFLQHFKNNYQICNKDSITEELVISCL 178          

HSP 2 Score: 50.8322 bits (120), Expect = 9.242e-6
Identity = 62/297 (20.88%), Postives = 114/297 (38.38%), Query Frame = 2
Query:  785 QLHCRKDLFNSLYKNDDLEELSNFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHCSMTE------------KESRTSLRFIEFNKQSSKNLLNRRKSTSRI-------NDNNYPVTRS---ESASFLLKLKL--------------------PSV---------KRKKSLLNQ-------TPCSKSKFN----SILKIRYRKDLFGQFFRDANSSSAVAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFHCSISNKDARRCMR 1489
            QL   + +F  L +N   ++ SN   K+     +++      EK L+ C +C Y   +S    +KHI   HC + +               +  +R I F KQ        +KS + +       ++ N  +++S    + + L K+ L                    P V           K S++NQ         CS+S+ +    S+L++ Y + +F +  R  +         K+   ++ ++      +KK + C  C Y + +S   +RKHI   HC I +     CM+
Sbjct:  414 QLKYSERVFRKLLRNLPEKDFSNLNNKMKIFAKFTLTTKWVGEKMLFMCPKCSYKTTHSLDHTRKHIFRIHCKIPKIYLINSMQASSLLSEKKMIRHINFYKQKMG-----KKSGAHVELLSDSEDEENSKISKSIVYGTPAKLRKIDLSNGISGISKNSIADIGTDVEPKVVLKPIDSCTPSKPSIVNQHVETNSLPSCSESELDTSNASVLQLTYSERVFRKLLRKLSEEDFSEIHNKMKIYKECTLSTACVGDKKFYICNQCKYKTNHSPDRIRKHIFRMHCGIPSIYLTACMQ 705          
The following BLAST results are available for this feature:
BLAST of SMED30033712 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A0X3NME32.496e-626.26Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183SYX32.562e-626.26Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of SMED30033712 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033712 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081020.10.000e+0100.00SMESG000081020.1[more]
SMESG000081028.15.133e-5930.82SMESG000081028.1[more]
SMESG000062598.14.688e-2822.85SMESG000062598.1[more]
SMESG000075452.16.234e-1621.68SMESG000075452.1[more]
SMESG000016820.16.547e-1429.05SMESG000016820.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033712 ID=SMED30033712|Name=SMED30033712|organism=Schmidtea mediterranea sexual|type=transcript|length=4130bp
TTAAGTTTCAAAATTGTATTTAATAAAGTTAGTTTTTGAATAACTATTTA
AGAAAAAGTGGCTATTTTTATATTTTGTTCTTTTAATTTTTACATTGGAA
ATGATAAAATTATTAAATACCAATTCATTTTTAAATAAAATAGCTGTACA
AGAAGCAAGTTTAGGAAAATTCATTTGCCCTAAGTGTTCTACATTTTTCA
CAAATTCCAAAACAGAATATGAAGACCATCTCCGTGAAAATCATATTGAT
TACGACCAAGTGAGTTGTATTTATTGTGCAGTTAGTTTCGACTTCTCTAA
AATATCCAGTCACATTGAATCTCATTTCGAAGAAAATTTAATGTCAACAA
ACATTTGTAATCTATGTAATACTGCTGTAAAGATGGATAGCCAAGAATCC
ATTTTAGATCATTTGCTGTTTCAACATAATAATGCAATTATTTGTCCTCT
ATGTCAAATTGAATATGATGATATTAACCATTTGCTTGATCATATAAATG
AAAATTTGAAAATTGTGTATCATTGTACATTTGAAGGATGTCAAATGAAA
ACTAATGACAATGAAGAATTGAATTTCCATAAGAATGTATCTGGTCATAT
AAGTGATTCGTGTTTTGAAGAACACACGTTTAATTGTCTTTCAATAGATG
ATGAAAACAAATTCAGTTTTGTCGAAGACGAAAACATTTTACCGAAATTA
GACAAAGAAAACAGTTTTATTAGTATTAACCATGATAACGACGAAATTCC
