LHFPL tetraspan subfamily member 2a

Overview
NameLHFPL tetraspan subfamily member 2a
Smed IDSMED30033690
Length (bp)1006
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LHFPL tetraspan subfamily member 2a (SMED30033690) t-SNE clustered cells

Violin plots show distribution of expression levels for LHFPL tetraspan subfamily member 2a (SMED30033690) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LHFPL tetraspan subfamily member 2a (SMED30033690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LHFPL tetraspan subfamily member 2a (SMED30033690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30033690SMESG000025882.1 dd_Smed_v4_6182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30033690SMESG000025882.1 dd_Smed_v4_6182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033690SMESG000025882.1 dd_Smed_v6_6182_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Human
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:HGNC Symbol;Acc:HGNC:6586])

HSP 1 Score: 77.411 bits (189), Expect = 3.287e-16
Identity = 59/195 (30.26%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMG-TALSIFCPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL  +Q   P   G +  C   +H+  +   +    CG Y    S   +PS EW+I  ++ G GC L L+ A+  +   C+S    R V    G IQ +  +    G  ++P+G++SE V+  C   S +F+ GKCE GW       G TA  + C  LA F   +    PY
Sbjct:    9 GVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYA---SFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Human
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:HGNC Symbol;Acc:HGNC:6586])

HSP 1 Score: 77.411 bits (189), Expect = 3.287e-16
Identity = 59/195 (30.26%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMG-TALSIFCPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL  +Q   P   G +  C   +H+  +   +    CG Y    S   +PS EW+I  ++ G GC L L+ A+  +   C+S    R V    G IQ +  +    G  ++P+G++SE V+  C   S +F+ GKCE GW       G TA  + C  LA F   +    PY
Sbjct:    9 GVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYA---SFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Human
Match: TMEM211 (transmembrane protein 211 [Source:HGNC Symbol;Acc:HGNC:33725])

HSP 1 Score: 71.2478 bits (173), Expect = 5.180e-14
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  110 LWCLLSLMVGGMATFAFLQPFWLIEAQSPH-CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKST-RRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRV 652
            +W  L L +   + F+ + P W    Q+P    GI +YC     N    S  C  +    SL+ +P   WK++ ++  GG LL    AIF +S     K    RR +  +  +QA+A    +VGLL+FP+G  S F++  C   S  +  GKC  GWG + A +   L+   PI++     +V
Sbjct:    5 VWVALGLSLTCTSAFSLISPAWF---QTPTFSFGILTYCSWPQGNSWNQS--CVTFS---SLEDIPDFAWKVSAVMLLGGWLLLAFNAIFLLSWAVAPKGLCPRRSSVPMPGVQAVAATAMIVGLLIFPIGLASPFIKEVCE-ASSMYYGGKCRLGWGYMTAILNAVLASLLPIISWPHTTKV 178          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Human
Match: TMEM211 (transmembrane protein 211 [Source:HGNC Symbol;Acc:HGNC:33725])

HSP 1 Score: 71.2478 bits (173), Expect = 5.180e-14
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  110 LWCLLSLMVGGMATFAFLQPFWLIEAQSPH-CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKST-RRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRV 652
            +W  L L +   + F+ + P W    Q+P    GI +YC     N    S  C  +    SL+ +P   WK++ ++  GG LL    AIF +S     K    RR +  +  +QA+A    +VGLL+FP+G  S F++  C   S  +  GKC  GWG + A +   L+   PI++     +V
Sbjct:    5 VWVALGLSLTCTSAFSLISPAWF---QTPTFSFGILTYCSWPQGNSWNQS--CVTFS---SLEDIPDFAWKVSAVMLLGGWLLLAFNAIFLLSWAVAPKGLCPRRSSVPMPGVQAVAATAMIVGLLIFPIGLASPFIKEVCE-ASSMYYGGKCRLGWGYMTAILNAVLASLLPIISWPHTTKV 178          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Human
Match: LHFPL2 (LHFPL tetraspan subfamily member 2 [Source:HGNC Symbol;Acc:HGNC:6588])

HSP 1 Score: 68.1662 bits (165), Expect = 1.177e-12
Identity = 53/195 (27.18%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI---------EAQSPH---------CLGIYSYCIKDIHNPH-QDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++V      AF+   WLI         E   P           LGIY+ CI++    H Q   LCG Y   F    + S  W+ T +    G  +  + A+  + T+C+    ++ +    G +Q IA +F ++GL+++P G+  +    YC   +  +  G C  GW    A  GT L+  C + +
Sbjct:   10 SMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFG--EIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFS 202          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Fly
Match: Tmhs (gene:FBgn0262624 transcript:FBtr0072836)

HSP 1 Score: 63.929 bits (154), Expect = 2.555e-11
Identity = 63/233 (27.04%), Postives = 105/233 (45.06%), Query Frame = 2
Query:   41 IKTVMKYSDCN--YAS--IFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHC--LGIYSYCIKD--IHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFF---DVRVCDKPYYNSQSIYKLELNS 706
            + T ++Y D    YAS  I  +  I +LW + ++    +   AF+ P W+ +  +     LG++  C +D    N  +  +         S+  +P+  +++    F  G +   +  IF +  L   KSTR    C  G++Q I+ I  +V    FP G+NS+  +  C PE+ RF  G C   W   LA +G    +    LA       VR+   P Y + S+YK E+N+
Sbjct:    1 MGTKIEYVDTTHLYASKYIRNSKAIGVLWAIFTICYAIIGIVAFVTPEWIGDPDNDGAGRLGLWQQCQRDEIFDNCRRRWE---------SIFEVPTFSFQLA-TFFMLGAIALALLTIFFLVCLLFMKSTRVFHLC--GWMQIISAICMIVACAAFPFGWNSDDFRKICGPEANRFELGLCGIRWAYPLAIIGCIDGVVLATLAFILATRHVRLQPDPIYQN-SLYKGEINN 220          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Fly
Match: Tmhs (gene:FBgn0262624 transcript:FBtr0072837)

HSP 1 Score: 63.929 bits (154), Expect = 2.555e-11
Identity = 63/233 (27.04%), Postives = 105/233 (45.06%), Query Frame = 2
Query:   41 IKTVMKYSDCN--YAS--IFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHC--LGIYSYCIKD--IHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFF---DVRVCDKPYYNSQSIYKLELNS 706
            + T ++Y D    YAS  I  +  I +LW + ++    +   AF+ P W+ +  +     LG++  C +D    N  +  +         S+  +P+  +++    F  G +   +  IF +  L   KSTR    C  G++Q I+ I  +V    FP G+NS+  +  C PE+ RF  G C   W   LA +G    +    LA       VR+   P Y + S+YK E+N+
Sbjct:    1 MGTKIEYVDTTHLYASKYIRNSKAIGVLWAIFTICYAIIGIVAFVTPEWIGDPDNDGAGRLGLWQQCQRDEIFDNCRRRWE---------SIFEVPTFSFQLA-TFFMLGAIALALLTIFFLVCLLFMKSTRVFHLC--GWMQIISAICMIVACAAFPFGWNSDDFRKICGPEANRFELGLCGIRWAYPLAIIGCIDGVVLATLAFILATRHVRLQPDPIYQN-SLYKGEINN 220          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Fly
Match: CG3770 (gene:FBgn0035085 transcript:FBtr0343502)

