Cleft lip and palate transmembrane protein 1

Overview
NameCleft lip and palate transmembrane protein 1
Smed IDSMED30033688
Length (bp)3617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cleft lip and palate transmembrane protein 1 (SMED30033688) t-SNE clustered cells

Violin plots show distribution of expression levels for Cleft lip and palate transmembrane protein 1 (SMED30033688) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cleft lip and palate transmembrane protein 1 (SMED30033688) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cleft lip and palate transmembrane protein 1 (SMED30033688) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033688

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033688h1SMcG0006501 SmedASXL_014345SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30033688h1SMcG0006501 SmedASXL_014345SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30033688h1SMcG0006502 dd_Smed_v4_2152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033688h1SMcG0006502 dd_Smed_v4_2152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033688h1SMcG0006502 dd_Smed_v4_2152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033688h1SMcG0006502 dd_Smed_v4_2152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033688h1SMcG0006502 dd_Smed_v4_2152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033688h1SMcG0006502 dd_Smed_v4_2152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Human
Match: CLPTM1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:HGNC Symbol;Acc:HGNC:2087])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 318/556 (57.19%), Postives = 425/556 (76.44%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            W ++KG +FR+ +I+ ISS FRR P  +   G   P  A  +A  NL+ K T  +L+VY S+   F DF+   +LFW   ++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+TNPYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + GIFPR++F  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E
Sbjct:   53 WQVIKGVLFRIFIIWAISSWFRRGPAPQDQAG---PGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPW--NFLGDELYEQSDEEQDSVKVALLETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGE 603          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Human
Match: CLPTM1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:HGNC Symbol;Acc:HGNC:2087])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 318/556 (57.19%), Postives = 425/556 (76.44%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            W ++KG +FR+ +I+ ISS FRR P  +   G   P  A  +A  NL+ K T  +L+VY S+   F DF+   +LFW   ++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+TNPYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + GIFPR++F  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E
Sbjct:   39 WQVIKGVLFRIFIIWAISSWFRRGPAPQDQAG---PGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPW--NFLGDELYEQSDEEQDSVKVALLETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGE 589          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Human
Match: CLPTM1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:HGNC Symbol;Acc:HGNC:2087])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 297/502 (59.16%), Postives = 395/502 (78.69%), Query Frame = 1
Query: 1666 DLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            +L+VY S+   F DF+   +LFW   ++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+TNPYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + GIFPR++F  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E
Sbjct:    2 NLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPW--NFLGDELYEQSDEEQDSVKVALLETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGE 501          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Human
Match: CLPTM1L (CLPTM1 like [Source:HGNC Symbol;Acc:HGNC:24308])

HSP 1 Score: 339.347 bits (869), Expect = 1.879e-103
Identity = 182/468 (38.89%), Postives = 287/468 (61.32%), Query Frame = 1
Query: 1783 DGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHL-PPVTHWHPNMTIHMLDDHTSWTPGSVPPPLN---EMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            +  FE   N++  +  +NNG+ Y +I++  +G  P  D +  +    LT Y   MV K          NLLTGE+DT  +++A K   S L  PV+HW P + ++++ D+  +   S+P  ++   +M++    T  Y P++F++   N  +D MV+N + TELPL + +  +SL +L+ ++           ++       S+++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++S+ G+S ++V +  F +V++ L++LD  T+ +V V   +G  IE+WK+KK + +T+       G+ P   F   S  +E  T++YD  A KYLS++L+PL VG A+YSLL +++  WYSW+++     +  FGF+ M PQLF+NYK+KSVAHLPW+  TYKA NTFIDD+FAF+I MPT +R+ C RDDV+F +YLYQRW+YP+D +R NE+G S E
Sbjct:   83 ESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTY---MVPK------PEEINLLTGESDT-QQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQL-GKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQ------DAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIELWKVKKALKMTIFWR----GLMPEFQFGTYSE-SERKTEEYDTQAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYE 528          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Human
Match: CLPTM1L (CLPTM1 like [Source:HGNC Symbol;Acc:HGNC:24308])

