beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3

Overview
Namebeta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Smed IDSMED30033698
Length (bp)1414
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033698

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30033698SMESG000043063.1 dd_Smed_v4_13967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033698SMESG000043063.1 dd_Smed_v4_13967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 169.474 bits (428), Expect = 5.245e-47
Identity = 109/346 (31.50%), Postives = 169/346 (48.84%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 169.474 bits (428), Expect = 5.245e-47
Identity = 109/346 (31.50%), Postives = 169/346 (48.84%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 169.474 bits (428), Expect = 5.245e-47
Identity = 109/346 (31.50%), Postives = 169/346 (48.84%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDE------------NIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R E             ++P  +TP     F G  + +V+R +V ++ ++   + ++++  +   PDE  ++T+   P+  + GS        L D   +   +    F G       +        RS+CI G  DLN ++   HLFA+KF       A++CL++    K  E +K
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPL----FSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKALETLK 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:HGNC Symbol;Acc:HGNC:4205])

HSP 1 Score: 166.007 bits (419), Expect = 1.160e-45
Identity = 101/353 (28.61%), Postives = 175/353 (49.58%), Query Frame = 2
Query:  215 ETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI-----------------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY----------NPQFRIAG--------SFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1168
            E  K + P +D+  Y  + +DC  F   +K F+    +++E  F IAYS+V  E     ERLLR +Y P N YC+H+D KS   F+ AV  ++ C    + N+  +   V V  ++ S + ADLNCM++L +    WKYF+N  G +FP+K+NAE+V+ LK   G N++E     + +                     K+  P+ +  F G+ +I+ +R+FV+ + ++   + +++++ +   PDE  ++TL            +P++ I+          + G   ++D G           +   S    R+IC+ G  DLN ++ + HL A+KF       AL+CLE++
Sbjct:   90 EVKKKREPFTDTH-YLSLTRDCEHFKAERK-FIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISC----FPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKG---------APYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEY 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:HGNC Symbol;Acc:HGNC:4205])

HSP 1 Score: 166.007 bits (419), Expect = 1.160e-45
Identity = 101/353 (28.61%), Postives = 175/353 (49.58%), Query Frame = 2
Query:  215 ETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI-----------------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY----------NPQFRIAG--------SFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1168
            E  K + P +D+  Y  + +DC  F   +K F+    +++E  F IAYS+V  E     ERLLR +Y P N YC+H+D KS   F+ AV  ++ C    + N+  +   V V  ++ S + ADLNCM++L +    WKYF+N  G +FP+K+NAE+V+ LK   G N++E     + +                     K+  P+ +  F G+ +I+ +R+FV+ + ++   + +++++ +   PDE  ++TL            +P++ I+          + G   ++D G           +   S    R+IC+ G  DLN ++ + HL A+KF       AL+CLE++
Sbjct:   90 EVKKKREPFTDTH-YLSLTRDCEHFKAERK-FIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISC----FPNVFIASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKG---------APYAPCSGIHQRAICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEY 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-17 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:O02315])

HSP 1 Score: 140.198 bits (352), Expect = 6.560e-37
Identity = 92/283 (32.51%), Postives = 149/283 (52.65%), Query Frame = 2
Query:  326 TEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGSF-LGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            +E+E  F +++ ++ ++  SQ+  LL +IY+P N YCI +   S+  F I + EL  C  + Y        R  ++  +  ++ +   C++ L    ++WKYF  L+G + PLKTN E+V+ILK   G  NI   TY++R  N   K ++P P+  FK  +  ++ R    ++  SS+P+ +L+FL      DE F+ TL  N   F + GSF   DP     G ++ R++   +  C +   +RS C+ GI D+  L+ S  L AHK Y   +P A  CL K
Sbjct:  101 SEEEARFPLSFGLLVYKELSQVLFLLSSIYQPQNEYCIAVGENSAPAFLILLKELANCFPNVY-----FMKRPPIKWGSFEIINSVYGCLEFLSHLKSDWKYFQYLSGVDIPLKTNLEMVRILKRLNGTVNIGISTYEDRLLNGKNKTESPLPL--FKSSLSSLIPRKAANYLSSSSVPQQLLEFLRTTWVADEGFWGTLFGNKDLFNVPGSFNFNDPLTNGWGNYVSRHQLWVESECHNYMKDRS-CVFGIGDVPNLMKSRALVAHKLYIESEPEAFFCLLK 375          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-16 (GLY-16; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EDP7])

HSP 1 Score: 133.65 bits (335), Expect = 2.356e-34
Identity = 108/392 (27.55%), Postives = 187/392 (47.70%), Query Frame = 2
Query:   74 YALVSKMLNFLVFTNLIASIQSDSSNEDLI------CENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDI---HQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGSF---------------LGDPDELDSGIF--LGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            ++ V+   + ++FT L  +  S     DL+      C N  +      ++E   T      + + KL+      H   + F FN+     +  +E+E  F ++Y ++ ++  SQ+  +L +IY+P N YCI +   S++ F I + EL  C  +     ++   R  +   +  ++ +  +C+K L    +NWKYF  L+G + PLKTN E+V+ILK+  G  N+E   Y+NR   ++ + +T  P+  FK  +  ++ R    ++  SSIP+ +L+FL N    DE F+ TL  N   F + GS                L  P +   G F  + R++   +  C +   + S C+ GI D++ L+ +  L AHK Y   +P A  CL K
Sbjct:    8 FSCVAVYGSLVIFTYLFVAKPSSRPPTDLLDDLEINCTNILQGLKNEKQLELINT-----KMIEDKLWNSTDRCHTVKSMFRFNE-----VPLSEEEARFPLSYGLLVYKELSQVLFMLSSIYQPQNEYCIAVGENSASTFLILLEELSDCFPN-----VHFMKRPPITWGSYEIINSVYDCLKFLSHLKSNWKYFQYLSGVDIPLKTNLEMVRILKSLNGTANVEIKVYENR--RLLGQNETESPLPLFKSSLSSLIPRKAANYLASSSIPQQLLEFLRNTWVADEGFWGTLFGNKGLFDVPGSLNFEEWIYFKENARANLTKPTD---GWFYYISRHQIWFESGCHNHMKDGS-CVFGIGDVSNLLQAKALVAHKLYLTSEPEAYFCLLK 378          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-18 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q19730])

HSP 1 Score: 125.946 bits (315), Expect = 1.573e-31
Identity = 99/368 (26.90%), Postives = 179/368 (48.64%), Query Frame = 2
Query:  113 TNLIASIQSDSSNE-DLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGS-----FLGDPDELDSGI---------FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            T++++ I++D  ++ D+ C N F       ++    +      + D  LY        K LF    F  +  + +EE+F ++Y ++ ++  SQ+  +L +IY P N YCI +   S+ +F+  + EL  C  +     I+   R  ++  +  ++ +  +C++ L    ++W+YF  L+G + PLKTN E+V+ILK   G  N+E   Y+ +      + Q+P P+  FK  +  ++ R     +  SSIP+ +L+FL N    DE F+ TL  N   F I GS     ++   + +++ +         ++ R +   +  C + +     C+ GI D+  L+ S  L AHKFY   +P A  CL K
Sbjct:   46 TSILSKIENDLLDDLDINCLNIFNGSKNRNQLRIVNSRS----IEDKLLYSTDRCQTLKSLFR---FNKVPLSPEEESFPLSYGLLVYKELSQVLFMLSSIYHPQNEYCIAVGENSAPIFQNLLKELSNCFSN-----IHFMKRPPIDWGSHEIINSAYDCLEFLSHLKSDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTANVEIKPYQYQRLRGKNETQSPLPL--FKSSLSSLIPREAANHLSSSSIPQQLLEFLRNTGIADEGFWGTLFGNKNLFDIPGSLNFKEWISYKNNVETNLTYPTDGWRYYISRDQIWSKPNCHN-YMKAGSCVFGIGDVPRLLKSKALVAHKFYLKSEPEAYFCLLK 398          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-1 (GLY-1; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5ECK8])

HSP 1 Score: 119.783 bits (299), Expect = 3.180e-29
Identity = 82/311 (26.37%), Postives = 147/311 (47.27%), Query Frame = 2
Query:  308 FLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT------YKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQ-FRIAGSF-------------LGDPDELD----SGIFLGRYKNKG-QFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            F  +  + +E  + +AY +V +++  Q+   +   Y+P + +CI +D +S N ++  +  L  C  + +  I         +  +  +L     C   L +    WKY+  L+G + P++TN E+V+I KA  G+ N + +      YKN  E ++P    P PV  +K  + ++V R   +++  S   + +L++L+    PDE F+ST+  +P    + GS              L  P E         ++GRY+  G Q  C  +  + S C+ G++D+  ++  P L AHK Y  FQP A  C+ K
Sbjct:  115 FTRIPSSREEAEYPLAYGLVVYKTIVQVLTQMSLFYQPQHMFCITVDDQSPNEYKSVIQALPSCFPNMHVFIGEPS-----QWGSFGILKNVYTCFNWLSKSKQKWKYYQYLSGTDLPIRTNLEMVRIFKALNGSMNTDVSTFEVDRYKNM-EGVLP----PMPV--YKSSMSVVVPREGADYLISSPRVQKLLKYLSKTWIPDESFWSTVLGSPALLPVPGSIRVRDILWLRKNFKLRPPYENTVNSIGTSYIGRYQVWGWQKECFGKVKDFS-CVFGVEDIEEIMTRPELVAHKLYLEFQPAAFMCMLK 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-15 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:L8E6J1])