HSP 1 Score: 50.0618 bits (118), Expect = 6.442e-7
Identity = 47/185 (25.41%), Postives = 73/185 (39.46%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI--------EAQSPH--CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSL------EWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALS 610
            +L+W L SL+   +   A + P WL+         A S H   +GIY+ C        +  Q  G   GRF LD L +       EWK        G  L  +  I  + T C   +  + +       Q +A I  ++GL + PMG+ +  +Q  C  ++  F    C  G       +G  L+
Sbjct:   10 SLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRC--------KVMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVLLT 186          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Fly
Match: CG3770 (gene:FBgn0035085 transcript:FBtr0072393)

HSP 1 Score: 50.0618 bits (118), Expect = 6.442e-7
Identity = 47/185 (25.41%), Postives = 73/185 (39.46%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI--------EAQSPH--CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSL------EWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALS 610
            +L+W L SL+   +   A + P WL+         A S H   +GIY+ C        +  Q  G   GRF LD L +       EWK        G  L  +  I  + T C   +  + +       Q +A I  ++GL + PMG+ +  +Q  C  ++  F    C  G       +G  L+
Sbjct:   10 SLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRC--------KVMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVLLT 186          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Zebrafish
Match: si:dkey-35m8.1 (si:dkey-35m8.1 [Source:ZFIN;Acc:ZDB-GENE-060526-296])

HSP 1 Score: 90.1225 bits (222), Expect = 9.057e-21
Identity = 54/185 (29.19%), Postives = 99/185 (53.51%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWLIEAQSPH-----CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCI-SKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQF 637
            +   W LLS  +  + +F+F+ P W+++    +       G+  +C + + + ++    C  +GG      +PS  W+ + +L  GGC L  + ++  I T+ + S +  RR+    G++Q  AV+    GLL++P G NS  V+ +C  +S  +NAG C+ GWG +LA +G  L++F P  A++
Sbjct:   32 VGCFWVLLSSALVAICSFSFISPAWIVKEHPKNHKDSVSFGLLWHCSESLDHMYR----CYTFGGLGKFQEIPSSSWQTSAVLCSGGCALLAVSSLLAIITIFLPSGACERRICTLAGYMQMAAVVIMASGLLVYPFGLNSSLVKSFCG-DSDIYNAGDCQIGWGYMLAVVGVMLTLFLPFFAKY 211          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Zebrafish
Match: lhfpl2a (LHFPL tetraspan subfamily member 2a [Source:NCBI gene;Acc:402962])

HSP 1 Score: 88.9669 bits (219), Expect = 2.295e-20
Identity = 63/195 (32.31%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-------------------EAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++       AFL   WL+                   EA  P  LGIY  CI+  H  ++   LCG Y   F    + S  W+ T +    G LL    A   I T+C     ++ +    G +QAIA +F +VGL+++P G+ S+ VQ YC P+S  +  G C AGW    A  GT L   C + +
Sbjct:   10 SMLWTLLSIVAAFSELIAFLSTDWLVGFPRAPDAGFSPLGATAAGEAYRPT-LGIYGRCIRVPH--YRRGVLCGPYAVHF--GEIASGFWQATAIFLAAGILLLCAVAFISIFTMCFQSIMKKSIFNVCGLLQAIAGLFLIVGLVLYPAGWGSQKVQLYCGPDSSPYRLGLCSAGWAFYTALAGTVLCFLCAVFS 199          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Zebrafish
Match: lhfpl2a (LHFPL tetraspan subfamily member 2a [Source:NCBI gene;Acc:402962])

HSP 1 Score: 88.9669 bits (219), Expect = 2.295e-20
Identity = 63/195 (32.31%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-------------------EAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++       AFL   WL+                   EA  P  LGIY  CI+  H  ++   LCG Y   F    + S  W+ T +    G LL    A   I T+C     ++ +    G +QAIA +F +VGL+++P G+ S+ VQ YC P+S  +  G C AGW    A  GT L   C + +
Sbjct:   10 SMLWTLLSIVAAFSELIAFLSTDWLVGFPRAPDAGFSPLGATAAGEAYRPT-LGIYGRCIRVPH--YRRGVLCGPYAVHF--GEIASGFWQATAIFLAAGILLLCAVAFISIFTMCFQSIMKKSIFNVCGLLQAIAGLFLIVGLVLYPAGWGSQKVQLYCGPDSSPYRLGLCSAGWAFYTALAGTVLCFLCAVFS 199          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Zebrafish
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:494110])

HSP 1 Score: 81.2629 bits (199), Expect = 9.004e-18
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALS-IFCPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL+ +Q   P   G +  C   I +  +   +    CG Y    S   +PSLEW+I  ++ G GC L L+ A+  I   C++    R +    G IQ +  +    G  ++P+G++SE V+  CS  S +F+ G CE GW       G A + + C  +A F   +    PY
Sbjct:    9 GVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEARGGTVMLEQCGRYA---SFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGSGCALYPLGWDSEEVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCTWMACFAGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Zebrafish
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:494110])

HSP 1 Score: 81.2629 bits (199), Expect = 9.004e-18
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALS-IFCPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL+ +Q   P   G +  C   I +  +   +    CG Y    S   +PSLEW+I  ++ G GC L L+ A+  I   C++    R +    G IQ +  +    G  ++P+G++SE V+  CS  S +F+ G CE GW       G A + + C  +A F   +    PY
Sbjct:    9 GVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEARGGTVMLEQCGRYA---SFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGSGCALYPLGWDSEEVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCTWMACFAGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Xenopus
Match: ENSXETT00000025484.1 (transmembrane protein 211-like [Source:NCBI gene;Acc:100486901])

HSP 1 Score: 84.3445 bits (207), Expect = 1.625e-18
Identity = 57/182 (31.32%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLY--GGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCI-SKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQF 637
            ++  W LLS  +  + +F+F+ P W++ + SP      S+ +   H P +   +   Y  GG  + + +PS  W+ + +L  GGC+L ++       TL + S    RR+    G++Q  AV     GLL++P G NS  V+ YC   +  + AG C+ GWG +LA +G  LS+F P  A++
Sbjct:   36 VSCFWVLLSACLAAVCSFSFISPAWVVRSASPVKQEPVSFGLL-WHCPDRLGHIAACYSLGGLGTFNDIPSSSWQTSAVLCSGGCVLLVMSCFLATITLFLPSGLCERRLCTLAGYMQTAAVFIMASGLLVYPFGLNSTTVKKYCE-NASIYYAGDCQIGWGYMLAIVGVMLSVFLPFFAKY 215          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Xenopus
Match: LHFPL2 (LHFPL tetraspan subfamily member 2 [Source:NCBI gene;Acc:100492344])

