chromobox protein homolog 1

Overview
Namechromobox protein homolog 1
Smed IDSMED30033701
Length (bp)1120
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of chromobox protein homolog 1 (SMED30033701) t-SNE clustered cells

Violin plots show distribution of expression levels for chromobox protein homolog 1 (SMED30033701) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of chromobox protein homolog 1 (SMED30033701) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for chromobox protein homolog 1 (SMED30033701) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033701

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30033701SMESG000055314.1 SMESG000054375.1 JN216839smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30033701SMESG000055314.1 SMESG000054375.1 SmedASXL_009807SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v4_4855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033701SMESG000055315.1 SMESG000054374.1 Contig137uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033701SMESG000055315.1 SMESG000054374.1 Contig137newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033701SMESG000052937.1 SMESG000027765.1 Contig137uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033701SMESG000052937.1 SMESG000027765.1 Contig137newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory systemSMED30033701SMESG000055315.1 SMESG000055314.1 SMESG000054375.1 SMESG000054374.1 dd_Smed_v6_4855_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033701SMESG000055314.1 SMESG000054375.1 SMED_09295_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30033701SMESG000055314.1 SMESG000054375.1 SMED_09295_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of chromobox protein homolog 1 vs. Ensembl Human
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 72.4034 bits (176), Expect = 7.364e-20
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  112 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 170          

HSP 2 Score: 44.669 bits (104), Expect = 7.364e-20
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQ 242
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K    T 
Sbjct:   34 GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETD 78          
BLAST of chromobox protein homolog 1 vs. Ensembl Human
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 72.4034 bits (176), Expect = 7.589e-20
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  112 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 170          

HSP 2 Score: 44.669 bits (104), Expect = 7.589e-20
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQ 242
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K    T 
Sbjct:   34 GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETD 78          
BLAST of chromobox protein homolog 1 vs. Ensembl Human
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 72.4034 bits (176), Expect = 7.589e-20
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  112 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 170          

HSP 2 Score: 44.669 bits (104), Expect = 7.589e-20
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQ 242
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K    T 
Sbjct:   34 GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETD 78          
BLAST of chromobox protein homolog 1 vs. Ensembl Human
Match: CBX3 (chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553])

HSP 1 Score: 67.781 bits (164), Expect = 1.564e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 1.564e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. Ensembl Human
Match: CBX3 (chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553])

HSP 1 Score: 67.781 bits (164), Expect = 1.564e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 1.564e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. Ensembl Fly
Match: HP1b (gene:FBgn0030082 transcript:FBtr0071284)

HSP 1 Score: 67.0106 bits (162), Expect = 1.104e-20
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF+RGL+   I G T  +  + F++KW G D  D+VPA  AN +CPQ+VI+FYE   ++
Sbjct:   94 GFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTW 152          

HSP 2 Score: 51.9878 bits (123), Expect = 1.104e-20
Identity = 32/89 (35.96%), Postives = 46/89 (51.69%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK-----LKEFTQNFQLPMTIKVPVRIGFLLNATFYYYRLL 326
            VE++      NG+  Y LKWK Y  S N+WEP E+L+C  LI NF ++LK      K+       P +I+   R  FL + T    +L+
Sbjct:    6 VERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTSSTPESIRS-KRKSFLEDDTEEQKKLI 93          
BLAST of chromobox protein homolog 1 vs. Ensembl Fly
Match: HP1b (gene:FBgn0030082 transcript:FBtr0309871)

HSP 1 Score: 67.0106 bits (162), Expect = 1.104e-20
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF+RGL+   I G T  +  + F++KW G D  D+VPA  AN +CPQ+VI+FYE   ++
Sbjct:   94 GFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTW 152          

HSP 2 Score: 51.9878 bits (123), Expect = 1.104e-20
Identity = 32/89 (35.96%), Postives = 46/89 (51.69%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK-----LKEFTQNFQLPMTIKVPVRIGFLLNATFYYYRLL 326
            VE++      NG+  Y LKWK Y  S N+WEP E+L+C  LI NF ++LK      K+       P +I+   R  FL + T    +L+
Sbjct:    6 VERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTSSTPESIRS-KRKSFLEDDTEEQKKLI 93          
BLAST of chromobox protein homolog 1 vs. Ensembl Fly
Match: HP1b (gene:FBgn0030082 transcript:FBtr0301805)

HSP 1 Score: 67.0106 bits (162), Expect = 1.104e-20
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF+RGL+   I G T  +  + F++KW G D  D+VPA  AN +CPQ+VI+FYE   ++
Sbjct:   94 GFERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTW 152          

HSP 2 Score: 51.9878 bits (123), Expect = 1.104e-20
Identity = 32/89 (35.96%), Postives = 46/89 (51.69%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK-----LKEFTQNFQLPMTIKVPVRIGFLLNATFYYYRLL 326
            VE++      NG+  Y LKWK Y  S N+WEP E+L+C  LI NF ++LK      K+       P +I+   R  FL + T    +L+
Sbjct:    6 VERVEDKRTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTSSTPESIRS-KRKSFLEDDTEEQKKLI 93          
BLAST of chromobox protein homolog 1 vs. Ensembl Fly
Match: HP6 (gene:FBgn0031613 transcript:FBtr0077444)

HSP 1 Score: 65.4698 bits (158), Expect = 4.751e-13
Identity = 28/61 (45.90%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            GFD GL+P  I G    +  + F+++W GCDE  +VPA   NV+CPQ+VI FYE    F +
Sbjct:   19 GFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVFTD 79          
BLAST of chromobox protein homolog 1 vs. Ensembl Fly
Match: HP1e (gene:FBgn0037675 transcript:FBtr0082016)