HSP 1 Score: 117.857 bits (294), Expect = 9.167e-29
Identity = 99/341 (29.03%), Postives = 154/341 (45.16%), Query Frame = 2
Query:  251 KLYQDIHQDCTKFLFNQKYFLNLKE--TEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNI---INSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKE----------QTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNP-QFRIAGSF-------------------LGDPDELDSGIFLGRYK---NKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCL 1159
            KL    +  C +F   QK F   +E  +++E  F +AY ++      QL  LL  IY+P N +C+ +D  SS  F   +G LV+ L   Y NI   I  E    +      +LT+   C+  L +  ++WKYF  L+G + PLK+N E+++ILKA  G+ N E         I+P E           +P P+  +K  +    +R    F+  S      + FL      DE  ++T+  NP +  + G F                    G+  ++D+G ++ RY+   N+    C   ++  S C+ G+ DL  LIN   L AHK Y  +QP A  CL
Sbjct:   73 KLSGQENAQCAEF---QKIFGFFQEPTSQEELEFPLAYGMLVHGDFVQLSLLLSAIYQPQNQFCLAVDGNSSVEF---IG-LVRMLSRCYGNIQYFITDE----IRWCGYEILTSVFQCVDYLAKLPSDWKYFQYLSGVDAPLKSNLEMIRILKALNGSFNAE---------ILPFEFYRLNRKRPWSSPLPL--YKTSLSATFSRKSANFMVNSEKVLEQIDFLRGTTCADESLWATIAGNPKELPMPGGFDAKAWIHKNYRRTRGKLGKYGENQKIDNGYYVSRYQQYVNRAPVKCKGYYYRLS-CVFGVYDLPNLINRHELVAHKLYFSYQPAAFMCL 390          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 73.1738 bits (178), Expect = 2.046e-13
Identity = 59/225 (26.22%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  326 TEDEENFRIAYSIVAFESA-SQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG----------------TYKNRDENI--IPKEQTPFPVIWFKGDVHIIVNRNFVEFIF----ESSIPKVILQFLNNQQFPDEQFFSTLNYN 931
            +E+ +  RIA+ +     A  Q+ RLL+ +Y P + Y IH+D +   ++     +L++ L SK+ NI  +  R        S+LT  L CM++L +   +W + INL+  +FP+KT  +LV  L A  G N ++G                T+   D ++  I   + P  +    G   + ++R FV ++     +  + + +L+   +   P E FF T+  N
Sbjct:  242 SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYR----KLLE-LESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRN 461          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 166.392 bits (420), Expect = 6.368e-46
Identity = 126/381 (33.07%), Postives = 188/381 (49.34%), Query Frame = 2
Query:  200 EMEFGETWKPKVPVSDSKLYQDIHQ--------DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--------------KNRDENI------IPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL---GDPDELDSGIFLGRYKN-KGQ-FTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTS 1237
            EME  E  K  V +   K+Y+ +          DC  F+ +Q+Y  +++ TE E  F +AYS+V  + A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TNAELV  LK  KG N +E  +              KN D          P+E+ P P  +  F G  +  ++R FV F+  SS+ K  L +  +   PDE F++TL   P   + G       D  EL S   L ++   +G+ +   +    R ICI G  +L  L+N  H FA+K      P  + CLE    +K+ E+ +S + +     ++S
Sbjct:   60 EMEPVEVGKSLV-IRKQKIYKGLTDAAIANATIDCEWFVSSQRYN-DIQVTESEREFPLAYSLVVHQDAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCI----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGGKKIRWSVHHLLKNNDSEYYDFPVSTPEEKPPPPHNIEMFVGSAYFTLSREFVYFVHWSSLAKDFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRSFHKKSINEVFSS 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 160.999 bits (406), Expect = 3.390e-44
Identity = 103/336 (30.65%), Postives = 165/336 (49.11%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-TYKNRD------ENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYK---NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEE 1192
            Y +I  DC  ++   + FL    +++EE+F IAYS+V  +     ERLLR IY P N YC+H+D KS  +F  AV  +V C    + N+  +     V  ++ S + AD+NCM++L +    W+Y +N  G +FP+KTNAE V+ LK   G N++E  T   ++       NI        I K   P     F G+ + +V+R FVE+I  S   + ++++  +   PDE  ++TL   P    + S     ++ D        K   ++G    G+ +        RS+C+ G  DL  ++   HL A+KF       A++C+E +   K T E
Sbjct:   77 YLNITTDCPTYI-EGRGFLMEALSKEEEDFPIAYSMVIHDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSC----FPNVFVASKLESVIYASWSRVQADVNCMQDLLKSPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSMESETVPGKNWRWQFHHNITNTVIRTDIRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKEIQNLMEWEKDTYSPDEHMWATLQRMPSVPGSNSPNNKYEQSDMNAIARLVKWSYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHHLLANKFDPEVDDVAIKCMEAFLRYKATVE 407          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 160.614 bits (405), Expect = 6.664e-44
Identity = 112/316 (35.44%), Postives = 159/316 (50.32%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTY--------------KNRDENI------IPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-LGDPD--ELDSGIFLGR--YKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQP 1141
            DC  F+ +Q Y  +++ TE E  F +AYS+V  + A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TNAELV  LK  KG N +E  +              KN D          P+E+ P P  +  F G  +  ++R FV F+  SS+ K  L +  +   PDE F++TL   P   + G     DP+  EL S   L +  Y     +   +    RS+CI G  +L  L+N  H FA+K      P
Sbjct:   92 DCEWFVSSQGYN-DIQVTESEREFPLAYSLVVHQDAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCI----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGGKKIRWSVHHLLKNNDSEYYDFPVSTPEEKPPPPHNIEMFVGSAYFTLSREFVYFVHWSSLAKDFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSDPEISELISKTHLVKWSYLENDLYPECTGVSVRSVCIYGAAELRWLLNYGHWFANKVDPTVDP 400          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 159.073 bits (401), Expect = 1.989e-43
Identity = 100/326 (30.67%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-TYKNRD------ENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYK---NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1162
            Y +I  DC  ++   + FL    +++EE+F IAYS+V  +     ERLLR IY P N YC+H+D KS  +F  AV  +V C    + N+  +     V  ++ S + AD+NCM++L +    W+Y +N  G +FP+KTNAE V+ LK   G N++E  T   ++       NI        I K   P     F G+ + +V+R FVE+I  S   + ++++  +   PDE  ++TL   P    + S     ++ D        K   ++G    G+ +        RS+C+ G  DL  ++   HL A+KF       A++C+E
Sbjct:   89 YLNITTDCPTYI-EGRGFLMEALSKEEEDFPIAYSMVIHDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSC----FPNVFVASKLESVIYASWSRVQADVNCMQDLLKSPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSMESETVPGKNWRWQFHHNITNTVIRTDIRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKEIQNLMEWEKDTYSPDEHMWATLQRMPSVPGSNSPNNKYEQSDMNAIARLVKWSYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHHLLANKFDPEVDDVAIKCME 409          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 159.458 bits (402), Expect = 2.120e-43
Identity = 100/326 (30.67%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-TYKNRD------ENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYK---NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1162
            Y +I  DC  ++   + FL    +++EE+F IAYS+V  +     ERLLR IY P N YC+H+D KS  +F  AV  +V C    + N+  +     V  ++ S + AD+NCM++L +    W+Y +N  G +FP+KTNAE V+ LK   G N++E  T   ++       NI        I K   P     F G+ + +V+R FVE+I  S   + ++++  +   PDE  ++TL   P    + S     ++ D        K   ++G    G+ +        RS+C+ G  DL  ++   HL A+KF       A++C+E
Sbjct:   89 YLNITTDCPTYI-EGRGFLMEALSKEEEDFPIAYSMVIHDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSC----FPNVFVASKLESVIYASWSRVQADVNCMQDLLKSPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSMESETVPGKNWRWQFHHNITNTVIRTDIRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKEIQNLMEWEKDTYSPDEHMWATLQRMPSVPGSNSPNNKYEQSDMNAIARLVKWSYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHHLLANKFDPEVDDVAIKCME 409          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: cnksr2 (connector enhancer of kinase suppressor of Ras 2 [Source:Xenbase;Acc:XB-GENE-490704])

HSP 1 Score: 175.252 bits (443), Expect = 3.204e-49
Identity = 110/335 (32.84%), Postives = 164/335 (48.96%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE-----GTYKNR-----------DENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS---------GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVT 1186
            Y ++  DC+ F  N+KY +    +++EENF IAYS+V  E     ERLLR IY P N YC+H+D KS  VF+ AV  +  C    + N+  +   V V  +    + ADLNCM++L +    WKY +N  G +FPLKTNAE+V+ LK+  G N++E      + K R            +  I K   P     F G+ +I+V RNFVE IF +     +++++ +   PDE  ++TLN  P    +  +    ++ D          G   G       +   +    RSIC+ G  DL  L+   H+ A+KF       AL CLE++   K  
Sbjct:   97 YINMTTDCSYFKKNRKY-MPFPMSKEEENFPIAYSMVIHEKIDMFERLLRAIYAPQNIYCVHVDEKSPAVFKEAVNAITSC----FDNVFIASKLVKVVYAAWPRVQADLNCMEDLLQSKVLWKYLLNTCGTDFPLKTNAEIVRTLKSLNGKNSMESEKPSSSKKTRWEFHFEVGDSISKTAIEKSPPPIDSPMFTGNAYIVVCRNFVEHIFNNPQALTLIEWVKDTYSPDEHLWATLNRMPGVPGSSPYSDKYEKSDMNAVARMVKWGYMEGDIAKGAPYPPCTGTHRRSICVYGTGDLYWLLEQHHVLANKFDPKVDNIALECLEEYLRHKTV 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: ccdc77 (coiled-coil domain containing 77 [Source:Xenbase;Acc:XB-GENE-959311])