HSP 1 Score: 73.559 bits (179), Expect = 1.189e-14
Identity = 55/192 (28.65%), Postives = 90/192 (46.88%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEA-------------QSPH--CLGIYSYCIKDIHNPH-QDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW +LS++V      AF+   WLI               Q P+   LGIY  CIK    P+ +   LCG Y   F  + + S  W+ T +    G  +  I A   + T+C+    ++ +    G +Q IA +F ++GL+++P G+ S+ V  YC   +  +  G+C  GW    A  GT L+  C + +
Sbjct:   10 SMLWTILSIVVAFGELIAFMSADWLIGKAKSTDSDSRTGGQQEPYRPTLGIYGRCIKMPQVPYFRKDTLCGPYAEHF--NEIASGFWQATAIFLAVGISILCIVAFVSVFTMCVQSVMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGSQKVVGYCGHYAAAYKLGECSLGWAFYTAIGGTVLTFICAVFS 199          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Xenopus
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:100145781])

HSP 1 Score: 72.4034 bits (176), Expect = 1.958e-14
Identity = 53/195 (27.18%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDS----QLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIF-CPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL+ +Q   P   G +  C   + +  + +    + CG Y    S + +PS EW+I  ++ G GC L L+ A+  +   C+++   R V    G IQ +  +    G  ++P+G++SE V+  C   S +F  G C  GW       G A+ +  C  L+ F   +    PY
Sbjct:    9 GVIWALLSFLCAAASCVGFFMPYWLLGSQLDKPVSFGTFRRCSYPVRDETRQTTFMVEQCGRYA---SFEAIPSPEWRICTIVTGLGCGLLLLVALTAMMGCCVTELISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQACGNLSDQFELGTCRFGWAYYCTGGGAAVVMLICTWLSCFSGKKQKQYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Xenopus
Match: LHFPL1 (LHFPL tetraspan subfamily member 1 [Source:NCBI gene;Acc:100494122])

HSP 1 Score: 60.8474 bits (146), Expect = 1.839e-10
Identity = 48/182 (26.37%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  110 LWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL---CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIF-CPILAQF 637
            +W LLS++   + + +F  P+WL   Q   P     +  C        +   +   CG Y    S   +PSL W+I+  +   GC L L+ ++  +   CI     R     LG  Q +  +    G  ++P+G+NS  +Q  C   S +F+ G C+ GW       G A ++  C  L+ F
Sbjct:   11 VWALLSMLCAALCSTSFFMPYWLFGFQMGKPVSFSSFRRCTYPTQTGEESVVMVEECGRYA---SFHAIPSLSWQISTWVISIGCTLLLLVSLAAVLGCCIKDLISRMTGRLLGAAQFVGGLLISSGCALYPLGWNSPEIQQACGNASSQFHLGTCKLGWAYYSTGAGAAAAMLICTWLSCF 189          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Xenopus
Match: rab8a (RAB8A, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-1018135])

HSP 1 Score: 50.8322 bits (120), Expect = 6.843e-7
Identity = 42/185 (22.70%), Postives = 81/185 (43.78%), Query Frame = 2
Query:   89 RANPINLLWCLLSLMVGGMATFAFLQPFWLIEA-QSPHC--LGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAI-FGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
             A  I +LW + ++    +    F+QP+W+ ++  +P     G++SYC   I N      +C   G       +PS  +K      G    L +   + F +   C S +  +  A    ++Q  A    ++G L++P G++S  V+  C  ++ +++ G C   W  +LA +    ++    LA
Sbjct:   21 NARAIGVLWAVFTICFSIIMVVIFIQPYWIGDSINTPQAGYFGLFSYC---IGNALTSELICK--GSALDFASIPSGAFKTAMFFVGISMFLVVGSMLSFSLFFFCNSATVYKVCA----WMQLAAAAGLMIGCLIYPDGWDSPEVKRMCGDKTDKYSLGACTVRWAYILAIIAIMDALILSFLA 196          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Mouse
Match: Lhfp (lipoma HMGIC fusion partner [Source:MGI Symbol;Acc:MGI:1920048])

HSP 1 Score: 70.8626 bits (172), Expect = 4.501e-14
Identity = 50/163 (30.67%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGW 574
             ++W LLS +    +   F  P+WL  +Q   P   G +  C   +H+  +   +    CG Y    S   +PS EW+I  ++ G GC L L+ A+  +   C+S+   R V    G IQ +  +    G  ++P+G++SE V+  C   S +F+ GKCE GW
Sbjct:    9 GVIWALLSFLSAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYA---SFQGIPSTEWRICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYISGQFDLGKCEIGW 168          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Mouse
Match: Lhfp (lipoma HMGIC fusion partner [Source:MGI Symbol;Acc:MGI:1920048])

HSP 1 Score: 70.8626 bits (172), Expect = 4.501e-14
Identity = 50/163 (30.67%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGW 574
             ++W LLS +    +   F  P+WL  +Q   P   G +  C   +H+  +   +    CG Y    S   +PS EW+I  ++ G GC L L+ A+  +   C+S+   R V    G IQ +  +    G  ++P+G++SE V+  C   S +F+ GKCE GW
Sbjct:    9 GVIWALLSFLSAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYA---SFQGIPSTEWRICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYISGQFDLGKCEIGW 168          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Mouse
Match: Lhfpl2 (lipoma HMGIC fusion partner-like 2 [Source:MGI Symbol;Acc:MGI:2145236])

HSP 1 Score: 60.077 bits (144), Expect = 3.929e-10
Identity = 51/191 (26.70%), Postives = 87/191 (45.55%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-EAQS--------------PHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++V      AF+   WLI +A++              PH LGI       +    +D+ LCG Y   F    + S  W+ T +    G  +  + A+  + T+C+    R+ +    G +Q IA +F ++GL+++P G+  +     C   +  +  G C  GW    AT GT L+  C + +
Sbjct:   10 SMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGILCIRTPAMQQVSRDT-LCGTYAKSFG--EIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASPYKPGDCSLGWAFYTATGGTVLTFICAVFS 196          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Mouse
Match: Lhfpl2 (lipoma HMGIC fusion partner-like 2 [Source:MGI Symbol;Acc:MGI:2145236])

HSP 1 Score: 60.077 bits (144), Expect = 3.929e-10
Identity = 51/191 (26.70%), Postives = 87/191 (45.55%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-EAQS--------------PHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++V      AF+   WLI +A++              PH LGI       +    +D+ LCG Y   F    + S  W+ T +    G  +  + A+  + T+C+    R+ +    G +Q IA +F ++GL+++P G+  +     C   +  +  G C  GW    AT GT L+  C + +
Sbjct:   10 SMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGILCIRTPAMQQVSRDT-LCGTYAKSFG--EIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASPYKPGDCSLGWAFYTATGGTVLTFICAVFS 196          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Mouse
Match: Lhfpl2 (lipoma HMGIC fusion partner-like 2 [Source:MGI Symbol;Acc:MGI:2145236])