HSP 1 Score: 45.8246 bits (107), Expect = 2.336e-10
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  344 FDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            F+ G   Q I    K N  I F+I++   D+  VVP+  A V+ PQ+V++FYEN+ +F +
Sbjct:  108 FNHGFTAQEILKGAKNNGEISFLIRFWHLDQPQVVPSGIAYVEIPQMVLKFYENHCNFHD 167          

HSP 2 Score: 38.5058 bits (88), Expect = 2.336e-10
Identity = 18/52 (34.62%), Postives = 28/52 (53.85%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLK 230
            VE+I+   +  G+  YL+KW +Y    N+WE    L+C +LI +      LK
Sbjct:   29 VERILDRRHYMGQLQYLVKWLDYSDEDNTWESAADLDCHSLIDSIESQKSLK 80          
BLAST of chromobox protein homolog 1 vs. Ensembl Zebrafish
Match: cbx1b (chromobox homolog 1b (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040625-68])

HSP 1 Score: 72.0182 bits (175), Expect = 3.942e-20
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  130 GFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 188          

HSP 2 Score: 45.4394 bits (106), Expect = 3.942e-20
Identity = 20/42 (47.62%), Postives = 27/42 (64.29%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKE 233
            GK  YLLKWK +    N+WEP+E+L+C  LI  F ++ K  E
Sbjct:   61 GKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQKTAE 102          
BLAST of chromobox protein homolog 1 vs. Ensembl Zebrafish
Match: cbx1b (chromobox homolog 1b (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040625-68])

HSP 1 Score: 72.0182 bits (175), Expect = 3.942e-20
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  130 GFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 188          

HSP 2 Score: 45.4394 bits (106), Expect = 3.942e-20
Identity = 20/42 (47.62%), Postives = 27/42 (64.29%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKE 233
            GK  YLLKWK +    N+WEP+E+L+C  LI  F ++ K  E
Sbjct:   61 GKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQKTAE 102          
BLAST of chromobox protein homolog 1 vs. Ensembl Zebrafish
Match: cbx3a (chromobox homolog 3a (HP1 gamma homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-1158])

HSP 1 Score: 69.707 bits (169), Expect = 6.331e-20
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF R L+P+ I G T  +  + F++KW   DE D+VPA +AN +CPQ+VI FYE   ++
Sbjct:  103 DKPRGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFYEERLTW 165          

HSP 2 Score: 47.3654 bits (111), Expect = 6.331e-20
Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            VEK++     NGK  + LKWK +  + N+WEPEE+L+C  LI  F ++ K
Sbjct:   21 VEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPELIAAFLESQK 70          
BLAST of chromobox protein homolog 1 vs. Ensembl Zebrafish
Match: cbx3a (chromobox homolog 3a (HP1 gamma homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-1158])

HSP 1 Score: 69.707 bits (169), Expect = 6.431e-20
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF R L+P+ I G T  +  + F++KW   DE D+VPA +AN +CPQ+VI FYE   ++
Sbjct:  106 DKPRGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFYEERLTW 168          

HSP 2 Score: 47.3654 bits (111), Expect = 6.431e-20
Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            VEK++     NGK  + LKWK +  + N+WEPEE+L+C  LI  F ++ K
Sbjct:   24 VEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPELIAAFLESQK 73          
BLAST of chromobox protein homolog 1 vs. Ensembl Zebrafish
Match: cbx1a (chromobox homolog 1a (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-4945])

HSP 1 Score: 74.7146 bits (182), Expect = 1.173e-19
Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            +D   GF RGL P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  134 QDKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 197          

HSP 2 Score: 41.5874 bits (96), Expect = 1.173e-19
Identity = 16/34 (47.06%), Postives = 23/34 (67.65%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            G+  YLLKWK +    N+WEPE++L+C  LI  +
Sbjct:   63 GRVEYLLKWKGFSEEDNTWEPEDNLDCPDLIAEY 96          
BLAST of chromobox protein homolog 1 vs. Ensembl Xenopus
Match: stab2 (stabilin 2 [Source:Xenbase;Acc:XB-GENE-491156])

HSP 1 Score: 72.4034 bits (176), Expect = 3.864e-21
Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  117 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVPAKEANVKCPQVVIAFYEERLTW 179          

HSP 2 Score: 49.2914 bits (116), Expect = 3.864e-21
Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  S N+WEPEE+L+C  LI+ F
Sbjct:   36 VEKVLDRRVVNGKVEYYLKWKGFTDSDNTWEPEENLDCPELIEAF 80          
BLAST of chromobox protein homolog 1 vs. Ensembl Xenopus
Match: zbtb11 (zinc finger and BTB domain containing 11 [Source:Xenbase;Acc:XB-GENE-988913])

HSP 1 Score: 72.7886 bits (177), Expect = 5.184e-20
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  111 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 169          

HSP 2 Score: 45.0542 bits (105), Expect = 5.184e-20
Identity = 20/39 (51.28%), Postives = 26/39 (66.67%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K
Sbjct:   34 GKVEYLLKWKGFSDDDNTWEPEENLDCPDLIAEFLQSQK 72          
BLAST of chromobox protein homolog 1 vs. Ensembl Xenopus
Match: tnfaip6 (TNF alpha induced protein 6 [Source:Xenbase;Acc:XB-GENE-988687])

HSP 1 Score: 69.707 bits (169), Expect = 1.597e-18
Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D A GF+RGL+P+ I G T     + F++KW   DE D+V A +ANVKCPQ+VI FYE   ++
Sbjct:  121 DIARGFERGLEPEKIIGATDSCGELMFLMKWKDSDEADLVLAKEANVKCPQIVIAFYEERLTW 183          