HSP 1 Score: 167.548 bits (423), Expect = 2.277e-46
Identity = 108/335 (32.24%), Postives = 166/335 (49.55%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE---------------------GTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG----DPDELDS-GIFLGRYKNKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            Y ++  DC  F  ++KY L    +++E  F IAYSIV +     LERLLR+IY P NYYCIH+D KSS  F  AV  +  C    ++N+  +     V  ++ + + ADLNCM +L+ K   WKY INL G +FP+KTN E+V++LK  K  N++E                        K  ++   P  +TP     F G  + +V R FV +I E+   +  L++  +   PDE  ++TL   P   + GS       D  ++++   F+     +G    G+ +        RS+C+ G  DL  ++   HLF +KF     P A++CLE+
Sbjct:   90 YINMTNDCEAFTRDRKYLL-YPLSKEEREFPIAYSIVVYHRIDMLERLLRSIYTPQNYYCIHVDKKSSTSFLNAVKAITSC----FENVFIASQLENVVYASWARVQADLNCMTDLHNKNAKWKYLINLCGMDFPIKTNREMVEMLKGLKSQNSLETEKMPPHKEVRWRKHYEIVDNAIRKTEEDKTPPPLETPV----FSGSAYFVVTRAFVSYILENEKIQRFLEWSKDTYSPDEFIWATLQRIPG--VPGSVPANSKYDVSDMNAYARFVKWAYLEGDVAKGAPYPPCAGNHVRSVCVFGAGDLEFMLQKHHLFGNKFDIDVDPTAIKCLEE 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: slc24a4 (solute carrier family 24 member 4 [Source:Xenbase;Acc:XB-GENE-478288])

HSP 1 Score: 166.777 bits (421), Expect = 6.533e-46
Identity = 106/329 (32.22%), Postives = 172/329 (52.28%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG----TYKNR----------DENII-----PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG-----DPDELDSGIFLGRYKN-KGQFTCGSRFF------NRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1168
            DC  F   +KY +    +++E++F IAYS+V  ++    ERLLR IY P N YC+H+D KS   F  AV  +  C    + N+  +   V V  ++   + ADLNCM++L +    WKY IN  G +FP+KTNAE+VK LK+  G N++E      +K R          D N I      K+ +P PV  F G+ +I+V RNFV  +F +   +  + +  +   PDE  ++TLN   +F     ++      D  ++++   L ++++ +G  + G+ +        R++C+ G  DLN L+   HLFA+KF        ++CLE++
Sbjct:  110 DCKLFRQRRKYVM-FSLSKEEQDFPIAYSMVIHDNIEMFERLLRAIYTPHNIYCVHMDKKSPESFHQAVRAITSC----FGNVFVASKLVNVVYASWRRVQADLNCMEDLLQSKVPWKYLINTCGTDFPIKTNAEMVKALKSLNGHNSMESEIPPNHKKRRWEYHFELKEDSNNIVLTNTRKKPSPLPVPVFSGNAYIVVTRNFVNALFVNPTVRSFITWAKDTYSPDEYLWATLN---RFAEMPGYMPAHQKYDTSDINAIARLVKWESLEGDMSKGAPYIPCSGTHRRTVCVYGTGDLNWLLQQHHLFANKFDPKVDNNVIQCLEEY 430          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 154.836 bits (390), Expect = 1.139e-41
Identity = 104/316 (32.91%), Postives = 152/316 (48.10%), Query Frame = 2
Query:  278 CTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLG-RYKN-KGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1162
            C +++  Q +F+    +++E  F +AY +   +     ERL R IY P N YC+H+D K+S  F  AV  LV+C    + N   +     V    +S L ADLNCMK+L      WKY INL GQ+FPLKTN E++  +K++KG N   G            Y +R++ +        + K   P  +  + G  ++ + R F  FI E      +L +  +   PDE ++ TLN     RIA      PD    G     ++K+ K Q  C   +  R ICI G  DL  L+NS  +FA+KF     P  + CLE
Sbjct:   93 CPEYV-RQNHFIMSPLSQEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLN-----RIADVPGSAPDASWEGQLRAVKWKDMKDQEKCHGHYV-RDICIYGTGDLQWLMNSRSIFANKFEAKSYPPTVECLE 397          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: adsl (adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE-1001539])

HSP 1 Score: 152.14 bits (383), Expect = 6.685e-41
Identity = 101/317 (31.86%), Postives = 147/317 (46.37%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIF--LGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1162
            +C  F+    Y + L  +E+E  F +AY +   +     ERL R IY P N YC+H+D K+S  F  AV  LV+C    + N   +     V    +S L ADLNCMK+L      WKY INL GQ+FPLKTN E++  +K++KG N   G            Y +R++ +        + K   P  +  + G  ++ + R F  FI E      +L +  +   PDE ++ TLN     RIA      PD    G    +    +K    C   +  R +C+ G  DL  L+ SP +F +KF     P  + CLE
Sbjct:   70 NCKDFILKNNY-ITLPLSEEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNREIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLN-----RIADFPGSVPDAKWEGDLRAIKWSDDKTHDGCHGHYV-RDVCVYGTGDLQWLLKSPSMFGNKFELASYPPTVECLE 375          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 177.948 bits (450), Expect = 2.326e-50
Identity = 113/351 (32.19%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R   +        I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 177.948 bits (450), Expect = 2.326e-50
Identity = 113/351 (32.19%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R   +        I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 177.948 bits (450), Expect = 2.326e-50
Identity = 113/351 (32.19%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R   +        I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 177.948 bits (450), Expect = 2.326e-50
Identity = 113/351 (32.19%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R   +        I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:MGI Symbol;Acc:MGI:1919327])