HSP 1 Score: 60.077 bits (144), Expect = 3.929e-10
Identity = 51/191 (26.70%), Postives = 87/191 (45.55%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-EAQS--------------PHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++V      AF+   WLI +A++              PH LGI       +    +D+ LCG Y   F    + S  W+ T +    G  +  + A+  + T+C+    R+ +    G +Q IA +F ++GL+++P G+  +     C   +  +  G C  GW    AT GT L+  C + +
Sbjct:   10 SMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGILCIRTPAMQQVSRDT-LCGTYAKSFG--EIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASPYKPGDCSLGWAFYTATGGTVLTFICAVFS 196          
BLAST of LHFPL tetraspan subfamily member 2a vs. UniProt/SwissProt
Match: sp|Q6P0C6|LHPL2_DANRE (LHFPL tetraspan subfamily member 2a protein OS=Danio rerio OX=7955 GN=lhfpl2a PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.733e-19
Identity = 63/195 (32.31%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-------------------EAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++       AFL   WL+                   EA  P  LGIY  CI+  H  ++   LCG Y   F    + S  W+ T +    G LL    A   I T+C     ++ +    G +QAIA +F +VGL+++P G+ S+ VQ YC P+S  +  G C AGW    A  GT L   C + +
Sbjct:   10 SMLWTLLSIVAAFSELIAFLSTDWLVGFPRAPDAGFSPLGATAAGEAYRPT-LGIYGRCIRVPH--YRRGVLCGPYAVHF--GEIASGFWQATAIFLAAGILLLCAVAFISIFTMCFQSIMKKSIFNVCGLLQAIAGLFLIVGLVLYPAGWGSQKVQLYCGPDSSPYRLGLCSAGWAFYTALAGTVLCFLCAVFS 199          
BLAST of LHFPL tetraspan subfamily member 2a vs. UniProt/SwissProt
Match: sp|Q5PRC1|LHPL6_DANRE (LHFPL tetraspan subfamily member 6 protein OS=Danio rerio OX=7955 GN=lhfpl6 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.797e-17
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALS-IFCPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL+ +Q   P   G +  C   I +  +   +    CG Y    S   +PSLEW+I  ++ G GC L L+ A+  I   C++    R +    G IQ +  +    G  ++P+G++SE V+  CS  S +F+ G CE GW       G A + + C  +A F   +    PY
Sbjct:    9 GVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEARGGTVMLEQCGRYA---SFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGSGCALYPLGWDSEEVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCTWMACFAGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. UniProt/SwissProt
Match: sp|Q9Y693|LHPL6_HUMAN (LHFPL tetraspan subfamily member 6 protein OS=Homo sapiens OX=9606 GN=LHFPL6 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.579e-15
Identity = 59/195 (30.26%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMG-TALSIFCPILAQFFDVRVCDKPY 667
             ++W LLS +    +   F  P+WL  +Q   P   G +  C   +H+  +   +    CG Y    S   +PS EW+I  ++ G GC L L+ A+  +   C+S    R V    G IQ +  +    G  ++P+G++SE V+  C   S +F+ GKCE GW       G TA  + C  LA F   +    PY
Sbjct:    9 GVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYA---SFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. UniProt/SwissProt
Match: sp|Q6ICI0|TM211_HUMAN (Transmembrane protein 211 OS=Homo sapiens OX=9606 GN=TMEM211 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 2.488e-13
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  110 LWCLLSLMVGGMATFAFLQPFWLIEAQSPH-CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKST-RRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRV 652
            +W  L L +   + F+ + P W    Q+P    GI +YC     N    S  C  +    SL+ +P   WK++ ++  GG LL    AIF +S     K    RR +  +  +QA+A    +VGLL+FP+G  S F++  C   S  +  GKC  GWG + A +   L+   PI++     +V
Sbjct:    5 VWVALGLSLTCTSAFSLISPAWF---QTPTFSFGILTYCSWPQGNSWNQS--CVTFS---SLEDIPDFAWKVSAVMLLGGWLLLAFNAIFLLSWAVAPKGLCPRRSSVPMPGVQAVAATAMIVGLLIFPIGLASPFIKEVCE-ASSMYYGGKCRLGWGYMTAILNAVLASLLPIISWPHTTKV 178          
BLAST of LHFPL tetraspan subfamily member 2a vs. UniProt/SwissProt
Match: sp|Q5BJS2|LHPL6_RAT (LHFPL tetraspan subfamily member 6 protein OS=Rattus norvegicus OX=10116 GN=Lhfpl6 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.562e-13
Identity = 50/163 (30.67%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGW 574
             ++W LLS +    +   F  P+WL  +Q   P   G +  C   +H+  +   +    CG Y    S   +PS EW+I  ++ G GC L L+ A+  +   C+S+   R V    G IQ +  +    G  ++P+G++SE V+  C   S +F+ GKCE GW
Sbjct:    9 GVIWALLSFLSAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYA---SFQGIPSTEWRICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYISDQFDLGKCEIGW 168          
BLAST of LHFPL tetraspan subfamily member 2a vs. TrEMBL
Match: A0A1S3JJC5 (transmembrane protein 211-like OS=Lingula unguis OX=7574 GN=LOC106173812 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.981e-39
Identity = 86/237 (36.29%), Postives = 138/237 (58.23%), Query Frame = 2
Query:   62 SDCNYASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQD--SQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVR----VCD----KPY---YNSQSIYK---LELNSLVKHLE 724
            + C   +   A PI+LLW LLS++V     F+F+QP+W+I+ +  +  GIYS+C ++ H+P +      C +YGG F     PS  W+ +C+LFGGGC      AI  I++LC+  +  ++VA   G++Q +AV+  + GL+++P G +S  V +YC  ++  FN+G C  GW  +L  +GTAL++FCP LAQ+ D +    VC     KPY   Y+  ++++    E+  L  H E
Sbjct:   24 TSCRDRARVMATPISLLWTLLSMLVAASCAFSFMQPYWIIDFEQWNSFGIYSFCYQENHSPDRTVHHHHCRIYGGHFDFSFFPSSAWQASCVLFGGGCAFLCFAAILAITSLCLPSACDKKVALSAGYMQLVAVLIMIAGLIVYPFGLDSRLVSYYCG-KTGIFNSGDCHFGWAYMLGIVGTALAMFCPFLAQYTDTKAYGPVCGMESYKPYMPEYSESNVFRPVETEMKVLHYHRE 259          
BLAST of LHFPL tetraspan subfamily member 2a vs. TrEMBL
Match: A0A1S3H601 (transmembrane protein 211 OS=Lingula unguis OX=7574 GN=LOC106152484 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.045e-39
Identity = 86/237 (36.29%), Postives = 138/237 (58.23%), Query Frame = 2
Query:   62 SDCNYASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQD--SQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVR----VCD----KPY---YNSQSIYK---LELNSLVKHLE 724
            + C   +   A PI+LLW LLS++V     F+F+QP+W+I+ +  +  GIYS+C ++ H+P +      C +YGG F     PS  W+ +C+LFGGGC      AI  I++LC+  +  ++VA   G++Q +AV+  + GL+++P G +S  V +YC  ++  FN+G C  GW  +L  +GTAL++FCP LAQ+ D +    VC     KPY   Y+  ++++    E+  L  H E
Sbjct:   24 TSCRDRARVMATPISLLWTLLSMLVAASCAFSFMQPYWIIDFEQWNSFGIYSFCYQENHSPDRTVHHHHCRIYGGHFDFSFFPSSAWQASCVLFGGGCAFLCFAAILAITSLCLPSACDKKVALSAGYMQLVAVLIMIAGLIVYPFGLDSRLVSYYCG-KTGIFNSGDCHFGWAYMLGIVGTALAMFCPFLAQYTDTKAYGPVCGMDSYKPYMPEYSESNVFRPVETEMKVLHYHRE 259          
BLAST of LHFPL tetraspan subfamily member 2a vs. TrEMBL
Match: R7TNS5 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_148433 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.816e-36
Identity = 80/203 (39.41%), Postives = 125/203 (61.58%), Query Frame = 2
Query:   95 NPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKD-----IHNPHQD---SQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAG-KCEAGWGLLLATMGTALSIFCPILAQFFDVRVCDKPYYNS 676
            + +  LW LLSL+V G++TF+FLQP+W I  ++   LG+YS+C++D     I   +Q    +Q CGL+G  F    LPS  W+++C+++GGGC++ +ICA+  +  LC+  S   R A   G++Q  AV+    GL++FP+G  S  VQHYC PE+  +  G  C+ GW  LL  + TAL+ F P LAQ+ D+ +  +  ++S
Sbjct:    3 SAVGGLWTLLSLIVAGLSTFSFLQPYWYIHQRTLQSLGMYSFCLQDDLASKIPEGYQAGPFTQACGLFGDYFDFGSLPSDAWQVSCVMYGGGCVVLVICAMISVLVLCLPSSCDTRTAVLTGYVQTTAVVLLTAGLVIFPVGLESSVVQHYC-PEASVYRPGTSCQIGWAYLLGIVATALAFFAPFLAQYTDISLDQRRLHSS 204          
BLAST of LHFPL tetraspan subfamily member 2a vs. TrEMBL
Match: R7TPN0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_186097 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.358e-35
Identity = 69/181 (38.12%), Postives = 106/181 (58.56%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFD 643
            + L+W  LS MV  ++ F+F++P W++       LG++S+C++  H     S +CG+YGG F+  HLPS  W++TC+L    C L L+  I  +ST  +    RR++    G+IQ +AV   V+G  +FP G +S FVQ+YC P S+++  G C  GW  ++   G AL +FCP LA   D
Sbjct:    9 VGLVWTFLSFMVTLVSIFSFVRPSWVVNTTDLTTLGLFSFCLRSDHLTDAPSVVCGIYGGNFNFSHLPSTTWQVTCILCACACGLLLMTTIMAVSTFLVRPGFRRKLTLGAGYIQIMAVFLLVIGYSIFPAGLDSSFVQYYC-PGSQKYRTGVCTVGWEYIIGVTGAALGLFCPFLAYHAD 188          
BLAST of LHFPL tetraspan subfamily member 2a vs. TrEMBL
Match: R7TX23 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219101 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.794e-35
Identity = 73/183 (39.89%), Postives = 116/183 (63.39%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVR 649
            + +LW  LS+MV    +F+ LQP W   A S   LG+ SYC++D   P +  ++C +YGG F L HLPS  W++ CLL+G GCLL  + ++  +++L +      RVA + G+ Q +AV+  ++ L+++P+G +  FV+H+C P S+ + A  C  GW  +LA M TAL++FCP+L+Q+ D R
Sbjct:  167 VKVLWACLSVMVTVGCSFSLLQPHWFTHANSRDSLGLSSYCVQDQRVPAEPQRVCDVYGGYFRLQHLPSNAWQVACLLYGIGCLLLTVASLASLASLLLGDRWSDRVAVYTGYSQTLAVVLIIISLVVYPVGLDCSFVRHHCGPHSKAYFADNCHIGWAYVLAIMSTALAMFCPVLSQYTDFR 349          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Cavefish
Match: si:dkey-35m8.1 (transmembrane protein 211-like [Source:NCBI gene;Acc:103045102])