HSP 2 Score: 43.1282 bits (100), Expect = 1.597e-18
Identity = 20/50 (40.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            VEK++      G+  +LLKWK +    N+WEP+ +L+C  LI  F K  K
Sbjct:   39 VEKVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNLDCPELISEFMKKYK 88          
BLAST of chromobox protein homolog 1 vs. Ensembl Xenopus
Match: ENSXETT00000037867.1 (chromodomain Y like [Source:NCBI gene;Acc:100491952])

HSP 1 Score: 50.0618 bits (118), Expect = 4.473e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 3
Query:   63 EVIEVEKII-AVSNRNGKRCYLLKWKNYDSSLNSWEPEEHL-NCGALIKNFHK 215
            E+ EVE+I+    N+ GK  YL+ WK YDS  ++WEPE+HL NC   I  F++
Sbjct:    5 ELYEVEQIVDKRKNKKGKIEYLVHWKGYDSGDDTWEPEQHLVNCEEYIHEFNR 57          
BLAST of chromobox protein homolog 1 vs. Ensembl Xenopus
Match: ENSXETT00000025504.1 (chromodomain Y like [Source:NCBI gene;Acc:100491952])

HSP 1 Score: 50.0618 bits (118), Expect = 4.504e-6
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 3
Query:   63 EVIEVEKII-AVSNRNGKRCYLLKWKNYDSSLNSWEPEEHL-NCGALIKNFHK 215
            E+ EVE+I+    N+ GK  YL+ WK YDS  ++WEPE+HL NC   I  F++
Sbjct:    5 ELYEVEQIVDKRKNKKGKIEYLVHWKGYDSGDDTWEPEQHLVNCEEYIHEFNR 57          
BLAST of chromobox protein homolog 1 vs. Ensembl Mouse
Match: Cbx1 (chromobox 1 [Source:MGI Symbol;Acc:MGI:105369])

HSP 1 Score: 72.4034 bits (176), Expect = 5.501e-20
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  112 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 170          

HSP 2 Score: 44.669 bits (104), Expect = 5.501e-20
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQ 242
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K    T 
Sbjct:   34 GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETD 78          
BLAST of chromobox protein homolog 1 vs. Ensembl Mouse
Match: Cbx3 (chromobox 3 [Source:MGI Symbol;Acc:MGI:108515])

HSP 1 Score: 67.781 bits (164), Expect = 1.133e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 1.133e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. Ensembl Mouse
Match: Cbx3 (chromobox 3 [Source:MGI Symbol;Acc:MGI:108515])

HSP 1 Score: 67.781 bits (164), Expect = 1.133e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 1.133e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. Ensembl Mouse
Match: Cbx3 (chromobox 3 [Source:MGI Symbol;Acc:MGI:108515])

HSP 1 Score: 67.781 bits (164), Expect = 1.133e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 1.133e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. Ensembl Mouse
Match: Cbx5 (chromobox 5 [Source:MGI Symbol;Acc:MGI:109372])

HSP 1 Score: 68.9366 bits (167), Expect = 2.129e-19
Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D A GF+RGL+P+ I G T     + F++KW   DE D+V A +ANVKCPQ+VI FYE   ++
Sbjct:  112 DIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTW 174          

HSP 2 Score: 46.2098 bits (108), Expect = 2.129e-19
Identity = 25/58 (43.10%), Postives = 34/58 (58.62%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNL-KLKEFTQN 245
            VEK++      G+  YLLKWK +    N+WEPE++L+C  LI  F K   K+KE   N
Sbjct:   22 VEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENN 79          
BLAST of chromobox protein homolog 1 vs. UniProt/SwissProt
Match: sp|P23198|CBX3_MOUSE (Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.647e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 50.0618 bits (118), Expect = 2.647e-19
Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI++F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDF 76          
BLAST of chromobox protein homolog 1 vs. UniProt/SwissProt
Match: sp|P83917|CBX1_MOUSE (Chromobox protein homolog 1 OS=Mus musculus OX=10090 GN=Cbx1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.302e-19
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  112 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 170          

HSP 2 Score: 44.669 bits (104), Expect = 3.302e-19
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQ 242
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K    T 
Sbjct:   34 GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETD 78          
BLAST of chromobox protein homolog 1 vs. UniProt/SwissProt
Match: sp|P83916|CBX1_HUMAN (Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.302e-19
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  112 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 170          

HSP 2 Score: 44.669 bits (104), Expect = 3.302e-19
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQ 242
            GK  YLLKWK +    N+WEPEE+L+C  LI  F ++ K    T 
Sbjct:   34 GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETD 78          
BLAST of chromobox protein homolog 1 vs. UniProt/SwissProt
Match: sp|Q5R6X7|CBX3_PONAB (Chromobox protein homolog 3 OS=Pongo abelii OX=9601 GN=CBX3 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.805e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 6.805e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. UniProt/SwissProt
Match: sp|Q13185|CBX3_HUMAN (Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4)

HSP 1 Score: 67.781 bits (164), Expect = 6.805e-19
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL P+ I G T  +  + F++KW   DE D+V A +AN+KCPQ+VI FYE   ++
Sbjct:  112 DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW 174          

HSP 2 Score: 48.521 bits (114), Expect = 6.805e-19
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            VEK++     NGK  Y LKWK +  + N+WEPEE+L+C  LI+ F
Sbjct:   32 VEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAF 76          
BLAST of chromobox protein homolog 1 vs. TrEMBL
Match: M9NNX2 (Heterochromatin protein 1-like protein 2 OS=Schmidtea mediterranea OX=79327 GN=HP1-2 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 5.740e-70
Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 3
Query:   57 MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPV 278
            MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVP+
Sbjct:    1 MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPI 74          