TGACAGAAATGTGTCAAGAATCAATTTTGTTTGGCAACTTCATTGCCGCA
AGGATTTATTTAATTCTTTATACAAAAATGACGATTTGGAAGAATTATCA
AATTTCCAAAAAAAATTATTTTCTATTGATCTCTATTCTATTGGAATTAT
TTTAGAAAGTGAAAAAAAATTATATTGCTGCCTGGAGTGTGATTATGCTC
CCCAATATTCTCACTGGGATGTCAAAAAACATATTTTAGTCTCTCATTGT
TCAATGACGGAAAAGGAATCACGAACGAGTTTGCGTTTCATTGAATTCAA
TAAGCAATCATCGAAAAATTTATTAAATCGACGAAAATCAACTTCTCGAA
TCAATGATAACAATTATCCGGTAACTCGGTCCGAATCAGCAAGTTTCCTT
CTGAAGTTGAAACTACCATCGGTAAAACGAAAAAAATCACTCCTTAATCA
AACGCCCTGTTCGAAATCCAAATTCAATTCAATTCTAAAAATTCGCTATC
GTAAGGATTTATTTGGCCAATTCTTCAGAGACGCCAATTCATCTTCAGCT
GTTGCATTCAAAAGAAAAATCAGTTCAGTTGAACAATATTCTATAGGAGT
TATGGTAACGAATAACAAAAAGGCATTTTATTGTTTAAGTTGCAACTATA
TCTCGTATTATTCTCATGGAGATGTTAGGAAGCACATTTTGAATTTCCAT
TGTTCGATATCAAATAAAGATGCTAGGCGATGTATGCGATTAGTTCAAGT
CGTCGATTTGCAGAATGGATTGGTGGACAATGAGGAGACAAAGGAATCGG
AACTGATTGAAGATGAGGATGAAGAAGATGAAGAAGAAGACGTCGATGAA
GGTGAGGAACCTAAGGAAATCGAATCAAATAATATATCGAATTCAGTTGA
AGTTAAAAAAGTCAAATCAAAATTATCCTACATGTTAAAGTTATTCGTTC
GAACGGATTTATACGACGAAATGTTCAAAAATTGCTCTCTGGAAATTGCC
GAAACCTTAAAACACAAACTGATTCCAGTGAACGATTATTCAATCGGTGT
AGCAGTAAACAAAACGAAAAAAACATTCTACTGTCAACTCTGTGATTACA
TTTCCAATTATTCAAATTGGGATGTCAGGAAGCATATTTTAGTTTGGCAT
TGTGGAATCAACAACACCGACTCGTACAAGTGCACAAAACTCGTTGAATT
CAAACAAGAGCCAATTGAATCGAACGATGAAGAGGATGTGGAAGAGGAAA
GTAAAATTATCGAAGAATCATTGTTAACCAAAGAACCTTTGGCAAAACTA
ACTCTGGATAATAAATCGGTTTTCAAAGAAAAGTCAATAATCGATTGTTT
CACAAAATCTGAAATGGTGACGCCATTCATTTCCGGTACGGGAAAATTAG
TCAAAATGCACTATTTGAAATCGGAATTGAAAAAAGTTTTCCCAATTGCC
AGCGATGAATTCCTGAAAGAAATAGAAAGTAAAATGGAAAATTACAAAGC
ATATTCACTGGAAGTTACGTATATCAAAGGAGTGAAATATTACGTATGCG
TCGTCTGTGGATATAAATCTCACTACAATCAAGGAGACATCAAAAAACAT
ATCATGTCGAAACATTGTGGAATTTCGGGCAATATCGTCCGGGATTGTAT
AAAGCTTTGCAAAAAGGATTCTCTGAGTCAAAGTTTCGATGACATCAAAC
TAGAATCGGAAATGTATGCGTCACCGAGAAAAATCAGAAACCGAAGTTTG
ATTTTAAAAATCAGTCGAGAAAGCTGTCCGGGATCCGTTAAAACTGATCA
GCATTTGGCTTGTAAGCAATTACCGAAAAAGCGGAGTTCATATTTCGTTA
GTCAAAAAGTAGAACCAATCGTGAACTCGGACCACGACAGATACAATGAT
TTCAGTGAAAACGTAGTCGTTGTCGATGAAGACCAACAACAAATGAAACG
GTTGTCGTCGTCATTGTCGATTCCGTTTGCTGAACTCGAAAAAAGACCGA
AATTGGCATCAATTAATTTAGACGAGCCTCAGAAAATTATCATTGAACGT
GAAATTGGGCTTCGTTATTCGGAAAATATCCTCAGAAAACTTTGCACTGC
TGAGAAAATTCTCGGACAATTTCCACTGATGAAGGAAAAATTGAAAGCAT
ATTGTCAGAGCAAAATTAGAGTGGCTAAAAAATTCAATTCCGAAATTTTT
ATTTGTTCTCATTGTAATTGGTTCAATTGGAAATCAATGTCTGTGGTAAG
CAAACACATCCTTGAGATGCACACCGGTATCGATCAAAGCTTTATCTTAT
TGGTGGAAGCCAGCACAAAATTGGACAGTGACGGCCAGTTGTTGTCGGAC
AGTGAACTGAGCAAATTAGGCTGGAATGGTAAACCAATTCTTTCCTAATA
GCAACTTTTTATATGATGTTTTTAAATTCGTAATCTTCGAATTTGGTAGA
AATTTGTAAATATTTTTATTATTAAAGTAGAAATGTACAGCTCTATTGAT
TTTCTATTGAAATTGAATTTAAATAATGCAATCAATAATTATTTTCAGTT
AATAATTATGTGAATAATCTGTCGACAATGTTGAGTGTAGCTCAATTTGT
AATTAAATGAAGATAATGTATGTCTTGTGAATGGAAAACGGTTTAATAAA