HSP 1 Score: 85.1149 bits (209), Expect = 4.235e-19
Identity = 54/184 (29.35%), Postives = 97/184 (52.72%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWLIE----AQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCI-SKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQF 637
            +   W LLS  +  + +F+F+ P W+++     +     G+  +C + + + ++    C  +GG      +PS  W+ + +L  GGC L  + ++  I T+ + S S  RR+    G++Q  AV     GLL++P G NS  V+ +C   S  + AG+C+ GWG +LA +G  L++F P  A++
Sbjct:   31 VGCFWVLLSSALVAVCSFSFISPAWIVKDHGRGEDSVSFGLLWHCSESLDHMYR----CYTFGGLGRFAEIPSSSWQTSAVLCSGGCALLAVSSLLAIITIFLPSGSCERRICTLAGYMQMAAVFIMASGLLVYPFGLNSSLVKSFCG-NSDIYYAGECQIGWGYMLAIVGVMLTLFLPFFAKY 209          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Cavefish
Match: lhfpl6 (lipoma HMGIC fusion partner homolog [Source:NCBI gene;Acc:103046216])

HSP 1 Score: 83.1889 bits (204), Expect = 1.531e-18
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIF-CPILAQFFDVRVCDKPY 667
             +LW LLSL+    +   F  P+WL+ +Q   P   G +  C   + +  Q   +    CG Y    S   +PSLEW+I  ++ G GC L L+ A+  I   C++    R +    G IQ +  +    G  ++P+G++SE V+  CS  S +F  G CE GW       G  +++  C  ++ F   +    PY
Sbjct:    9 GVLWALLSLLCASASCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPVRDEAQGGTVMLEQCGRYA---SFQGIPSLEWRICTVVTGTGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGAGCALYPLGWDSEEVRQTCSNTSNQFQLGSCEIGWAFYCTGAGAVVAMLVCTWMSCFAGKKQKQYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Cavefish
Match: lhfpl6 (lipoma HMGIC fusion partner homolog [Source:NCBI gene;Acc:103046216])

HSP 1 Score: 83.1889 bits (204), Expect = 1.531e-18
Identity = 57/195 (29.23%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIF-CPILAQFFDVRVCDKPY 667
             +LW LLSL+    +   F  P+WL+ +Q   P   G +  C   + +  Q   +    CG Y    S   +PSLEW+I  ++ G GC L L+ A+  I   C++    R +    G IQ +  +    G  ++P+G++SE V+  CS  S +F  G CE GW       G  +++  C  ++ F   +    PY
Sbjct:    9 GVLWALLSLLCASASCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPVRDEAQGGTVMLEQCGRYA---SFQGIPSLEWRICTVVTGTGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGAGCALYPLGWDSEEVRQTCSNTSNQFQLGSCEIGWAFYCTGAGAVVAMLVCTWMSCFAGKKQKQYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Cavefish
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:103033992])

HSP 1 Score: 77.0258 bits (188), Expect = 2.664e-16
Identity = 56/195 (28.72%), Postives = 92/195 (47.18%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSI-FCPILAQFFDVRVCDKPY 667
             +LW L+SL+    +   F  P+WL+ +Q   P   G +  C   I +  + + +    CG Y    +   +PS+EW++  ++ G GC L L+ A+  +   C+S+   R +    G IQ +  +    G  ++P+G++SE V+  C   S +F  G CE GW       G A +I  C  LA F   +    PY
Sbjct:    9 GVLWTLVSLLSAAASCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEQRQATIMLEQCGRYA---TFQGIPSVEWRVCTVVTGTGCGLLLLVALTALMGCCVSELISRAIGRVAGGIQFLGGLLIGSGCALYPLGWDSEEVKQTCDNRSDQFQLGSCEIGWAYYCTGAGAASAILLCTWLACFAGKKQKQYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Cavefish
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:103033992])