HSP 2 Score: 141.739 bits (356), Expect = 5.740e-70
Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE
Sbjct:   76 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 141          
BLAST of chromobox protein homolog 1 vs. TrEMBL
Match: A0A504YE48 (Chromobox protein 1 (Heterochromatin protein 1 beta) OS=Fasciola gigantica OX=46835 GN=FGIG_04052 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.434e-24
Identity = 41/64 (64.06%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFE 520
            D  YGFDRGL P  I  VTKK+D +YF+IKW G  E DVVPA QAN +CPQLVIRFYE+   F+
Sbjct:   78 DEPYGFDRGLAPDFISMVTKKDDELYFLIKWKGRQECDVVPAAQANTRCPQLVIRFYESILHFK 141          

HSP 2 Score: 52.7582 bits (125), Expect = 1.434e-24
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 3
Query:   69 IEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVP 275
             EVE+++ V + NGK  Y +KWK +   +N+WEP  +LNC +L+K F   L  + F++     +T++VP
Sbjct:   14 FEVEELVDVRHVNGKPEYFIKWKGHPPEMNTWEPYSNLNCPSLLKKF---LAQRSFSRQ----VTVEVP 75          
BLAST of chromobox protein homolog 1 vs. TrEMBL
Match: A0A4E0RD81 (Chromobox protein 1 (Heterochromatin protein 1 beta) OS=Fasciola hepatica OX=6192 GN=D915_004599 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.469e-24
Identity = 41/64 (64.06%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFE 520
            D  YGFDRGL P  I  VTKK+D +YF+IKW G  E DVVPA QAN +CPQLVIRFYE+   F+
Sbjct:   78 DEPYGFDRGLAPDFISMVTKKDDELYFLIKWKGRQECDVVPAAQANTRCPQLVIRFYESILHFK 141          

HSP 2 Score: 52.7582 bits (125), Expect = 1.469e-24
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 3
Query:   69 IEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVP 275
             EVE+++ V + NGK  Y +KWK +   +N+WEP  +LNC +L+K F   L  + F++     +T++VP
Sbjct:   14 FEVEELVDVRHVNGKPEYFIKWKGHPPEMNTWEPYSNLNCPSLLKKF---LAQRSFSRQ----VTVEVP 75          
BLAST of chromobox protein homolog 1 vs. TrEMBL
Match: J3JTC0 (Uncharacterized protein OS=Dendroctonus ponderosae OX=77166 GN=109533696 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.863e-24
Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 2
Query:  338 YGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            +GFDRGL+P+ I G T  +  + F++KW G DE D+VPA QANVKCPQ+VI+FYE   S+
Sbjct:  104 HGFDRGLQPEKIIGATNSSGPLLFLMKWVGTDEADLVPATQANVKCPQVVIKFYEERLSW 163          

HSP 2 Score: 60.077 bits (144), Expect = 1.863e-24
Identity = 28/57 (49.12%), Postives = 37/57 (64.91%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQN 245
            VEKII    +NG + YLLKW  YD   N+WEPE +L+C +LIK F  +  +KE  +N
Sbjct:   21 VEKIIDCRIKNGVKEYLLKWIGYDDKDNTWEPESNLDCPSLIKTFEADRAVKEAEKN 77          
BLAST of chromobox protein homolog 1 vs. TrEMBL
Match: A0A224YJX0 (Chromobox protein 3 OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.863e-24
Identity = 33/60 (55.00%), Postives = 42/60 (70.00%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFE 520
            GFDRGL P  I G T  +  + F+IKW  CDE D+VPA  ANV+CPQ+VIRFYE   +++
Sbjct:  108 GFDRGLDPDRIIGATDSSGELMFLIKWKDCDEADIVPARVANVRCPQVVIRFYEERLTWD 167          

HSP 2 Score: 63.929 bits (154), Expect = 3.863e-24
Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPVR 281
            VEKI+    R GK  YLLKWK Y  S N+WEPEE+L+C  LI  F +  K K  +Q+ ++      P R
Sbjct:   27 VEKILDRRVRQGKVEYLLKWKGYGDSENTWEPEENLDCPGLIAQFEEKRKQKAESQSTKMKDDADAPSR 95          
BLAST of chromobox protein homolog 1 vs. Ensembl Cavefish
Match: cbx1a (chromobox protein homolog 1-like [Source:NCBI gene;Acc:103037352])

HSP 1 Score: 71.633 bits (174), Expect = 1.284e-19
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            ++   GF RGL P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  134 QEKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 197          

HSP 2 Score: 44.2838 bits (103), Expect = 1.284e-19
Identity = 18/39 (46.15%), Postives = 26/39 (66.67%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            G+  +LLKWK +    N+WEPE++L+C  LI  F +N K
Sbjct:   63 GRTEFLLKWKGFTDEDNTWEPEDNLDCPDLIAEFMQNYK 101          
BLAST of chromobox protein homolog 1 vs. Ensembl Cavefish
Match: cbx1a (chromobox protein homolog 1-like [Source:NCBI gene;Acc:103037352])

HSP 1 Score: 71.633 bits (174), Expect = 1.284e-19
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            ++   GF RGL P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  134 QEKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 197          

HSP 2 Score: 44.2838 bits (103), Expect = 1.284e-19
Identity = 18/39 (46.15%), Postives = 26/39 (66.67%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            G+  +LLKWK +    N+WEPE++L+C  LI  F +N K
Sbjct:   63 GRTEFLLKWKGFTDEDNTWEPEDNLDCPDLIAEFMQNYK 101          
BLAST of chromobox protein homolog 1 vs. Ensembl Cavefish
Match: cbx5 (chromobox 5 [Source:NCBI gene;Acc:103047453])

