SMED30033700

Overview
NameSMED30033700
Smed IDSMED30033700
Length (bp)703
Neoblast Clusters

Zeng et. al., 2018



 

 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)



Explore this single cell expression dataset with our NB Cluster Shiny App



Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020



SMED30033700

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
oocyteSMED30033700h1SMcG0005382 Contig55793newmark_estsPMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30033700h1SMcG0005382 Contig55793uc_Smed_v2PMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30033700h1SMcG0005382 Contig55793newmark_estsPMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30033700h1SMcG0005382 Contig55793uc_Smed_v2PMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30033700h1SMcG0020964 Contig55793newmark_estsPMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30033700h1SMcG0020964 Contig55793uc_Smed_v2PMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30033700h1SMcG0020964 Contig55793newmark_estsPMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30033700h1SMcG0020964 Contig55793uc_Smed_v2PMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033700 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002808:6767..7469 +3452
v31.002808:24117..24824 -3317
Homology
The following BLAST results are available for this feature:
BLAST of SMED30033700 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033700 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033700 ID=SMED30033700|Name=SMED30033700|organism=Schmidtea mediterranea sexual|type=transcript|length=703bp
AATTAGCTGAAAATTCATTAGCAACATACGAAAATTGCTGCATTTGTGAT
ACCACCGCAAATGAATATCTATTCTATACGTATTGCAATCACGGGTTTCA
CCAGAACTGCCTCTTCAAGCACCTCATGAACACGAATCTTTATCAGTGTC
CTCGATGTTCCACAGCCTCCAAATATTGGTCGGCAATGATTTCCACCAAA
ACTCTTTGCGCCGTTTATTTTAAGAACACCCCCCAATTGTGTCAAATCGG
TTACAGTTTCATACGCAATTATGTCGAAATTGGCTATTCATGTCTGGTGA
GTTTATTTCGGATAAAATTGCCCCTAGTGCTAAAAGTCAAACTATCAAAG
AAATCCATCCGGAAATATATTTATATCCAAAATTTATCCGAGTATTCATT
CATTTACAAACAGAAAGCTAAAGGTTTGAAATGCCGAAAGCTAAAAGTGA
TAATTCCGAATCCAACGAAAATCCCAATTGAAGACGTAAAGATCGAGATG
TTGTGTCAAAAAACAACTCTTACGTTTTACTGTCAAATCAAGCTGGAAAA
CGGGCTTGCTTTTGAGCGAGTTCCTTTTATCACTGAGATCAAAAGCATCG
GCAGAAAGATCAACATGGACAATTACCATTCAAATGAATTTGAAAAACCA
AAACCGAAGACTATTCTGAGTAAAAACCTTTTTATTTAAAAAGATGAGGG
GAG
back to top

protein sequence of SMED30033700-orf-1

>SMED30033700-orf-1 ID=SMED30033700-orf-1|Name=SMED30033700-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=229bp
LAENSLATYENCCICDTTANEYLFYTYCNHGFHQNCLFKHLMNTNLYQCP
RCSTASKYWSAMISTKTLCAVYFKNTPQLCQIGYSFIRNYVEIGYSCLVS
LFRIKLPLVLKVKLSKKSIRKYIYIQNLSEYSFIYKQKAKGLKCRKLKVI
IPNPTKIPIEDVKIEMLCQKTTLTFYCQIKLENGLAFERVPFITEIKSIG
RKINMDNYHSNEFEKPKPKTILSKNLFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR018957Znf_C3HC4_RING-type
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018957Zinc finger, C3HC4 RING-typePFAMPF00097zf-C3HC4coord: 12..52
e-value: 3.7E-5
score: 23.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1..66
e-value: 1.4E-6
score: 29.5
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 12..53
score: 9.981
NoneNo IPR availableCDDcd16448RING-H2coord: 12..53
e-value: 9.54904E-4
score: 33.9647
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 11..59