HSP 1 Score: 77.0258 bits (188), Expect = 2.664e-16
Identity = 56/195 (28.72%), Postives = 92/195 (47.18%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSI-FCPILAQFFDVRVCDKPY 667
             +LW L+SL+    +   F  P+WL+ +Q   P   G +  C   I +  + + +    CG Y    +   +PS+EW++  ++ G GC L L+ A+  +   C+S+   R +    G IQ +  +    G  ++P+G++SE V+  C   S +F  G CE GW       G A +I  C  LA F   +    PY
Sbjct:    9 GVLWTLVSLLSAAASCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEQRQATIMLEQCGRYA---TFQGIPSVEWRVCTVVTGTGCGLLLLVALTALMGCCVSELISRAIGRVAGGIQFLGGLLIGSGCALYPLGWDSEEVKQTCDNRSDQFQLGSCEIGWAYYCTGAGAASAILLCTWLACFAGKKQKQYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Sea Lamprey
Match: lhfpl5b (LHFPL tetraspan subfamily member 5b [Source:ZFIN;Acc:ZDB-GENE-080220-51])

HSP 1 Score: 51.2174 bits (121), Expect = 8.747e-8
Identity = 39/173 (22.54%), Postives = 78/173 (45.09%), Query Frame = 2
Query:   92 ANPINLLWCLLSLMVGGMATFAFLQPFWL---IEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAI-FGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMG 598
            A  + +LW + ++    +   +F+QPFW+   ++       G++SYCI    N      +C   G       +PS  +K      G   LL + C + F +   C S +  +  A    ++Q  +    V+G +++P G++++ V+  C   + ++  G C   +  +LA +G
Sbjct:   19 ARAVGVLWAIFTICFAILNVVSFIQPFWIGDSVDTPQAGYFGLFSYCIG---NSLTREMVCS--GSFMDFSAVPSSAFKTAGFFIGISMLLVIACLVCFSLFFFCTSATVYKVCA----WMQLTSAALLVLGCMIYPDGWDADEVRRLCGDNTGKYTLGACTVRYAYVLAIVG 182          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Nematostella
Match: EDO35175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM90])

HSP 1 Score: 90.1225 bits (222), Expect = 1.824e-21
Identity = 63/194 (32.47%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWLIEAQSPH----------CLGIYSYCIKDI------HNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQ 634
            +++LW +LS++  G  + A + PFW      P             G+  +CIK         +   D + C  Y    S   +PSL WK + +L+G G LL L+  +    + C  K  +R V    G +Q  AVIF V+ L+MFP+GF S+FV  +C   +  FN G+C   W   LA M T L + CP++A+
Sbjct:    4 VSVLWTVLSVLFTGACSLAIISPFWFERVPDPDDVSSDNSSFVAFGLLRFCIKRNLESILEMDEWSDFKNCKFYS---SFHGIPSLFWKFSVVLYGIGVLLLLVAILLAHISCCFKKVCKRSVFGVAGVVQISAVIFLVISLVMFPLGFKSQFVSQHCG-LTDMFNPGQCSISWAYTLAIMSTGLLMLCPVMAR 193          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Nematostella
Match: EDO45262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG9])

HSP 1 Score: 64.6994 bits (156), Expect = 2.363e-12
Identity = 52/182 (28.57%), Postives = 80/182 (43.96%), Query Frame = 2
Query:   95 NPINLLWCLLSLMVGGMATFAFLQPFWLIEAQ----SPHCLGIYSYC---IKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFC 619
             PI ++W L S++   +   +F  P+W IE +    S H  G++  C    KD        Q CG Y    S   +PS  WK   +L G GC L L+  +  I + C+     +      G +Q  A  F       +P G+    V+  C P++  FN G+C  GW   +  +GTA++  C
Sbjct:    6 TPIGVVWVLSSVISSLLCCVSFYLPYW-IEGKTLGVSVH-FGVFRRCNFLAKDEDGSTYVMQACGRYA---SFADIPSTSWKACTVLIGIGCGLLLLVCLTAICSCCMRDIITKSSGKVAGIVQFFAASFLGFSAAAYPSGWGGVEVRQACGPDADSFNLGQCSLGWAFYIYILGTAMAFVC 182          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Nematostella
Match: EDO32906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STR5])

HSP 1 Score: 54.299 bits (129), Expect = 1.147e-8
Identity = 47/197 (23.86%), Postives = 81/197 (41.12%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI----------------EAQSPHCLGIYSYCIK-DIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRR---FNAGKCEAGWGLLLATMGTALSIF-CPILA 631
            N+LW L S+     +    L P WL+                + +    +GI ++CI+       ++   C  YG  F    +   EWK + +    G  +  +     +   C     R+ +    G IQAI  +F V+GL+++P G+ +  V+  C+   ++   F   +C  GW    AT+G  +  F C  LA
Sbjct:   13 NILWVLFSISAPLASIAGILTPKWLVGTIESGRTNLSQPLAPDDRGTPSIGIINHCIRFSAVIGGREKLTCMYYGNEFG--DIACDEWKASIVFLMIGTGILSVVVFMALIGFCFQSCGRKSLFQIGGLIQAIGGLFLVIGLVLYPAGWGNRRVEKLCAIRYQKADPFVMNECSFGWA-FYATLGATIGAFVCAFLA 206          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Nematostella
Match: EDO26204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCL5])

HSP 1 Score: 42.743 bits (99), Expect = 8.404e-6
Identity = 15/45 (33.33%), Postives = 25/45 (55.56%), Query Frame = 2
Query:  485 FPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFC 619
            +P G+    V+  C P++  FN G+C  GW   +  +GTA++  C
Sbjct:    8 YPSGWGGVEVRQACGPDADSFNLGQCSLGWAFYIYILGTAMAFVC 52          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Medaka
Match: si:dkey-35m8.1 (transmembrane protein 211 [Source:NCBI gene;Acc:101167817])

HSP 1 Score: 85.8853 bits (211), Expect = 2.657e-19
Identity = 60/201 (29.85%), Postives = 103/201 (51.24%), Query Frame = 2
Query:   77 ASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEA------QSPH-------CLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFL-GFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQF 637
            AS+F    +   W LLS  +  + +F+F+ P W+++       Q PH         G+  +C + +   ++    C  +GG      +PS  W+ + +L  GGC L  + ++  I T+ +      R AC L G++Q  AV     GLL++P G NS  V+ +C  +S  ++AG+C+ GWG +LA +G  L++F P  A++
Sbjct:   25 ASMFSC--VGCFWVLLSSALVAVCSFSFISPAWIVKETPRSGHQHPHPHDKGSVSFGLLWHCSESLDRMYR----CYTFGGLGRFAEIPSSSWQTSAVLCSGGCALLAVSSLLAIITVFLPSGGCERRACTLAGYMQMAAVFIMAAGLLIYPFGLNSSLVRSFCG-DSDIYHAGECQIGWGYMLAIVGVMLTVFLPFFAKY 218          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Medaka
Match: lhfpl2a (LHFPL tetraspan subfamily member 2 [Source:NCBI gene;Acc:101175333])