HSP 1 Score: 174.096 bits (440), Expect = 7.835e-49
Identity = 106/341 (31.09%), Postives = 173/341 (50.73%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-------------YKNRDE-NIIPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL----------------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1183
            Y  +  DC  F   +K F+ +  +++E +F IAYS+V  E     ERLLR +Y P N YC+H+D KSS  F+ AV  +V C    + N+  +   V V  ++ S + ADLNCM++L +    WKY +N  G +FP+KTNAE+VK LK  KG N++E               Y+  D  ++  K +TP P  +  F G+ +++ +R+F+E +F +S  + +++++ +   PDE  ++TL          S++   D L     L                G  +N   +T  S    R++C+ G  DL+ ++ + HL A+KF        L+CLE++   K 
Sbjct:  103 YLRMTADCEHFKTKRK-FIQVPLSKEEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSC----FPNVFIASKLVSVVYASWSRVQADLNCMEDLLQSPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEHLWATLQ-------RASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q09324|GCNT1_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 1.627e-49
Identity = 113/351 (32.19%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG---------TYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-------LGDPDELDSGI----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTN E+V+ LK   G NN+E           +K R   +        I K   P     F G  + +V R +V ++ E+   + ++++  +   PDE  ++T+   P+  + GSF       L D + +   +    F G   N   +   S    RS+C+ G  DL+ ++   HLFA+KF     P A++CL++    K  E ++
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q5JCT0|GCNT3_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 5.481e-48
Identity = 106/341 (31.09%), Postives = 173/341 (50.73%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-------------YKNRDE-NIIPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL----------------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1183
            Y  +  DC  F   +K F+ +  +++E +F IAYS+V  E     ERLLR +Y P N YC+H+D KSS  F+ AV  +V C    + N+  +   V V  ++ S + ADLNCM++L +    WKY +N  G +FP+KTNAE+VK LK  KG N++E               Y+  D  ++  K +TP P  +  F G+ +++ +R+F+E +F +S  + +++++ +   PDE  ++TL          S++   D L     L                G  +N   +T  S    R++C+ G  DL+ ++ + HL A+KF        L+CLE++   K 
Sbjct:  103 YLRMTADCEHFKTKRK-FIQVPLSKEEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSC----FPNVFIASKLVSVVYASWSRVQADLNCMEDLLQSPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEHLWATLQ-------RASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q805R1|GCNT3_BHV4L (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bovine herpesvirus 4 (strain LVR140) OX=436506 GN=Bo17 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.874e-48
Identity = 107/350 (30.57%), Postives = 186/350 (53.14%), Query Frame = 2
Query:  215 ETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-----TYKNR-------DENIIP----KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDP----DELDSGIFLGRYK-NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1183
            E  K + P++D+  Y +I +DC +F   Q+ F+    +++E +F IAYS+V  E     ERLLR +Y P N YC+H+D KS   F+ AV  ++ C    + N+  +   V V  ++ S + ADLNCM++L +   +WKY +N  G +FP+KTNAE+V  LK  KG N++E      + KNR        + + P    K+  P  +  F G+ + + +R FV+ + ++   +++++++ +   PDE  ++TL   P   + GS    P     ++ +   L +++ ++G  + G+ +        R+ICI G  DL  ++ + HL A+KF        L+CLE++   K 
Sbjct:   93 EVKKKRPPLTDT-YYLNITRDCERFK-AQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISC----FPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVSWKYLLNTCGTDFPIKTNAEMVLALKMLKGKNSMESEVPSESKKNRWKYRYEVTDTLYPTSKMKDPPPDNLPMFTGNAYFVASRAFVQHVLDNPKSQILVEWVKDTYSPDEHLWATLQRAPW--MPGSVPSHPKYHISDMTAIARLVKWQYHEGDVSMGAPYAPCSGIHRRAICIYGAGDLYWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKA 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q9IZK2|GCNT3_BHV4V (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bovine herpesvirus 4 (strain V. test) OX=436507 GN=Bo17 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.122e-48
Identity = 107/350 (30.57%), Postives = 186/350 (53.14%), Query Frame = 2
Query:  215 ETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-----TYKNR-------DENIIP----KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDP----DELDSGIFLGRYK-NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1183
            E  K + P++D+  Y +I +DC +F   Q+ F+    +++E +F IAYS+V  E     ERLLR +Y P N YC+H+D KS   F+ AV  ++ C    + N+  +   V V  ++ S + ADLNCM++L +   +WKY +N  G +FP+KTNAE+V  LK  KG N++E      + KNR        + + P    K+  P  +  F G+ + + +R FV+ + ++   +++++++ +   PDE  ++TL   P   + GS    P     ++ +   L +++ ++G  + G+ +        R+ICI G  DL  ++ + HL A+KF        L+CLE++   K 
Sbjct:   93 EVKKKRPPLTDT-YYLNITRDCERFK-AQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISC----FPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVSWKYLLNTCGTDFPIKTNAEMVLALKMLKGKNSMESEVPSESKKNRWKYRYEVTDTLYPTSKIKDPPPDNLPMFTGNAYFVASRAFVQHVLDNPKSQILVEWVKDTYSPDEHLWATLQRAPW--MPGSVPSHPKYHISDMTAIARLVKWQYHEGDVSMGAPYAPCSGIHRRAICIYGAGDLYWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKA 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q8CH87|GCNT3_RAT (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.874e-47
Identity = 104/341 (30.50%), Postives = 168/341 (49.27%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI--------------IPKEQTPFP--VIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL----------------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKV 1183
            Y  +  DC  F   Q+ F+ +  +++E NF IAYS+V  E     ERLLR +Y P N YC+H+D KSS  F+ AV  +V C    + N+  +   V V  ++ S + ADLNCM++L +    W+Y +N  G +FP+KTNAE+VK LK   G N++E       +                  KE+TP P  +  F G+ +++ +R+F+E +  +S  + +++++ +   PDE  ++TL          S++   D L     L                G  +N   +T  S    R+IC+ G  DL+ ++ + HL A+KF        L+CLE++   K 
Sbjct:  103 YLSMTADCEHFK-TQRKFIQVPLSKEEANFPIAYSMVIHEKIENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSC----FPNVFIANKLVSVVYASWSRVQADLNCMEDLLQSPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEHLWATLQ-------RASWMPGSDPLHPKFDLSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2C9JUK0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.504e-81
Identity = 149/333 (44.74%), Postives = 209/333 (62.76%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDP--DELDSGI--FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQV 1243
            Y ++  DCT+F  ++ Y +  K T++EE+F IAYS++ ++    +ERLLR IYRP NYYCIH+D KS   F IAV  + +C    ++N+  +  R+ V   T SVL  +L CM++L+R F  WKYFINLTGQEFPL+TN ELV+ILK+Y+GAN++EGT K R    +P +  P  +   KG VHI VNR+FV++I      K +L ++ N   PDE FF+TLN+NPQ  I G++ G P  D  DS I  FL R+KN G+  C   +  R ICIL   DL +L  + H+FA+KF+    P A+ CLE+  Y+   +E+     +V  S Y SQ+
Sbjct:   79 YINLTTDCTRFKQSRGY-VTCKLTQEEEDFPIAYSLIIYKDVEMMERLLRAIYRPQNYYCIHVDKKSDQNFFIAVSAIAEC----FENVFIAPERLAVHWGTFSVLEPELVCMQQLWR-FRKWKYFINLTGQEFPLRTNWELVQILKSYRGANDLEGTIKRR----LPTD-PPHNITAIKGSVHIAVNRDFVDYILHHRTAKDLLDWVKNTSIPDETFFTTLNHNPQLGIRGTYKGVPETDNDDSMIKPFLTRFKNWGEKLCAGHWV-RGICILSTGDLPLLGRAKHMFANKFFLWEDPIAIGCLEEMIYNNTRDELSG--VKVFNSTYYSQL 397          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0B7AMK8 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF130617 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.220e-77
Identity = 143/340 (42.06%), Postives = 214/340 (62.94%), Query Frame = 2
Query:  245 DSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFL-NNQQFPDEQFFSTLNYNPQFRIAGSFLGDPD-ELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQ 1258
            D   Y ++  +C KF   + Y ++   T++EE F +A+SI+ F+    +ERLLR IYRP NYYC+H+D K+S+VF  A+  L KC    + N+I +  R+ V+ +T +VL  +L CM++L+ +F +WKYF  LTGQEFPLKTN ELVKI+ AY GAN++EGT K R      +   PF +   KG VHI VNRN+V+++  ++  KV+L+++  +  FPDE +F+TLN+NPQ  I GS+ G+P+ + ++  FL R+KN G   C S  + R+ICIL + DL  L ++ H FA+KFY       + CLE+  ++   +E   G      S+Y S  FVK++
Sbjct:  130 DEAAYINLTSNCNKFQTERGYIMS-SLTKEEEEFPLAFSILVFKEPEMVERLLRAIYRPQNYYCVHVDTKASDVFYNAMLGLSKC----FPNVIIASRRIDVQWATFTVLEPELLCMEDLW-QFPSWKYFFTLTGQEFPLKTNLELVKIMTAYDGANDLEGTIK-RANFERWRTIAPFGIRPIKGSVHITVNRNYVDYVLHNNTAKVLLEWVKRDTSFPDETYFATLNHNPQLGIRGSYKGEPETDEETKPFLTRFKNWGHLPCASGNYVRAICILSLGDLPQLYHAKHYFANKFYLAEDRIVIGCLEEKIFNDTRDEY-LGLKNFDASYYASLDFVKNK 461          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0B7AQP9 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF135715 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.250e-77
Identity = 145/344 (42.15%), Postives = 205/344 (59.59%), Query Frame = 2
Query:  245 DSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFL-NNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGI--FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVK---ESFYTSQVFVKHQ 1258
            D   Y ++  DC  F+  + Y L+   T++EE F +A SI+ F+    +ERLL+ IYRP NYYC+H+D KS + F  AV  +  C    + N+  +  R+ V+    SVL  +L CMKEL+R +  WKYF++LTGQEFPLKTN+ELVKI  AY GAN+IEGT K  ++    +   P  +   KG VHI VNR+FV +I  +   K++L+++  +   PDE FF+TLN+NPQ  I GS+ G+P+   S +  FL RYKN G   C S  + R ICIL + DL  L N+ H FA+KFY       + CLE    +K+  + +  Y  VK    +FY +  FVK++
Sbjct:  129 DDAFYLNLTTDCNSFVTTRGYILS-TLTKEEEEFPLAVSILVFKEVEMVERLLKAIYRPQNYYCVHVDYKSPDTFYRAVSAIANC----FPNVFLTSRRIDVQWGWFSVLEPELQCMKELWR-YPKWKYFLSLTGQEFPLKTNSELVKIFTAYDGANDIEGTIKRANKERF-RSTPPLGIRPVKGSVHITVNRDFVGYILHNETAKILLEWVKKDTSVPDEAFFATLNHNPQLGIRGSYKGEPETDWSTLKPFLTRYKNWGSSNCASGVYVRGICILSLGDLPSLGNARHYFANKFYLSQDRVVIGCLE----EKIFNDTRDEYLGVKTFDTTFYANLGFVKNK 461          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P154 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12288 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.174e-75
Identity = 140/345 (40.58%), Postives = 198/345 (57.39%), Query Frame = 2
Query:  227 PKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRD-ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPD-ELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKH 1255
            P +P    K    + ++C  F+    + +N   TE+E NF IAYSI+ F+ A Q+ +LL+ IYRP N YCIH+D K+   +   +  +  C H    N+  +   V V   T +VL  +L CMK+L+  F  WKYFINLTGQEFPL+TN ELV+IL AY GAN++E   K  + E       TP  +I  KG VHI+VNR+FV+++  S + +  L +      PDE FF++LN+NPQ  I GS+ G P+ +  +  FL R+KN G + C    FNR ICIL   DL +L   P +FA+KFY+ +   AL CL +  Y+   +E   G      S+Y +  FVK+
Sbjct:   28 PALPTE--KDITRLAKNCRNFVRVYGFIMNFL-TEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADCFH----NVFLTSRSVDVRWGTFTVLEPELICMKDLWH-FKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIIPVKGSVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWGDYPCAEGNFNRDICILSTGDLPLLDTRPEMFANKFYQDYSRVALECLHERLYNHTRDEF-LGMMEFNTSYYQNVSFVKN 363          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P139 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12289 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 8.408e-75
Identity = 137/332 (41.27%), Postives = 195/332 (58.73%), Query Frame = 2
Query:  266 IHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRD-ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPD-ELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKH 1255
            + ++C+ F+    + +N   TE+E NF IAYSI+ F+ A Q+ +LL+ IYRP N YCIH+D K+   +   +  +V C H    N+  +   V V+  T +VL  +L CMK+L+  F  WKYFINLTGQEFPLKTN ELV+IL AY GAN++E T +  + E        P  +I  KG VHI+VNR+FV+++  S + +  L +      PDE FF++LN+NPQ  I GS+ G P+ +  +  FL R+KN  QF C      R ICIL   DL +L   P +FA+KFY+ +   AL CL +  Y+   +E   G      S+Y +  FVK+
Sbjct:   39 LAKNCSNFVRVYGFIMNFL-TEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIVDCFH----NVFLASRSVDVQWGTFTVLEPELICMKDLW-PFKKWKYFINLTGQEFPLKTNFELVRILTAYNGANDVESTTETANKERWASAGPAPHGIIPVKGAVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWRQFPCAEEMRIRQICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHTRDEF-LGMMEFDTSYYQNVSFVKN 363          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001873.1:355693:357685:-1 gene:ENSAMXG00000033034.1 transcript:ENSAMXT00000050168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 1.726e-52
Identity = 119/382 (31.15%), Postives = 195/382 (51.05%), Query Frame = 2
Query:   98 NFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-------TYKNRDENII----------PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFR--IAGSFLGDPDELDSGIFLGRYK-NKGQFTC------GSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            ++LVF +       DS N D I      +  ++  +   + +K +  ++D   Y ++ QDC +F   +KY +    + +EE F +AYSIV        ERLLR+IY P N+YCIH+D K+S     A+   V C    + N+  +     V  ++ S + AD+NCMK+LY+    WKYFINL GQ+FP+KTN E+V+ LK   G N++E         Y+ +  +I+           K+  P  +  F G  +I+V+R F+ F+ E    + ++ +  +   PDE  ++T+   P     I      D  ++++   L ++  ++G+F        G+    R+IC+ G+ DL  ++   HLFA+KF   F P A+RCLEK
Sbjct:   35 SWLVFGD--DGTPEDSCNCDNIIVGDINEIDRAKILTITKVFKNQTKMTDEH-YIELTQDCERFRVTRKY-MPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGAIQYTNEAKKPPPSRIKMFSGGAYIVVSRAFIRFVLEDPKAQELISWSKDTYSPDEFLWATMQRIPGVPGYIRAHHKFDRSDMNTISRLIKWAGHEGEFDAVYPPCQGTHV--RAICVYGVGDLQWMLQQDHLFANKFDTDFDPIAIRCLEK 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000026751.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:103024919])