HSP 1 Score: 67.781 bits (164), Expect = 1.356e-18
Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  335 AYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            A GF+RGL+P+ I G T     + F++KW   DE D+V A +AN KCPQ+VI FYE   ++ E
Sbjct:  124 ARGFERGLEPEKIIGATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIVIAFYEERLTWHE 186          

HSP 2 Score: 44.2838 bits (103), Expect = 1.356e-18
Identity = 21/50 (42.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            VEK++      G+  Y LKWK +    N+WEPE++L+C  LI  F K  K
Sbjct:   43 VEKVLDRRVVKGRVEYFLKWKGFTDKHNTWEPEKNLDCPDLISEFMKTYK 92          
BLAST of chromobox protein homolog 1 vs. Ensembl Cavefish
Match: cbx3a (chromobox protein homolog 3-like [Source:NCBI gene;Acc:103046426])

HSP 1 Score: 67.3958 bits (163), Expect = 2.379e-18
Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            +   GF R L+P+ I G T  +  + F++KW   DE D+VPA +AN +CPQ+VI FYE   ++
Sbjct:  107 EKPRGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQVVIAFYEERLTW 169          

HSP 2 Score: 44.2838 bits (103), Expect = 2.379e-18
Identity = 18/35 (51.43%), Postives = 24/35 (68.57%), Query Frame = 3
Query:  105 NGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            NGK  + LKWK +  + N+WEPEE+L+C  LI  F
Sbjct:   35 NGKVEFFLKWKGFPDTDNTWEPEENLDCPELISAF 69          
BLAST of chromobox protein homolog 1 vs. Ensembl Cavefish
Match: cbx3a (chromobox protein homolog 3-like [Source:NCBI gene;Acc:103046426])

HSP 1 Score: 67.0106 bits (162), Expect = 3.668e-18
Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            +   GF R L+P+ I G T  +  + F++KW   DE D+VPA +AN +CPQ+VI FYE   ++
Sbjct:  114 EKPRGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQVVIAFYEERLTW 176          

HSP 2 Score: 43.8986 bits (102), Expect = 3.668e-18
Identity = 18/35 (51.43%), Postives = 24/35 (68.57%), Query Frame = 3
Query:  105 NGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            NGK  + LKWK +  + N+WEPEE+L+C  LI  F
Sbjct:   42 NGKVEFFLKWKGFPDTDNTWEPEENLDCPELISAF 76          
BLAST of chromobox protein homolog 1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 74.7146 bits (182), Expect = 1.045e-21
Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL P+ I G T  +  + F++KW G DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  136 GFARGLDPERIIGATDSSGELMFLMKWKGSDEADLVPAKEANVKCPQIVISFYEERLTW 194          

HSP 2 Score: 45.8246 bits (107), Expect = 1.045e-21
Identity = 21/41 (51.22%), Postives = 27/41 (65.85%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLK 230
            GK  YLLKWK +    N+WEP+E+L+C  LI  F +N K K
Sbjct:   55 GKVEYLLKWKGFGDEDNTWEPDENLDCPDLISEFLENYKNK 95          
BLAST of chromobox protein homolog 1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 71.633 bits (174), Expect = 1.669e-20
Identity = 29/59 (49.15%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW G DE D+VPA +AN  CPQ+VI FYE   ++
Sbjct:  114 GFSRGLEPERIIGATDSSGELMFLMKWYGSDEADLVPAKEANTSCPQIVISFYEERLTW 172          

HSP 2 Score: 44.669 bits (104), Expect = 1.669e-20
Identity = 22/53 (41.51%), Postives = 30/53 (56.60%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKE 233
            VEK++      GK  Y LKWK +    N+WEPEE+L+C  LI  +    K K+
Sbjct:   23 VEKVMDRRVVKGKVEYFLKWKGFTEEDNTWEPEENLDCPDLISEYLGTSKGKQ 75          
BLAST of chromobox protein homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009664.1 (pep scaffold:Pmarinus_7.0:GL477881:602658:605312:-1 gene:ENSPMAG00000008728.1 transcript:ENSPMAT00000009664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 5.676e-16
Identity = 30/59 (50.85%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T  +  + F++KW GC+E D+VPA +AN+KCPQ+VI FYE   ++
Sbjct:  138 GFVRGLEPEKIIGATDSSGELMFLMKWKGCEEADLVPAKEANLKCPQVVISFYEERLTW 196          
BLAST of chromobox protein homolog 1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 73.1738 bits (178), Expect = 1.826e-15
Identity = 30/63 (47.62%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            D   GF RGL+P+ I G T  +  + F++KW   DE D+VPA +AN+KCPQ+VI FYE   ++
Sbjct:  115 DRIRGFTRGLEPERIIGATDSSGELMFLMKWRDSDEADLVPAKEANLKCPQVVISFYEERLTW 177          
BLAST of chromobox protein homolog 1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 67.0106 bits (162), Expect = 2.968e-13
Identity = 29/59 (49.15%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF  GL+ + I G T  +  + F++KW G DE D+VPA +ANVKCPQ+VI+FYE   ++
Sbjct:  134 GFAGGLEAERIVGATDCSGELMFLMKWKGLDETDLVPAKEANVKCPQVVIKFYEERVTW 192          

HSP 2 Score: 52.7582 bits (125), Expect = 1.873e-8
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLK 230
            VEK++      GK  YLLKWK +    N+WEPE+HL+C  LI ++  +LKLK
Sbjct:   31 VEKVLDRRVVKGKVEYLLKWKGFSHGDNTWEPEDHLDCPELINHYLDSLKLK 82          
BLAST of chromobox protein homolog 1 vs. Ensembl Nematostella
Match: EDO48908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT1])