HSP 1 Score: 83.9593 bits (206), Expect = 1.456e-18
Identity = 60/195 (30.77%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLI-------------------EAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++       AF+   WL+                   EA  P  LGIY  CIK  H   Q   LCG Y   F    + S  W+   +    G LL    A   + T+C     ++ +    G +Q IA +F ++GL+++P G+ S+ VQ YC P+S  + AG C  GW    A  GT L+  C + +
Sbjct:   10 SMLWTLLSIVAAFGELIAFMSTDWLVGYPRTPDAVFGPHGATAAGEAYRPT-LGIYGRCIKLPH--MQRGILCGPYAVHFG--EIASGFWQAASIFLAAGILLLCAVAFISVFTMCFQSIMKKSIFNVCGLLQGIAGLFLILGLMLYPAGWGSDKVQLYCGPDSAPYRAGLCSMGWAFYTAMGGTLLTFICAVFS 199          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Medaka
Match: ENSORLT00000004077.2 (LHFPL tetraspan subfamily member 2 protein [Source:NCBI gene;Acc:101158202])

HSP 1 Score: 63.929 bits (154), Expect = 1.425e-11
Identity = 55/193 (28.50%), Postives = 84/193 (43.52%), Query Frame = 2
Query:  104 NLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHC-----------------LGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            ++LW LLS++V       F+ P WL+    PH                  LG+YS C++ +         CG Y G F    + S  W+   L    G L+  + A   I +LC     ++ +    G +QAIA +  +VGL+++P G+ S  V  YC  E+  F    C  GW    A  GT  +  C +L+
Sbjct:   10 SMLWTLLSIVVAFSELITFMSPDWLL--GPPHSDSEVNGAGVDSGEYRPSLGLYSRCLRVVGVS------CGPYAGTF--GEVASGFWQAAMLFLAAGTLVLGLVACISIFSLCFQSILKKSIFNICGLLQAIAGLLLMVGLMLYPAGWGSPKVIGYCGAEAAPFKPANCSLGWAFYAAIGGTLATFLCAVLS 192          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Medaka
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:101173878])

HSP 1 Score: 63.1586 bits (152), Expect = 2.071e-11
Identity = 50/178 (28.09%), Postives = 81/178 (45.51%), Query Frame = 2
Query:  155 AFLQPFWLIEAQ--SPHCLGIYSYCIKDIHNPHQDSQL----CGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIF-CPILAQFFDVRVCDKPY 667
             F  P+WL+  Q   P   G +  C   + +  +   +    CG Y    S   +PSL+W+I  ++ G GC L L+ A+  +   CIS    R +    G IQ +  +    G  ++P+G++SE V+  C+  S +F  G C+ GW       G A ++  C  L+ F   +    PY
Sbjct:   26 GFFMPYWLLGTQMDKPVSFGTFRRCSYPVRDEERQMTVMLEQCGRYA---SFHGIPSLQWRICTVVTGVGCGLLLLVALTALMGCCISDLISRTIGRVAGGIQFVGGLLIGSGCALYPLGWDSEEVRQTCNNSSDQFKLGSCQIGWAYYCTGAGAAAAMLICTWLSCFAGKKQKHYPY 200          
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Medaka
Match: ENSORLT00000038232.1 (LHFPL tetraspan subfamily member 3 protein [Source:NCBI gene;Acc:101157534])

HSP 1 Score: 60.077 bits (144), Expect = 3.715e-10
Identity = 47/182 (25.82%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  101 INLLWCLLSLMVGGMATFAFLQPFWL---IEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFS-LDHLPSLEWKITXXXXXXXXXXXXX-XAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILA 631
            I LLW + +++ G +    F QP+W+   ++       G++ YCI D H+     Q      G F+    +PS  +K      G    L +     F +  L +S ST  ++    G++QA++ +  V+G +++P G++S+ V+  C  ++ +++ G C   W  +LA MG   ++    LA
Sbjct:   30 IGLLWAIFTILFGIVNMTIFSQPYWIGDGVDTPQAGYFGLFHYCIGDGHSRDLACQ------GSFTEFAAIPSSAFKAASFFIGMSMTLVVTCIGCFSLFFL-LSTSTVYKIC---GWMQALSGVCLVLGCMIYPDGWDSDEVRRMCGEKTDKYSLGACSMRWAYILAIMGILDALILSFLA 201          
BLAST of LHFPL tetraspan subfamily member 2a vs. Planmine SMEST
Match: SMESG000025882.1 (SMESG000025882.1)