HSP 1 Score: 181.415 bits (459), Expect = 8.641e-52
Identity = 122/392 (31.12%), Postives = 196/392 (50.00%), Query Frame = 2
Query:   68 IYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-------TYKNRDENII----------PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFR--IAGSFLGDPDELDSGIFLGRYK-NKGQFTC------GSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            + Y    K  ++LVF +       DS N D I     ++   +  +   + +K +  ++D   Y ++ QDC +F   +KY +    + +EE F +AYSIV        ERLLR+IY P N+YCIH+D K+S     A+   V C    + N+  +     V  ++ S + AD+NCMK+LY+    WKYFINL GQ+FP+KTN E+V+ LK   G N++E         Y+ +  +I+           K+  P  +  F G  +I+V+R F+ F+ E    + ++ +  +   PDE  ++T+   P     I      D  ++++   L ++  ++G F        G+    RSIC+ G  DL  ++   HLFA+KF   F P A+RCLEK
Sbjct:   31 VIYRKTQKDYSWLVFGD--DGTPEDSCNCDNIIVGDIEEIKHAKLLTITKVFKNQTKMTDEH-YIELTQDCERFRVTRKY-MPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGDIHNTNEAKKPPPSGIKMFSGGAYIVVSRVFIRFVLEDPKAQELILWSKDTYSPDEFLWATMQRIPGVPGYIRAHHKFDRTDMNTISRLIKWVYHEGDFDAVYPPCQGTHV--RSICVYGAGDLQWMLQQDHLFANKFDTDFDPIAIRCLEK 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 160.999 bits (406), Expect = 4.158e-44
Identity = 102/325 (31.38%), Postives = 167/325 (51.38%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENI------IP------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-LGDPDELD----SGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            DC +++  + Y  ++  T++E+NF +AYS+V  ++   +ER++R IY P N YCIH D KSS  F  AV  L KC    + NI  +     VE + ++ L ADLNC+ +L      WKY INL GQ+FPL++N ELV+ LK   GAN +E +           ++++ +++      +P      K   P  +  F G  + +++R+FV ++  + + K  L +  +   PDE F++TL   P   + G     +PD  D    + +    Y     +   +    RS+CI G  +L  L++  H FA+KF     P  ++CLE+
Sbjct:  101 DCPRYVKARGYS-DISVTDEEKNFPLAYSLVVHKNMPMVERIIRAIYAPTNIYCIHYDQKSSESFIAAVKNLAKC----FPNIFIASKLESVEYAHITRLNADLNCLSDLMSSEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQDVPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQVAKDFLDWSADTYSPDEHFWATLARVPG--VPGEIPRSEPDVTDLKSKTRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWLLDDGHWFANKFDPKVDPVLIKCLEE 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 157.918 bits (398), Expect = 5.668e-43
Identity = 98/331 (29.61%), Postives = 158/331 (47.73%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNR--------DENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVI--LQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS---------GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKW 1168
            Y    +DC  ++ +++ FL    + +E +F IA+S+V  E     ERLLR IY P N YC+H+D KSS  F  AV  +  CL     N+  +     V  ++ S + AD+NCM++L +    W+Y +N  G +FP+KTNAE+V+ LK   G N++E    N           N+        I K   P     F G+ + +V+R FVE +F S  P+++  +++  +   PDE  ++TL   P    +    G  DE D              G  +    +   +     ++C+ G  D+  ++   HLFA+KF       A++CLE +
Sbjct:   90 YLSATKDCPAYI-SERGFLTTPLSIEERDFPIAFSMVIHEKIEMFERLLRAIYSPQNIYCVHVDTKSSKEFMEAVKAITSCL----PNVFVASKLESVVYASWSRVQADINCMQDLLKSSVQWRYLLNTCGADFPIKTNAEMVRTLKQLNGRNSMESEATNDYKKQRWVYQHNVTTSVIRTSIKKTDPPIKSPMFTGNAYFVVSREFVEHMFSS--PEILNFMEWEKDTYSPDEHMWATLQRMPNMPGSNPPNGKYDESDMLAIARLVKWSYLEGDLRKGAPYPPCTGAHRHAVCVYGAGDIKWIVRQKHLFANKFDPEVDDIAIKCLEAY 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4b (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4-like [Source:NCBI gene;Acc:103021884])