HSP 1 Score: 53.9138 bits (128), Expect = 1.372e-8
Identity = 23/64 (35.94%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            KD       G +   I G T+ +  I+F+I+W   D  D++P+  AN+K PQ+VI+FYE   ++
Sbjct:  132 KDDVDPIAEGWEADTILGATEVDGQIHFLIQWKSTDRADLIPSKVANLKWPQIVIKFYEERVTW 195          
BLAST of chromobox protein homolog 1 vs. Ensembl Nematostella
Match: EDO27150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA22])

HSP 1 Score: 43.8986 bits (102), Expect = 2.970e-6
Identity = 20/55 (36.36%), Postives = 31/55 (56.36%), Query Frame = 3
Query:   66 VIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLK 230
            +   E I+    R+GK  Y +KWK Y    N+WEPEE++    L+K + + L L+
Sbjct:   10 IYAAETILKERVRDGKVWYFIKWKGYSQRYNTWEPEENVLDPRLLKAYQERLALR 64          
BLAST of chromobox protein homolog 1 vs. Ensembl Medaka
Match: CBX1 (chromobox protein homolog 1 [Source:NCBI gene;Acc:101170765])

HSP 1 Score: 75.485 bits (184), Expect = 5.557e-20
Identity = 31/63 (49.21%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            + A GF RGL+P+ I G T  +  + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  103 EKARGFGRGLQPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 165          

HSP 2 Score: 41.2022 bits (95), Expect = 5.557e-20
Identity = 17/34 (50.00%), Postives = 23/34 (67.65%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF 209
            GK  +LLKWK +    N+WEPEE+L+C  LI  +
Sbjct:   31 GKVEFLLKWKGFSEEDNTWEPEENLDCPDLIAEY 64          
BLAST of chromobox protein homolog 1 vs. Ensembl Medaka
Match: cbx3a (chromobox protein homolog 3 [Source:NCBI gene;Acc:100049459])

HSP 1 Score: 67.781 bits (164), Expect = 1.214e-19
Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  329 DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            +   GF R L+P+ I G T  +  + F++KW   DE D+VPA +AN +CPQ+VI FYE   ++
Sbjct:  103 EKPRGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQVVISFYEERLTW 165          

HSP 2 Score: 47.7506 bits (112), Expect = 1.214e-19
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNF---HKNLKLK 230
            VEK++     NGK  + LKWK +  + N+WEPEE+L+C  LI  F    KN+K K
Sbjct:   25 VEKVLDQRLVNGKVEFYLKWKGFTDADNTWEPEENLDCPELISAFLESQKNIKEK 79          
BLAST of chromobox protein homolog 1 vs. Ensembl Medaka
Match: CBX1 (chromobox 1 [Source:NCBI gene;Acc:101155967])

HSP 1 Score: 71.633 bits (174), Expect = 4.488e-19
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  341 GFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            GF RGL+P+ I G T     + F++KW   DE D+VPA +ANVKCPQ+VI FYE   ++
Sbjct:  192 GFARGLEPERIIGATDSTGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 250          

HSP 2 Score: 42.3578 bits (98), Expect = 4.488e-19
Identity = 18/39 (46.15%), Postives = 26/39 (66.67%), Query Frame = 3
Query:  108 GKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLK 224
            G+  YLLKWK +    N+WEPE++L+C  LI  F ++ K
Sbjct:  122 GRVEYLLKWKGFSEEDNTWEPEDNLDCPDLIAEFLQSQK 160          
BLAST of chromobox protein homolog 1 vs. Ensembl Medaka
Match: cbx5 (chromobox 5 [Source:NCBI gene;Acc:101174667])

HSP 1 Score: 67.781 bits (164), Expect = 7.558e-13
Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  335 AYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            A GF+RGL+P+ I G T     + F++KW   DE D+V A +AN KCPQ+VI FYE   ++ E
Sbjct:  129 ARGFERGLEPEKIIGATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIVIAFYEERLTWHE 191          
BLAST of chromobox protein homolog 1 vs. Ensembl Medaka
Match: cbx3b (chromobox protein homolog 3 [Source:NCBI gene;Acc:101159942])

HSP 1 Score: 53.9138 bits (128), Expect = 3.651e-8
Identity = 19/54 (35.19%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  356 LKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 517
            L+P+ I G T +   + F++KW   +++ ++PA +A+ +CPQ+VI FYE   ++
Sbjct:  133 LEPECIIGSTDRKGELMFLVKWKNSEDVALLPAREASTRCPQVVIDFYEQKLTW 186          

HSP 2 Score: 50.8322 bits (120), Expect = 3.741e-7
Identity = 23/48 (47.92%), Postives = 32/48 (66.67%), Query Frame = 3
Query:   75 VEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKN 218
            VEKII     NG+  Y LKWK +  + N+WEPE++L+C  LI+ F +N
Sbjct:   24 VEKIIRRRVFNGRVEYFLKWKGFTDAENTWEPEDNLDCPELIEEFLRN 71          
BLAST of chromobox protein homolog 1 vs. Planmine SMEST
Match: SMESG000055315.1 (SMESG000055315.1)

HSP 1 Score: 231.491 bits (589), Expect = 2.249e-76
Identity = 114/115 (99.13%), Postives = 115/115 (100.00%), Query Frame = 1
Query:  757 MDNKEYVKVSANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYETFLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYNDMENLIQ 1101
            MDNKEY+KVSANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYETFLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYNDMENLIQ
Sbjct:    1 MDNKEYIKVSANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYETFLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYNDMENLIQ 115          
BLAST of chromobox protein homolog 1 vs. Planmine SMEST
Match: SMESG000054374.1 (SMESG000054374.1)