TTAATTGCGCGTAATTCGTTATTAATTTTGCTTTGGAAATTCTCGATCTT
TCATTGGAATGGTTATTGATTTTGAAAATTTGTCTGGAAATCTCTTCTTT
TTATTGCTGTATTTTTATCGTGTGATATCAGAATTTGTGAAATTGTTATT
TGTAAGTAATTGCAACAAAATGTTTGTTCTTAGCTCAGTTAATTGTTCAA
TTGAAGGTTTTAGAAAAAGAATTATAAGCGAATTTATAGGTTTCAATGTA
AGTGGTTGTATCAATTTATAGGAACAAGTGCTGATTTTTATATTGAATCT
TCGTGTTCGAGGGTTATATTACTTTTATCCTTGAAAAATTGAGTGTCAAA
ATTATTCAAAAAATACAAACCACTTAAACTGCTGATGTTATGAGGTAAAT
ATTTAGGTTATCTAACTGCATTTTGAAAAATAACCTGCAACATATATTAA
GTATCATTTATCCCGGAACTAGGATTATTTTCCTTTGGATTAAATTTAAT
CCAAACTGAGTATTCAGTAAATCAGCAATGTTGAAACATTAAAATAGTTG
GTAATTTGCCTCAGCTAGGGGCGCAAAAACTCGAGACTAGGATATTGGGG
CGACAGAAATTTGTTAAAATAGGGAATCAAAGAAATATTAAATGAATTCG
TTAGCAGAAAAATCAAACTTTTAAAGCTAATTATTTTGAAAAGTGCTTGA
AACCAAATGCTCGCAACGGAACTTGTCAAT
back to top

protein sequence of SMED30033712-orf-1

>SMED30033712-orf-1 ID=SMED30033712-orf-1|Name=SMED30033712-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1016bp
MIKLLNTNSFLNKIAVQEASLGKFICPKCSTFFTNSKTEYEDHLRENHID
YDQVSCIYCAVSFDFSKISSHIESHFEENLMSTNICNLCNTAVKMDSQES
ILDHLLFQHNNAIICPLCQIEYDDINHLLDHINENLKIVYHCTFEGCQMK
TNDNEELNFHKNVSGHISDSCFEEHTFNCLSIDDENKFSFVEDENILPKL
DKENSFISINHDNDEIPDRNVSRINFVWQLHCRKDLFNSLYKNDDLEELS
NFQKKLFSIDLYSIGIILESEKKLYCCLECDYAPQYSHWDVKKHILVSHC
SMTEKESRTSLRFIEFNKQSSKNLLNRRKSTSRINDNNYPVTRSESASFL
LKLKLPSVKRKKSLLNQTPCSKSKFNSILKIRYRKDLFGQFFRDANSSSA
VAFKRKISSVEQYSIGVMVTNNKKAFYCLSCNYISYYSHGDVRKHILNFH
CSISNKDARRCMRLVQVVDLQNGLVDNEETKESELIEDEDEEDEEEDVDE
GEEPKEIESNNISNSVEVKKVKSKLSYMLKLFVRTDLYDEMFKNCSLEIA
ETLKHKLIPVNDYSIGVAVNKTKKTFYCQLCDYISNYSNWDVRKHILVWH
CGINNTDSYKCTKLVEFKQEPIESNDEEDVEEESKIIEESLLTKEPLAKL
TLDNKSVFKEKSIIDCFTKSEMVTPFISGTGKLVKMHYLKSELKKVFPIA
SDEFLKEIESKMENYKAYSLEVTYIKGVKYYVCVVCGYKSHYNQGDIKKH
IMSKHCGISGNIVRDCIKLCKKDSLSQSFDDIKLESEMYASPRKIRNRSL
ILKISRESCPGSVKTDQHLACKQLPKKRSSYFVSQKVEPIVNSDHDRYND
FSENVVVVDEDQQQMKRLSSSLSIPFAELEKRPKLASINLDEPQKIIIER
EIGLRYSENILRKLCTAEKILGQFPLMKEKLKAYCQSKIRVAKKFNSEIF
ICSHCNWFNWKSMSVVSKHILEMHTGIDQSFILLVEASTKLDSDGQLLSD
SELSKLGWNGKPILS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR015880Znf_C2H2-like
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 113..133
e-value: 140.0
score: 3.2
coord: 54..75
e-value: 170.0
score: 2.4
coord: 84..109
e-value: 66.0
score: 6.0
coord: 275..299
e-value: 190.0
score: 1.9
coord: 576..600
e-value: 280.0
score: 0.5
coord: 140..166
e-value: 5.7
score: 15.4
coord: 950..974
e-value: 59.0
score: 6.4
coord: 731..755
e-value: 4.1
score: 16.4
coord: 24..48
e-value: 0.72
score: 18.9
coord: 426..450
e-value: 44.0
score: 7.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 479..510
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 481..504
NoneNo IPR availablePANTHERPTHR24409FAMILY NOT NAMEDcoord: 23..757