HSP 1 Score: 153.68 bits (387), Expect = 2.029e-41
Identity = 105/339 (30.97%), Postives = 166/339 (48.97%), Query Frame = 2
Query:  233 VPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-------------TYKNRD----------ENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSF-LGDPDELD----SGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            VP+ + +   +   DC ++L ++  F +++ ++ E  F +AYS+V  + A+ +ER+L  IY P N YCIH D KSS  F  A+  L  CL     N+  +     V+ ++++ L ADLNC+ +L      W+Y INL GQ+FPL++N ELV+ LKA KGA+ +E              +Y  +D          +    K   P  +  F G  +  ++R FV F+  S + K  L +  +   PDE F++TL   P   + G     DPD  D    + +   +Y     +   +    RS+CI G  +L  L+N  H FA+K      P  + CLE+
Sbjct:   77 VPMLEDEDIANATLDCPRYLASRG-FHSIRTSQIEREFPLAYSLVVHKEAAMVERILWAIYVPHNSYCIHYDLKSSPEFMAAMQGLALCL----PNVFIASKLERVQYASITRLRADLNCLSDLMESKVKWRYVINLCGQDFPLRSNVELVEELKALKGASMLETARPSPLKKRRFSFSYTLKDVGSQYHQHPMKTDQAKSPPPHKLEMFVGSAYFTLSREFVSFVQWSPMVKDFLSWSEDTYSPDEHFWATLIRVPG--VPGELSRSDPDVSDLASRTRLVKWQYLEGKLYPACTGVHIRSVCIYGAGELRWLLNDGHWFANKLDPRVDPVLVECLEE 408          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 179.874 bits (455), Expect = 2.002e-52
Identity = 120/350 (34.29%), Postives = 180/350 (51.43%), Query Frame = 2
Query:  206 EFGETWKPK----VPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE----GTYKN----------RDENIIPKEQ--------TPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL-GDPDELDSGIFLGRYKN-KGQF--TCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            E G+T K +    V ++D  +   + +DC  FL  +KYF      E E +F IAYSIV  ++A+ LERLLR I+ P N YC+H+D KSS  F+ AV  L KC    + N+  +     V  + +S L AD+NC+ +L +    WKY INL GQ+FPL++N ELV  LK+ +G + +E      YK           R ++ +P  Q         P  +  F G  + +++R FV F   S++    L++  +   PDE F++TL  +PQ    G     D  +L S   L ++   +G+    C  R   RS+CI G  +L  L+   H FA+KF  H  P  ++CLE+
Sbjct:   14 EIGKTLKIRRKTIVDLTDEDMLL-LTEDCPVFLETRKYFSKHVSAE-ERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHV-RSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEE 356          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 179.489 bits (454), Expect = 2.539e-52
Identity = 120/350 (34.29%), Postives = 180/350 (51.43%), Query Frame = 2
Query:  206 EFGETWKPK----VPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE----GTYKN----------RDENIIPKEQ--------TPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFL-GDPDELDSGIFLGRYKN-KGQF--TCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEK 1165
            E G+T K +    V ++D  +   + +DC  FL  +KYF      E E +F IAYSIV  ++A+ LERLLR I+ P N YC+H+D KSS  F+ AV  L KC    + N+  +     V  + +S L AD+NC+ +L +    WKY INL GQ+FPL++N ELV  LK+ +G + +E      YK           R ++ +P  Q         P  +  F G  + +++R FV F   S++    L++  +   PDE F++TL  +PQ    G     D  +L S   L ++   +G+    C  R   RS+CI G  +L  L+   H FA+KF  H  P  ++CLE+
Sbjct:   13 EIGKTLKIRRKTIVDLTDEDMLL-LTEDCPVFLETRKYFSKHVSAE-ERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHV-RSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEE 355          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 166.392 bits (420), Expect = 9.347e-47
Identity = 110/371 (29.65%), Postives = 185/371 (49.87%), Query Frame = 2
Query:  167 ENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIE---------GTYKNRDENI--------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLG----DPDELDSGIFLGRYK-NKGQFTCGSRF------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEI 1195
            E + +  I +  +EF + W+    +++S+  + + +DC  F  +++Y + +  +E+E  F IAYS+VA      LERLLR IY P N YC+H+D KS   ++ AV  L  C    + N+  +  +  V  ++   + ADLNCM++L      WKYFINL G +FP+KTN E+V+ L+A  G N++E         G ++ R E +          K   P P   F G+ +I+V R FVE +      + ++++  +   PDE  ++TL   P   + GS       D +++ +   L R+   +G    G+ +        R+ICI   +DL  ++   HLF +K        A+ CLE++   K   ++
Sbjct:   68 ERWAEASILTKTVEFRKRWR----LNESECVR-MTRDCDAFKRDRRY-VTVPLSEEEAAFPIAYSVVAHHRVDMLERLLRAIYAPQNVYCLHVDQKSPPPYQEAVRALAAC----FPNVFMASRQERVVYTSWLRVQADLNCMRDLVAAPQPWKYFINLCGLDFPIKTNLEMVRALRALNGENSMESMHTPGGKVGRWQIRHEIVNDGLRSTGEKKSPPPIPTPMFSGNAYIVVTRAFVEHVLSDPTARALMEWEKDTFSPDEHLWATLQRLPG--VPGSTPPHDKYDVEDMMAIARLVRWSYMEGDTLQGAAYPPCRGTHMRAICINSAKDLAWVLKQRHLFVNKLDSDVDELAVHCLERYLRRKALRQV 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 162.925 bits (411), Expect = 1.927e-45
Identity = 101/338 (29.88%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  272 QDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKEL--YRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI-----------------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDP-DELDSGIFLGRYKN----KGQFTCGSRFFN-------RSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEE 1192
            +DC  F   ++Y L +  + +EE F IAYS+VA      LERLLR +Y P N YC+H+DAKS   +  A   L  C    + N+  + +   V  ++ S + ADLNCM EL    +   W+YFINL G++FP+KTN E+V+ L+   G N++E     R +                   + K   P P   F G  +++V R FVE +      + ++++  +   PDE  ++TL   P   + GS       ++     L R       +G    G   +        R +C+ G  DL  ++   HLFA+K        A+ CLE     K   E
Sbjct:  101 RDCDAFRRARRYVL-VPLSREEEAFPIAYSVVAHHRVDMLERLLRAVYAPQNLYCLHVDAKSPRAYLEAARALAAC----FPNVFVAAHLERVVYASWSRVQADLNCMSELVAMAERVPWRYFINLCGRDFPIKTNLEMVRALRTLNGRNSLETVRMPRGKRARWTLSYKVAGNEIRSTGLTKRPPPIPTPMFAGSAYVVVTRAFVEHVLSDPAARALIEWAGDTYSPDEHLWATLQRMPG--VPGSTPAHRIHDVTDAAALARLVKWSAFEGDVAGGGAAYPPCRGTHVRDVCVYGAGDLAWVLRQHHLFANKVDTAVDHVAVHCLEHHLRKKALAE 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 144.05 bits (362), Expect = 7.383e-39
Identity = 100/328 (30.49%), Postives = 149/328 (45.43%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILK-AYKGANNIEGTY------------------KNRDENI---IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEE 1192
            +C+ F+  Q Y       E E++F +AY I   +       L R IY P N YCIH+D KSS  F+ ++  L  C    + N+  +     V  +  S L AD+NCM++L  + T WKY +NL GQ+FPL+TN E+V+ILK  ++G N   G +                  K++ + I   + K   P  +    G  +  V R FV+++ +    + +L++      PDE +F TLN  P     G+      E ++     R   K    C   +  R IC+ G  DL  L     LFA+KF     P  L CLE W   +   E
Sbjct:   70 NCSAFIEKQSYITEALSKE-EQDFPLAYIITVHKDFETFSILFRNIYMPQNIYCIHVDVKSSESFKKSMQRLAGC----FDNVFLASRSETVVYAGFSRLKADINCMRDLATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVLDDKKAQDLLEWSQETFSPDEHYFVTLNSLPD--APGANTVPSWEGNTRAVKWRDGEKTHKGCKGHYV-RDICVYGEGDLEWLTKRSDLFANKFEMQRYPLVLECLEHWARQRTLNE 389          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 154.836 bits (390), Expect = 9.400e-44
Identity = 97/280 (34.64%), Postives = 147/280 (52.50%), Query Frame = 2
Query:  326 TEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGT-----------YKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLI---NSPHLFAHKF 1123
            T  E +F IAY I+ ++     ERLL+ +Y P NYYCIHID K+++ F  A   +V CL     N+  ++ RV V+   +S++ A+L+CM EL  +   WKY+INL GQ+FPL  N E+V++LK+  G NNIE             +    + ++ K   P  +I  KG VH I+ R F EF+    + + +L++L +    DE FF+TL Y+      G   G   E      + R K      C  R+  R+IC + I+DL  ++   N+  LF +K 
Sbjct:   13 TRTELDFPIAYGILIYKGLPLFERLLQALYMPQNYYCIHIDKKTNSYFVDAAQRMVACL----PNVFIAKTRVNVKWGEISLVKAELSCMTEL--QTFKWKYYINLVGQDFPLYNNMEIVRVLKSLHGLNNIESIEMPAYNVHRVEFVRHGQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVLRDKVARDLLKWLEDVFAADEIFFATLQYDQA--TPGGIHGQQPEC-----IARVKRWRPGYCAGRYV-RNICWIDIRDLTWVLSEGNNRKLFVNKI 278          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO37446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS7])

HSP 1 Score: 145.976 bits (367), Expect = 3.625e-40
Identity = 90/294 (30.61%), Postives = 146/294 (49.66%), Query Frame = 2
Query:  335 EENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEG-----TYKNRDENI---------IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLI---NSPHLFAHKFYEHFQPGALRCLEK 1165
            E +F +A+ I+ +      ERLL+ IY P N YCIHID K+   F  AV +++ CL     N+  +   V V     S++ A +NC++ L +    WKY++++ GQ+FPL TN E+V+ +K     NN+E      + ++R E +         I K   PF +   KG++H ++ R FVEF+ ES I    + + N+   PDE FF+++  +P     G  +GD       +    + ++    C  R   R +C + I+DL  ++   N   LF HK    +    L CL +
Sbjct:    2 ERDFPLAFGIMIYNGLPLFERLLQEIYMPHNVYCIHIDRKTRQSFHKAVKQMISCL----PNVFIASKLVKVYWGEFSIVQAKMNCLRNLLKSPVKWKYYLHMIGQDFPLYTNHEMVRAIKTLNYTNNMESIKVPISNRDRTEYVYIGSRTRTKILKPPPPFNITLRKGNIHAMLTRGFVEFLLESEIANAFIDWCNDTSVPDETFFASMQNHPG--APGGVVGDQPPYIFKLIRWYWFDR----CYGRII-RQVCWIDIKDLRSVLSQFNLSFLFVHKIPFDYDIELLDCLSQ 284          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 54.299 bits (129), Expect = 7.764e-8
Identity = 55/225 (24.44%), Postives = 93/225 (41.33%), Query Frame = 2
Query:  311 LNLKETEDEENFRIAYSIVAFESA-SQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKEL-YRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGAN----------------NIEGTYKNRDENI--IPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKV--ILQFLNNQQFPDEQFFST 919
            LN K        RIAY +     A  Q+ RL + IY   +Y+  HID +S +     V  ++K     + N   +   +       ++L   L  M++L  RK   W +FINL+G +FP+K N  L   L++++  N                 ++ T+   DE++  +   + P  +    G   I +NR + +++  S    V  +         P E FF T
Sbjct:   67 LNDKSAAYGPPIRIAYVLSLHGRALRQIRRLFKVIYHTHHYFYFHIDTRS-DYLRREVSNMIK----DFPNAALAPWSMATIWGGATLLQMLLKSMEDLIARKEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDELVTGLKHMYRYTLLPAESFFHT 286          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:NCBI gene;Acc:101155272])

HSP 1 Score: 165.622 bits (418), Expect = 7.059e-46
Identity = 104/350 (29.71%), Postives = 169/350 (48.29%), Query Frame = 2
Query:  191 KSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKN-------------RDENII----PKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFL---------GRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLE 1162
            ++PE++     + +  +   + Y +  +DC  F+  ++ F+    +E+E+ F IAYS+V  E     ERLLR IY P N YC+H+D KSS  ++ AV  +V C    + NI  +     V  ++ S + ADLNCMK+L      WKY +N  G +FP+KTN E+V  LK   G N++E    N              D ++I     K   P     + G+ + IV+R FV+ + +    + ++ +  +   PDE  ++TL   PQ   +  F    D  D   F          G  +    +   +  + R++C+ G+ DL  L+ + HLFA+KF       A+RC+E
Sbjct:   61 QNPELDLLLVSRERKSLLSEEFYLNATKDCPAFI-AKRGFITEPLSEEEKKFPIAYSMVIHEKIEMFERLLRAIYAPQNVYCVHVDQKSSPEYQTAVKRIVSC----FPNIFIASKLERVVYASWSRVQADLNCMKDLLNSDVPWKYLLNTCGTDFPIKTNREMVSALKLLNGRNSMETEVTNDYKKGRWEYHHNVTDTSVIRTGVKKSPPPISSPMYSGNAYFIVSRAFVKHLMKDEEAQRLIDWEKDTYSPDEHLWATLQRMPQVPGSLPFNSKYDTSDMLAFARAVKWVYHTGDVRKGAPYPPCTGTYRRAVCVYGVGDLLWLLQTHHLFANKFDPEVDDIAIRCME 405          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000007218.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:101157299])