HSP 1 Score: 231.491 bits (589), Expect = 2.249e-76
Identity = 114/115 (99.13%), Postives = 115/115 (100.00%), Query Frame = 1
Query:  757 MDNKEYVKVSANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYETFLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYNDMENLIQ 1101
            MDNKEY+KVSANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYETFLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYNDMENLIQ
Sbjct:    1 MDNKEYIKVSANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYETFLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYNDMENLIQ 115          
BLAST of chromobox protein homolog 1 vs. Planmine SMEST
Match: SMESG000055314.1 (SMESG000055314.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.957e-73
Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 3
Query:   57 MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPV 278
            MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVP+
Sbjct:    1 MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPI 74          

HSP 2 Score: 141.739 bits (356), Expect = 2.957e-73
Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE
Sbjct:   76 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 141          
BLAST of chromobox protein homolog 1 vs. Planmine SMEST
Match: SMESG000054375.1 (SMESG000054375.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.957e-73
Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 3
Query:   57 MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPV 278
            MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVP+
Sbjct:    1 MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPI 74          

HSP 2 Score: 141.739 bits (356), Expect = 2.957e-73
Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE
Sbjct:   76 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 141          
BLAST of chromobox protein homolog 1 vs. Planmine SMEST
Match: SMESG000055314.1 (SMESG000055314.1)

HSP 1 Score: 141.354 bits (355), Expect = 7.507e-55
Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 2
Query:  326 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 523
            KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE
Sbjct:   55 KDHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSFEE 120          