HSP 1 Score: 489.96 bits (1260), Expect = 2.141e-176
Identity = 269/270 (99.63%), Postives = 269/270 (99.63%), Query Frame = 2
Query:   53 MKYSDCNYASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITXXXXXXXXXXXXXXAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRVCDKPYYNSQSIYKLELNSLVKHLEILEERDIENSTETNEISQKPIXXXXXXXXXXXXXXRHDAYSSSTDH 862
            MKYSDCNYASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITCLLFGGGCLLHLICAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRVCDKPYYNSQSIYKLELNSLVKHLEILEERDIENSTETNEISQKPIFTTTATTNNFPF TRHDAYSSSTDH
Sbjct:    1 MKYSDCNYASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHCLGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITCLLFGGGCLLHLICAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFNSEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRVCDKPYYNSQSIYKLELNSLVKHLEILEERDIENSTETNEISQKPIFTTTATTNNFPFPTRHDAYSSSTDH 270          
The following BLAST results are available for this feature:
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHFPL63.287e-1630.26LHFPL tetraspan subfamily member 6 [Source:HGNC Sy... [more]
LHFPL63.287e-1630.26LHFPL tetraspan subfamily member 6 [Source:HGNC Sy... [more]
TMEM2115.180e-1430.60transmembrane protein 211 [Source:HGNC Symbol;Acc:... [more]
TMEM2115.180e-1430.60transmembrane protein 211 [Source:HGNC Symbol;Acc:... [more]
LHFPL21.177e-1227.18LHFPL tetraspan subfamily member 2 [Source:HGNC Sy... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tmhs2.555e-1127.04gene:FBgn0262624 transcript:FBtr0072836[more]
Tmhs2.555e-1127.04gene:FBgn0262624 transcript:FBtr0072837[more]
CG37706.442e-725.41gene:FBgn0035085 transcript:FBtr0343502[more]
CG37706.442e-725.41gene:FBgn0035085 transcript:FBtr0072393[more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-35m8.19.057e-2129.19si:dkey-35m8.1 [Source:ZFIN;Acc:ZDB-GENE-060526-29... [more]
lhfpl2a2.295e-2032.31LHFPL tetraspan subfamily member 2a [Source:NCBI g... [more]
lhfpl2a2.295e-2032.31LHFPL tetraspan subfamily member 2a [Source:NCBI g... [more]
lhfpl69.004e-1829.23LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
lhfpl69.004e-1829.23LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000025484.11.625e-1831.32transmembrane protein 211-like [Source:NCBI gene;A... [more]
LHFPL21.189e-1428.65LHFPL tetraspan subfamily member 2 [Source:NCBI ge... [more]
lhfpl61.958e-1427.18LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
LHFPL11.839e-1026.37LHFPL tetraspan subfamily member 1 [Source:NCBI ge... [more]
rab8a6.843e-722.70RAB8A, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhfp4.501e-1430.67lipoma HMGIC fusion partner [Source:MGI Symbol;Acc... [more]
Lhfp4.501e-1430.67lipoma HMGIC fusion partner [Source:MGI Symbol;Acc... [more]
Lhfpl23.929e-1026.70lipoma HMGIC fusion partner-like 2 [Source:MGI Sym... [more]
Lhfpl23.929e-1026.70lipoma HMGIC fusion partner-like 2 [Source:MGI Sym... [more]
Lhfpl23.929e-1026.70lipoma HMGIC fusion partner-like 2 [Source:MGI Sym... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P0C6|LHPL2_DANRE1.733e-1932.31LHFPL tetraspan subfamily member 2a protein OS=Dan... [more]
sp|Q5PRC1|LHPL6_DANRE6.797e-1729.23LHFPL tetraspan subfamily member 6 protein OS=Dani... [more]
sp|Q9Y693|LHPL6_HUMAN1.579e-1530.26LHFPL tetraspan subfamily member 6 protein OS=Homo... [more]
sp|Q6ICI0|TM211_HUMAN2.488e-1330.60Transmembrane protein 211 OS=Homo sapiens OX=9606 ... [more]
sp|Q5BJS2|LHPL6_RAT2.562e-1330.67LHFPL tetraspan subfamily member 6 protein OS=Ratt... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JJC51.981e-3936.29transmembrane protein 211-like OS=Lingula unguis O... [more]
A0A1S3H6012.045e-3936.29transmembrane protein 211 OS=Lingula unguis OX=757... [more]
R7TNS51.816e-3639.41Uncharacterized protein OS=Capitella teleta OX=283... [more]
R7TPN01.358e-3538.12Uncharacterized protein OS=Capitella teleta OX=283... [more]
R7TX232.794e-3539.89Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-35m8.14.235e-1929.35transmembrane protein 211-like [Source:NCBI gene;A... [more]
lhfpl61.531e-1829.23lipoma HMGIC fusion partner homolog [Source:NCBI g... [more]
lhfpl61.531e-1829.23lipoma HMGIC fusion partner homolog [Source:NCBI g... [more]
LHFPL62.664e-1628.72LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
LHFPL62.664e-1628.72LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lhfpl5b8.747e-822.54LHFPL tetraspan subfamily member 5b [Source:ZFIN;A... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO351751.824e-2132.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452622.363e-1228.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329061.147e-823.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262048.404e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-35m8.12.657e-1929.85transmembrane protein 211 [Source:NCBI gene;Acc:10... [more]
lhfpl2a1.456e-1830.77LHFPL tetraspan subfamily member 2 [Source:NCBI ge... [more]
ENSORLT00000004077.21.425e-1128.50LHFPL tetraspan subfamily member 2 protein [Source... [more]
LHFPL62.071e-1128.09LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
ENSORLT00000038232.13.715e-1025.82LHFPL tetraspan subfamily member 3 protein [Source... [more]
back to top
BLAST of LHFPL tetraspan subfamily member 2a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025882.12.141e-17699.63SMESG000025882.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033690 ID=SMED30033690|Name=LHFPL tetraspan subfamily member 2a|organism=Schmidtea mediterranea sexual|type=transcript|length=1006bp
TAACGATTTCAAATAAAATTTCTGATCAAACTGTGATGTTATCAAAACTG
TCATGAAGTACTCCGATTGTAATTATGCGTCAATTTTCCGGGCGAATCCC
ATCAACCTCCTTTGGTGTTTGCTGTCTCTCATGGTTGGCGGAATGGCGAC
TTTTGCATTTCTTCAACCGTTTTGGTTAATCGAAGCTCAAAGTCCTCATT
GTCTTGGAATCTATTCCTATTGCATTAAAGACATTCACAATCCTCACCAG
GACAGTCAGCTTTGTGGACTGTATGGCGGACGGTTTTCATTGGATCATTT
GCCGAGTTTGGAGTGGAAGATCACTTGTCTACTTTTCGGAGGGGGCTGCT
TGTTGCATTTGATTTGCGCGATTTTCGGAATAAGCACTTTATGCATTAGC
AAATCCACTCGACGCCGGGTTGCATGCTTTTTGGGTTTCATTCAAGCTAT
TGCAGTTATATTTTCTGTGGTCGGCCTTCTAATGTTTCCAATGGGTTTCA
ACTCAGAATTTGTCCAGCATTACTGTTCTCCAGAATCTAGACGATTCAAC
GCAGGAAAGTGTGAAGCCGGTTGGGGTCTCTTATTGGCAACAATGGGCAC
CGCTCTGTCAATTTTCTGTCCGATTTTAGCGCAATTTTTCGACGTGAGAG
TTTGCGATAAACCTTACTACAACAGCCAATCAATTTACAAGCTTGAGCTG
AACAGCTTAGTAAAACATTTGGAAATTCTTGAAGAGCGTGACATTGAAAA
TTCAACAGAAACAAATGAAATCAGTCAGAAACCTATTTTTACAACAACAG
CTACAACGAATAATTTTCCATTTTCTACTCGTCATGATGCCTACAGTAGT
TCGACGGACCACTCTTCTCCTCTTCCGCCATTTGCCTAATTATTGTCCGA
AATCGTTTGACAATATCGCAATCTGTGATCCATCAAACCGAATAATTTCT
TTAACTCCCTATTTTTGGTTTTATTTTCTTGTACAGAATCAGTTTTTTTA
TTTATA
back to top

protein sequence of SMED30033690-orf-1

>SMED30033690-orf-1 ID=SMED30033690-orf-1|Name=SMED30033690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MKYSDCNYASIFRANPINLLWCLLSLMVGGMATFAFLQPFWLIEAQSPHC
LGIYSYCIKDIHNPHQDSQLCGLYGGRFSLDHLPSLEWKITCLLFGGGCL
LHLICAIFGISTLCISKSTRRRVACFLGFIQAIAVIFSVVGLLMFPMGFN
SEFVQHYCSPESRRFNAGKCEAGWGLLLATMGTALSIFCPILAQFFDVRV
CDKPYYNSQSIYKLELNSLVKHLEILEERDIENSTETNEISQKPIFTTTA
TTNNFPFSTRHDAYSSSTDHSSPLPPFA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019372LHFPL
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019372Lipoma HMGIC fusion partner-like proteinPFAMPF10242L_HMGIC_fplcoord: 18..192
e-value: 1.9E-29
score: 103.2
IPR019372Lipoma HMGIC fusion partner-like proteinPANTHERPTHR12489LIPOMA HMGIC FUSION PARTNER-LIKE PROTEINcoord: 12..199
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 16..204
e-value: 1.4E-6
score: 29.8
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 123..145