HSP 1 Score: 158.688 bits (400), Expect = 2.815e-43
Identity = 105/358 (29.33%), Postives = 173/358 (48.32%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIP-----------------------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRF------------FNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            ++ +SD + Y +  +DC  F+  +KY +    +++EE+F +AYS++        ERLLR IY P N+YC+H+D K+    E +V   +  + S + N+      V V  +    + ADLNCM +LY     WKYF+NL GQ+FPLKTN E+V+ILK   G N++E       EN+ P                       K  +PF +    G+ +I+ +R ++  +      + +++++ +   PDE  ++T+   P   + GS   +     S I       K Q+  GS+               R+IC+ G  DL  L+ + H FA+KF     P A+ CLE++   K   E++
Sbjct:   84 RIKISD-EYYINATEDCRLFIKTRKY-ITFPLSKEEEDFPLAYSMIVHHKVQNFERLLRAIYAPQNFYCVHVDKKA----EPSVFAAILAISSCFPNVFLVSQSVDVVYAGWPRVQADLNCMADLYNTSRRWKYFLNLCGQDFPLKTNLEMVRILKTLNGGNSMES------ENMPPEKKWRVTNAHQIVDGKIQAKGEAKSPSPFNLPIMSGNAYIVASRGYIHSVLHDKRIQALIEWMKDTYSPDEAIWATIQRIPG--VPGSTRPNRKYDVSDINALARLVKWQWHEGSQDSLDALYPVCHGNHVRAICVYGAGDLQWLLENHHFFANKFDTDTDPIAIYCLERYLRKKALAELE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 153.68 bits (387), Expect = 2.213e-41
Identity = 119/396 (30.05%), Postives = 196/396 (49.49%), Query Frame = 2
Query:   92 MLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKS-PEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKIL--KAYKGANNIEGT-----YKNRDE---------NIIPKEQTPFPV-----IWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNY---NPQFRIAGSFLGDPDELDSGIFLGRYKNK-GQFTCGSR-FFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIK 1198
            +++F+ F   I +      + D  C NF  +     P +E    W  +     + + +D +Q C + L    +F+    +++EE++ +A+ +   +      R LR IY P N YCIHIDAK+   ++  V  LV C    ++NI  S     V     S L ADLNCMK+L R    WK  +NL GQ+FP+K+N ELV+ +  K ++  N   G       ++R E         ++I K +   P      I+F G  +  + R FV+F+ +S I   +L++  +   PDE ++ TLN+    P  R+ G + GD       I   ++K++ G    G +  + R IC+ G+ D+  +IN+ ++FA+KF  +  P AL CLE+W+  KV  + K
Sbjct:   21 IVSFIYFKTRIPTDLKHLQSSD--CRNFSNECRPILPGLETAAQWYRRDCQVVNHILKD-NQPCVE-LIRDLHFITRPLSQEEEDYPLAFIMTIHKDLEMFVRTLRAIYMPQNVYCIHIDAKAPLEYKKVVRGLVGC----FENIFLSSQSETVTYGGYSRLQADLNCMKDLIRSNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPPPDNLQIYF-GTAYYALTRAFVDFVLKSPIALNLLKWSKDAYSPDEHYWVTLNHLKEAPGSRVDGGWEGD-------IRAIKWKDQEGTNHQGCKGHYVRDICVYGMGDIEWIINNNNMFANKFESNAYPEALDCLEQWHRSKVLNQAK 400          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: si:dkeyp-87d8.8 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:101166645])

HSP 1 Score: 148.288 bits (373), Expect = 2.336e-39
Identity = 110/370 (29.73%), Postives = 174/370 (47.03%), Query Frame = 2
Query:  239 VSDSKLYQDIHQDCTKFLFNQKYFLNLKETED------EENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENI--------------------IP------KEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGD-PDELD----SGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTS 1237
            +  +K  +D  +   +F  N   F+ ++  +D      E++F +AYS+V  ++A  +ERLLR  Y P N YCIH D KS+  F  A+  L +CL     N+  +  R  V  +++S L ADLNC+ +L      WKY INL GQ+FPLK+N ELV  L+   G+N +E +   R  NI                    +P      K   P  +  F G+ + +++R F+  +  S I      +  +   PDE F++TL   P F   G    + PD  D    + +    Y     +   +    RS+CI G  +L  L+N  H FA+KF     P  ++CLE    +++ E+ +S + R   + + S
Sbjct:   76 IRKNKEREDTDESLAEFTENCPSFIKIRGYDDVCFSDQEKDFPLAYSLVVHKNAWMVERLLRATYSPVNVYCIHYDQKSTPQFTAAMEGLARCL----PNVFIASKRESVFYASISRLQADLNCLHDLVESEVKWKYVINLCGQDFPLKSNMELVSELRKLNGSNMLETS---RPSNIKKDRFSFHHELKDASFEYQKLPVRTDQAKSPPPHGIEMFIGNAYFVLSREFILHMTSSVIAMDFFDWSKDTYSPDEHFWATLVRVPGF--PGEVAREKPDITDLMSKTRLVKWSYLEGSLYPLCTGEHVRSVCIYGCGELRWLLNYGHWFANKFEPKVDPVLIQCLE----ERLEEKQRSLFTRTSLTCHKS 432          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: xylt1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049390])

HSP 1 Score: 67.3958 bits (163), Expect = 1.751e-11
Identity = 58/217 (26.73%), Postives = 101/217 (46.54%), Query Frame = 2
Query:  347 RIAYSIVAFESAS-QLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYR-KFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHI---------------------IVNRNFVEFIFES--SIPKVILQFLNNQQFPDEQFFSTL 922
            RIA+ +V    AS Q +RL + IY   ++Y IH+D +S+ +        V+ +  KY N+  +  R+       S+LT  L  M +L   +  +W +FINL+  ++P++TN +LV  L  Y+  N I+     RD     ++Q     ++F+ D H+                     ++NR FV+++  S   +   + +F      P E FF T+
Sbjct:  305 RIAFVLVIHGRASRQFQRLFKAIYHTSHFYYIHVDQRSNYLHR-----QVQIMAMKYPNVRVTPWRMATIWGGASLLTMYLRSMADLLAMRDWSWDFFINLSAADYPIRTNNQLVAFLSKYRDMNFIKS--HGRDNARFIRKQG-LDRLFFECDTHMWRLGDRKIPEGISVDGGSDWFLLNRMFVDYVINSKDDLVTSMKRFYAYTLLPAESFFHTV 513          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000043063.1 (SMESG000043063.1)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 406/407 (99.75%), Postives = 407/407 (100.00%), Query Frame = 2
Query:   56 MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL 1276
            MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGI+LGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL
Sbjct:    1 MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIYLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL 407          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000043068.1 (SMESG000043068.1)