HSP 2 Score: 92.4337 bits (228), Expect = 7.507e-55
Identity = 43/44 (97.73%), Postives = 44/44 (100.00%), Query Frame = 3
Query:  147 SSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPV 278
            SSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVP+
Sbjct:   10 SSLNSWEPEEHLNCGALIKNFHKNLKLKEFTQNFQLPMTIKVPI 53          
The following BLAST results are available for this feature:
BLAST of chromobox protein homolog 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBX17.364e-2050.85chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX17.589e-2050.85chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX17.589e-2050.85chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX31.564e-1946.03chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553][more]
CBX31.564e-1946.03chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553][more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HP1b1.104e-2045.76gene:FBgn0030082 transcript:FBtr0071284[more]
HP1b1.104e-2045.76gene:FBgn0030082 transcript:FBtr0309871[more]
HP1b1.104e-2045.76gene:FBgn0030082 transcript:FBtr0301805[more]
HP64.751e-1345.90gene:FBgn0031613 transcript:FBtr0077444[more]
HP1e2.336e-1038.33gene:FBgn0037675 transcript:FBtr0082016[more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbx1b3.942e-2050.85chromobox homolog 1b (HP1 beta homolog Drosophila)... [more]
cbx1b3.942e-2050.85chromobox homolog 1b (HP1 beta homolog Drosophila)... [more]
cbx3a6.331e-2044.44chromobox homolog 3a (HP1 gamma homolog, Drosophil... [more]
cbx3a6.431e-2044.44chromobox homolog 3a (HP1 gamma homolog, Drosophil... [more]
cbx1a1.173e-1948.44chromobox homolog 1a (HP1 beta homolog Drosophila)... [more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stab23.864e-2149.21stabilin 2 [Source:Xenbase;Acc:XB-GENE-491156][more]
zbtb115.184e-2050.85zinc finger and BTB domain containing 11 [Source:X... [more]
tnfaip61.597e-1849.21TNF alpha induced protein 6 [Source:Xenbase;Acc:XB... [more]
ENSXETT00000037867.14.473e-647.17chromodomain Y like [Source:NCBI gene;Acc:10049195... [more]
ENSXETT00000025504.14.504e-647.17chromodomain Y like [Source:NCBI gene;Acc:10049195... [more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cbx15.501e-2050.85chromobox 1 [Source:MGI Symbol;Acc:MGI:105369][more]
Cbx31.133e-1946.03chromobox 3 [Source:MGI Symbol;Acc:MGI:108515][more]
Cbx31.133e-1946.03chromobox 3 [Source:MGI Symbol;Acc:MGI:108515][more]
Cbx31.133e-1946.03chromobox 3 [Source:MGI Symbol;Acc:MGI:108515][more]
Cbx52.129e-1949.21chromobox 5 [Source:MGI Symbol;Acc:MGI:109372][more]
back to top
BLAST of chromobox protein homolog 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23198|CBX3_MOUSE2.647e-1946.03Chromobox protein homolog 3 OS=Mus musculus OX=100... [more]
sp|P83917|CBX1_MOUSE3.302e-1950.85Chromobox protein homolog 1 OS=Mus musculus OX=100... [more]
sp|P83916|CBX1_HUMAN3.302e-1950.85Chromobox protein homolog 1 OS=Homo sapiens OX=960... [more]
sp|Q5R6X7|CBX3_PONAB6.805e-1946.03Chromobox protein homolog 3 OS=Pongo abelii OX=960... [more]
sp|Q13185|CBX3_HUMAN6.805e-1946.03Chromobox protein homolog 3 OS=Homo sapiens OX=960... [more]
back to top
BLAST of chromobox protein homolog 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M9NNX25.740e-7098.65Heterochromatin protein 1-like protein 2 OS=Schmid... [more]
A0A504YE481.434e-2464.06Chromobox protein 1 (Heterochromatin protein 1 bet... [more]
A0A4E0RD811.469e-2464.06Chromobox protein 1 (Heterochromatin protein 1 bet... [more]
J3JTC01.863e-2456.67Uncharacterized protein OS=Dendroctonus ponderosae... [more]
A0A224YJX03.863e-2455.00Chromobox protein 3 OS=Rhipicephalus zambeziensis ... [more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbx1a1.284e-1946.88chromobox protein homolog 1-like [Source:NCBI gene... [more]
cbx1a1.284e-1946.88chromobox protein homolog 1-like [Source:NCBI gene... [more]
cbx51.356e-1847.62chromobox 5 [Source:NCBI gene;Acc:103047453][more]
cbx3a2.379e-1842.86chromobox protein homolog 3-like [Source:NCBI gene... [more]
cbx3a3.668e-1842.86chromobox protein homolog 3-like [Source:NCBI gene... [more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBX11.045e-2152.54chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX11.669e-2049.15chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
ENSPMAT00000009664.15.676e-1650.85pep scaffold:Pmarinus_7.0:GL477881:602658:605312:-... [more]
CBX11.826e-1547.62chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX12.968e-1349.15chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO489081.372e-835.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271502.970e-636.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of chromobox protein homolog 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBX15.557e-2049.21chromobox protein homolog 1 [Source:NCBI gene;Acc:... [more]
cbx3a1.214e-1942.86chromobox protein homolog 3 [Source:NCBI gene;Acc:... [more]
CBX14.488e-1950.85chromobox 1 [Source:NCBI gene;Acc:101155967][more]
cbx57.558e-1347.62chromobox 5 [Source:NCBI gene;Acc:101174667][more]
cbx3b3.651e-835.19chromobox protein homolog 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of chromobox protein homolog 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055315.12.249e-7699.13SMESG000055315.1[more]
SMESG000054374.12.249e-7699.13SMESG000054374.1[more]
SMESG000055314.12.957e-7398.65SMESG000055314.1[more]
SMESG000054375.12.957e-7398.65SMESG000054375.1[more]
SMESG000055314.17.507e-55100.00SMESG000055314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033701 ID=SMED30033701|Name=chromobox protein homolog 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1120bp
CCTTGTCAATAATTTTGAATTAGCTCAGGAAATACTTGTTTTAATCAGTT
TTGTTAATGTCTGAAGTAATTGAGGTTGAAAAAATTATTGCTGTTTCTAA
TCGAAATGGCAAAAGATGTTACTTGTTGAAATGGAAAAATTATGATAGTT
CATTGAATTCGTGGGAGCCCGAAGAACATTTAAATTGTGGTGCATTAATA
AAAAACTTTCATAAAAATTTGAAATTAAAAGAATTTACCCAAAATTTTCA
ATTACCAATGACTATAAAAGTTCCTGTTAGAATTGGTTTCTTATTAAACG
CTACATTTTATTATTATAGATTATTAAAGATCATGCTTACGGATTTGATA
GGGGACTAAAGCCACAAATAATATGTGGCGTTACTAAAAAAAATGATGCA
ATTTATTTTATGATAAAATGGGATGGTTGTGACGAAATAGATGTTGTTCC
AGCTGTTCAAGCTAATGTGAAATGTCCACAGCTTGTAATTAGATTCTATG
AAAATAACTTTAGTTTTGAAGAATAAATAATTGTTGTGTAGTTATTGTGT
CGTGTTATTGATTATTAAAATAAAATTTCATTGGTTAATGGTTATTCAGT
GTATGTTTCTTTTTAACAAGTCATAATTGGAAAATGACTTCCATATTAAA
AAAGAAAAAATGGCGGATTAATTTACCATGTGTCTCTAAATTTAAACCTA
TCAAGTTTAAGAAAATAAATCTTATTGGAAATAAGTTTAAGTTAAATCGC
CATCATATGGATAACAAGGAATATGTAAAAGTAAGTGCTAATTTTTCTGA
AAACAATCAGCTTCTCGACGAAGTGTGGTGGGATCCAGGTGGTTGCAATT
TAGAAAACGATTTGGACTGCATCTATGACGAAGTTTATGATAACCAAGGA
ATGGAAGCAGAGAAAATATCATACTACGAAACCTTCTTGAATGTTCCAAA
TGTTTCAGTTAACAGCAAGAAGACATCTCTAATTAATATTAAAAAAGAAA
TATTGGATTTACATTCGAAATTGGATAATTTACACAGCCTTGAAAGTCAA
TATATGCAGCAGTTGAATAAATATTATAATGATATGGAAAATTTAATTCA
ATAAATTTTTTGGCGTGGTG
back to top

protein sequence of SMED30033701-orf-1

>SMED30033701-orf-1 ID=SMED30033701-orf-1|Name=SMED30033701-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MTSILKKKKWRINLPCVSKFKPIKFKKINLIGNKFKLNRHHMDNKEYVKV
SANFSENNQLLDEVWWDPGGCNLENDLDCIYDEVYDNQGMEAEKISYYET
FLNVPNVSVNSKKTSLINIKKEILDLHSKLDNLHSLESQYMQQLNKYYND
MENLIQ*
back to top

protein sequence of SMED30033701-orf-2

>SMED30033701-orf-2 ID=SMED30033701-orf-2|Name=SMED30033701-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MSEVIEVEKIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKN
FHKNLKLKEFTQNFQLPMTIKVPVRIGFLLNATFYYYRLLKIMLTDLIGD
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005719nuclear euchromatin
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000953Chromo/chromo_shadow_dom
IPR023780Chromo_domain
IPR023779Chromodomain_CS
IPR016197Chromo-like_dom_sf
IPR008251Chromo_shadow_dom