HSP 1 Score: 476.863 bits (1226), Expect = 7.335e-167
Identity = 229/398 (57.54%), Postives = 294/398 (73.87%), Query Frame = 2
Query:  104 LVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKP--KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGI-----FLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYVRPTL 1276
            ++FTN I  IQSD +  D  C       +   ++E+ +TW+P      +DS++YQ+IHQ+C+ FL NQ YFL    T +EENFRIA++IV F+S SQ+ERLLRTIYRPWNYYCIHID KS   F  A+ ELVKCL+S+YKNIIN+ENRV V+   MSVLTADLNCMKELY +F +WKY INLTGQEFPLKTN ELVKILKAYKGANN+EGTYK R+E  +P  + PFP+IW+KG VH+ VNR+F++FIF S   + +L+ L  Q  PDEQFF+TLN+NPQFRI GSF+GDPD+L+        F+ RYKN G++TC S+   R ICI G+ D+  L+  PHLF +KFYE FQP  LRC+E+WYYDK+ +EI++    + E+FY++  FV HQ++ PTL
Sbjct:   19 ILFTN-IPFIQSDQNTID--CAALLHSNVNQKKLEYAKTWQPLRNESFTDSQMYQNIHQNCSNFLENQNYFLQFPNTTEEENFRIAFTIVTFKSGSQIERLLRTIYRPWNYYCIHIDKKSDKKFTEALEELVKCLNSRYKNIINTENRVDVQWGKMSVLTADLNCMKELYERFKDWKYLINLTGQEFPLKTNKELVKILKAYKGANNLEGTYKRRNEYRVPTVKMPFPLIWYKGSVHVTVNRDFIKFIFGSPKSQDLLKALKGQHVPDEQFFATLNHNPQFRIPGSFIGDPDDLELEKQPLINFMTRYKNWGEYTCESKLIVRGICIWGVGDIPKLVKVPHLFTNKFYEDFQPATLRCMEEWYYDKINKEIQNNGVNINETFYSTLPFVVHQFIPPTL 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 440.269 bits (1131), Expect = 3.533e-152
Identity = 217/392 (55.36%), Postives = 284/392 (72.45%), Query Frame = 2
Query:  104 LVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS-----GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYV 1264
            L+F NL  ++   + NE L   +  K  I S        W P    +D ++YQ I++ C+ F+ N+KY L  + +++E++FRIA+SIV +++ASQ+ERLLRTIYRPWNYYCIH+D KS   F  A+G+L +CL+SK+ N+IN++NRV V+   MSVLTADLNCMKELY+++ NWKYFINLTGQEFPLKTNAELVKILKA+KGAN++E  YK R +N IP  + PFP+IW+ G VHIIVN +FV FIFES + KV+L  LNN   PDE FFSTLNYNPQ RI+GS++G+PDE+ S     G    RYKN GQ+ C S+   R ICILG+ DL  ++N+P+LFA+KFYE FQP  LRCLE+W YDKV +E + G A + +SFY    FVK +Y+
Sbjct:   36 LIFANLNIALTEPNCNE-LFRTDISKSVINS---SINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLK-ELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYI 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 440.269 bits (1131), Expect = 3.616e-152
Identity = 217/392 (55.36%), Postives = 284/392 (72.45%), Query Frame = 2
Query:  104 LVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS-----GIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYV 1264
            L+F NL  ++   + NE L   +  K  I S        W P    +D ++YQ I++ C+ F+ N+KY L  + +++E++FRIA+SIV +++ASQ+ERLLRTIYRPWNYYCIH+D KS   F  A+G+L +CL+SK+ N+IN++NRV V+   MSVLTADLNCMKELY+++ NWKYFINLTGQEFPLKTNAELVKILKA+KGAN++E  YK R +N IP  + PFP+IW+ G VHIIVN +FV FIFES + KV+L  LNN   PDE FFSTLNYNPQ RI+GS++G+PDE+ S     G    RYKN GQ+ C S+   R ICILG+ DL  ++N+P+LFA+KFYE FQP  LRCLE+W YDKV +E + G A + +SFY    FVK +Y+
Sbjct:   37 LIFANLNIALTEPNCNE-LFRTDISKSVINS---SINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLK-ELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYI 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000008883.1 (SMESG000008883.1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.652e-151
Identity = 218/388 (56.19%), Postives = 276/388 (71.13%), Query Frame = 2
Query:  110 FTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPV----SDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQY 1261
            F NL  SIQS   +    C    K  +++  ++  E W   VP+    +DS+L Q+IH  C  FL N+ Y  N   +++E+NF +++SI+AF+S+SQ+ERLLRTIYRPWNYYCIH+D KS   F  A+  LV CL+SKY NI+N++NRV V+   MSVLTADLNCMKELY K+ +WKYFINLTGQEFPLKTNAELVKIL AYKGANN+EG YK R+E  IP  + PFPV+WFKG VHI VNR+FV FIFES   K +L  + +Q  PDE FFSTLNYNPQ RI GS++G+PDE+ S  F+ RYKN GQ+ C S    R ICI G  DL  L+ +P+LFA+KF+E FQP  LRCLE+W +DKV +E ++G   +   FY+S  FVK+QY
Sbjct:   39 FKNL--SIQSSEPD----CYELLKPNVENKSLQDAEKWV--VPLNDTLTDSQLLQNIHSSCDTFLSNKNYASN-HPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKNRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFVAFIFESPKSKTLLNIVKSQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQY 417          
The following BLAST results are available for this feature:
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT15.245e-4731.50glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT15.245e-4731.50glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT15.245e-4731.50glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT31.160e-4528.61glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT31.160e-4528.61glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-176.560e-3732.51GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-162.356e-3427.55GLY-16; GLYcosylation related [Source:UniProtKB/T... [more]
gly-181.573e-3126.90GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-13.180e-2926.37GLY-1; GLYcosylation related [Source:UniProtKB/Tr... [more]
gly-159.167e-2929.03GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt2.046e-1326.22gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-87d8.86.368e-4633.07si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
gcnt33.390e-4430.65glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
si:dkeyp-87d8.86.664e-4435.44si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
gcnt31.989e-4330.67glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt32.120e-4330.67glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnksr23.204e-4932.84connector enhancer of kinase suppressor of Ras 2 [... [more]
ccdc772.277e-4632.24coiled-coil domain containing 77 [Source:Xenbase;A... [more]
slc24a46.533e-4632.22solute carrier family 24 member 4 [Source:Xenbase;... [more]
gcnt2.21.139e-4132.91glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
adsl6.685e-4131.86adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcnt12.326e-5032.19glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt12.326e-5032.19glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt12.326e-5032.19glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt12.326e-5032.19glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt37.835e-4931.09glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09324|GCNT1_MOUSE1.627e-4932.19Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q5JCT0|GCNT3_MOUSE5.481e-4831.09Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q805R1|GCNT3_BHV4L7.874e-4830.57Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q9IZK2|GCNT3_BHV4V8.122e-4830.57Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q8CH87|GCNT3_RAT1.874e-4730.50Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JUK01.504e-8144.74Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0B7AMK81.220e-7742.06Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0B7AQP96.250e-7742.15Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7P1541.174e-7540.58Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1398.408e-7541.27Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050168.11.726e-5231.15pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026751.28.641e-5231.12glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt4a4.158e-4431.38glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt35.668e-4329.61glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt4b2.029e-4130.97beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt4a2.002e-5234.29glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a2.539e-5234.29glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt39.347e-4729.65glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt31.927e-4529.88glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT27.383e-3930.49glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396179.400e-4434.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374463.625e-4030.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368357.764e-824.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt37.059e-4629.71glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
ENSORLT00000007218.22.815e-4329.33glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt72.213e-4130.05beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
si:dkeyp-87d8.82.336e-3929.73glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
xylt11.751e-1126.73xylosyltransferase 1 [Source:NCBI gene;Acc:1000493... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043063.10.000e+099.75SMESG000043063.1[more]
SMESG000043068.17.335e-16757.54SMESG000043068.1[more]
SMESG000051787.13.533e-15255.36SMESG000051787.1[more]
SMESG000051787.13.616e-15255.36SMESG000051787.1[more]
SMESG000008883.11.652e-15156.19SMESG000008883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033698 ID=SMED30033698|Name=beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1414bp
TTTATTTTTCACAATTTATTAGTGTGATTGTTTTAACGATATTTTAAAAG
ACAAAATGAAAAACTGCATTTACTATGCATTAGTTTCAAAAATGCTAAAT
TTTCTTGTATTCACAAACCTAATTGCCTCAATTCAATCTGACAGTTCGAA
TGAAGATTTAATTTGTGAAAATTTCTTCAAACAATACATCAAATCTCCGG
AAATGGAATTCGGTGAAACTTGGAAACCAAAAGTTCCTGTCTCTGATTCT
AAACTTTATCAAGACATCCATCAAGACTGTACAAAATTTTTATTTAATCA
AAAGTATTTTCTCAATTTAAAGGAAACAGAAGACGAAGAAAATTTTCGAA
TCGCTTACTCGATTGTTGCATTTGAAAGTGCATCTCAACTGGAAAGATTG
CTGAGAACAATTTATCGTCCATGGAATTATTATTGCATTCACATTGATGC
CAAGTCTTCCAATGTGTTTGAAATAGCTGTTGGAGAATTGGTAAAATGTC
TTCATTCAAAATACAAGAACATAATTAATAGTGAAAATCGAGTCTTTGTC
GAAAGAAGTACAATGTCTGTATTGACTGCAGATTTGAACTGTATGAAAGA
ACTGTATAGAAAGTTTACAAACTGGAAATATTTCATTAATTTAACCGGAC
AAGAATTTCCACTGAAAACAAATGCTGAGTTAGTAAAGATTCTCAAAGCT
TACAAAGGAGCCAACAATATAGAGGGAACATATAAAAATAGGGACGAAAA
TATAATTCCTAAAGAACAGACGCCGTTTCCAGTCATCTGGTTTAAAGGAG
ATGTTCATATTATAGTGAATCGAAATTTCGTAGAATTCATTTTTGAATCT
TCAATACCAAAAGTTATCCTACAGTTTTTAAATAATCAACAATTTCCGGA
TGAACAATTCTTTTCAACTCTAAACTACAATCCACAGTTCAGAATTGCGG
GCTCCTTTCTAGGAGATCCTGATGAATTGGATTCGGGAATTTTCCTGGGA
AGGTATAAAAACAAAGGTCAATTTACGTGTGGAAGTCGATTTTTTAACCG
AAGTATTTGTATATTGGGAATTCAAGATTTGAATATGTTAATCAACTCTC
CGCATTTATTTGCACATAAATTCTATGAACACTTTCAACCGGGAGCATTG
CGCTGTCTTGAAAAGTGGTATTATGATAAAGTGACGGAAGAAATCAAATC
GGGCTATGCAAGAGTTAAAGAGAGCTTTTACACTTCACAAGTATTCGTTA
AACATCAATATGTTCGACCAACTTTATGACAAAATTGAAAAAGTTCTCGT
AGATTAGAAGAAAATTAATGTTTATTTTTCAAGGGTGACAAATGTTTTAT
TGCGTTTTCTGCTTAGTAATAAATTGATTTTATTTTATTTCAATTAATTA
ATTACTTATTGACA
back to top

protein sequence of SMED30033698-orf-1

>SMED30033698-orf-1 ID=SMED30033698-orf-1|Name=SMED30033698-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=408bp
MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEM
EFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIA
YSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLH
SKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQE
FPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDV
HIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGS
FLGDPDELDSGIFLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPH
LFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKH
QYVRPTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 99..295
e-value: 1.4E-31
score: 109.9
NoneNo IPR availablePANTHERPTHR19297GLYCOSYLTRANSFERASE 14 FAMILY MEMBERcoord: 25..381
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..28
score: 0.525