HSP 1 Score: 339.347 bits (869), Expect = 1.879e-103
Identity = 182/468 (38.89%), Postives = 287/468 (61.32%), Query Frame = 1
Query: 1783 DGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHL-PPVTHWHPNMTIHMLDDHTSWTPGSVPPPLN---EMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            +  FE   N++  +  +NNG+ Y +I++  +G  P  D +  +    LT Y   MV K          NLLTGE+DT  +++A K   S L  PV+HW P + ++++ D+  +   S+P  ++   +M++    T  Y P++F++   N  +D MV+N + TELPL + +  +SL +L+ ++           ++       S+++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++S+ G+S ++V +  F +V++ L++LD  T+ +V V   +G  IE+WK+KK + +T+       G+ P   F   S  +E  T++YD  A KYLS++L+PL VG A+YSLL +++  WYSW+++     +  FGF+ M PQLF+NYK+KSVAHLPW+  TYKA NTFIDD+FAF+I MPT +R+ C RDDV+F +YLYQRW+YP+D +R NE+G S E
Sbjct:   83 ESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTY---MVPK------PEEINLLTGESDT-QQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQL-GKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLRFWIHMQ------DAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIELWKVKKALKMTIFWR----GLMPEFQFGTYSE-SERKTEEYDTQAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYE 528          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Celegans
Match: C36B7.6 (pep chromosome:WBcel235:X:7097434:7100338:-1 gene:WBGene00016469.1 transcript:C36B7.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.6)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 297/557 (53.32%), Postives = 395/557 (70.92%), Query Frame = 1
Query: 1513 SMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAG----INLYQKGTWFDLYVYTSDMYT-FNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            S++ G + + M+ YFIS++  +   +++     +  A + G    +NL+  G  +D Y+Y  D    FN F N G LF   K + YGDWT GPN DGS+         E L  N S+YLH ++V +G SP+P  KNY ++  +Y    + K+KK+  ++T NLLTG ++  +E  A K+       +  WHPNM+++++DDH+ W  G++PPPL++ V+F  +   Y+P++F N+YWNL  DYM +NETV EL L++ F P+S+FK Q+Y +Q+MRS+W         +    E+ D++K  +L+TNP LLG+T+ VS++H+V EFLAFKNDIQFWR+R+ L GLSVRSV FN+FQS+IV LY+ DN+TNFMVK SV  GLLIE WKI KV+N+  +R  PI G+ PR+ FS K SY ESDTK YDQ+AF+YLSW+LFPLLVGYA+YS++Y+E  GWYSWVL+M YG+LLMFGFI MTPQLFINYK+KSVAHLPWR LTYK +NTFIDD+FAFVIKMP LYRIGC RDD+IF IYLYQRWIY +DP R NEYG S E
Sbjct:   26 SILFGILKQCMMFYFISTMLGKMGGSQSKTN-STAAANVKGMPPSVNLFPPGQIYDFYLYLDDSEERFNHFEN-GFLFAQKKGLRYGDWTGGPNKDGSYVFEKTFPTPEVLLRNQSYYLHAFLVKNGQSPNPADKNYIRREVVYGVHQLNKYKKKHYKKTANLLTGVSEQSDEDLA-KAEIMKFEILNFWHPNMSVNIVDDHSQWQKGAIPPPLDKDVKFAPNGEFYHPILFFNNYWNLGADYMPINETVKELKLSVTFYPLSIFKYQMYASQNMRSQW------SDYLHTEKEDDDSVKVALLETNPILLGVTIAVSLLHTVLEFLAFKNDIQFWRSRKDLVGLSVRSVLFNIFQSLIVFLYICDNETNFMVKFSVGAGLLIECWKIPKVMNVEFDRTNPILGVIPRLKFSDKGSYVESDTKVYDQMAFRYLSWVLFPLLVGYAVYSIIYVEQRGWYSWVLNMLYGYLLMFGFITMTPQLFINYKLKSVAHLPWRMLTYKFINTFIDDLFAFVIKMPLLYRIGCFRDDIIFLIYLYQRWIYRVDPTRMNEYGTSGE 573          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Celegans
Match: R166.2 (pep chromosome:WBcel235:II:10534332:10537671:-1 gene:WBGene00011302.1 transcript:R166.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R166.2)

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 290/560 (51.79%), Postives = 381/560 (68.04%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAG-----INLYQKGTWFDLYVYTSDM-YTFNDF-SNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            W M+K  I    V+  +S  FR    + +P    +  A+ AG     +N++     FDLYVY  D    F  F S    L W    ++Y DW +G N DGS     N      L  N S +LH +IV +G SP+P+ +NY K   IYK+  + K+KK+  R+T+NLLTGE++  +E  A   +  +   + HWHPN++I ++ D T W  G +PPPL+E +EF    + Y P++F N++WNL  DY  +NETV +L L + + P+S+FK Q+Y +Q M+S+W   M         D+  D++K+ +L+TNP LL +T+IVS++H+VFEFLAFKNDIQFW NR+ L GLSVRSV FN+FQS+IV LY+ DN+TN MVKV+V +GLLIE WKI KV+N++++ +   FG+ PR+  S K SY ES+TK YDQ+AFKYL W LFPLLVGYAIYS++Y+E  GWYSWVL+M YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYK +NTFIDD+FAFVI+MP LYRIGC RDD+IF IYLYQRW Y IDP R NE+G S E
Sbjct:   24 WGMIKQAITIYFVVSMVSGFFRP---SSSPGNDGNVTASTAGNGNKAMNMFPNHQIFDLYVYMDDSDLPFRQFDSAPEKLIWMRNGMKYDDWISGDNEDGSHTIHKNFPTPAALLRNDSLWLHTFIVKAGQSPNPKDRNYFKNQIIYKSYQLNKYKKKYYRKTSNLLTGESEQSDEDLAKAQIMKY-EVLNHWHPNISISLVVDQTPWARGQIPPPLSEDIEFNEDGTIYKPILFYNNWWNLGADYQPINETVKDLNLTITYYPMSVFKYQMYASQRMQSQW-QSMLSMDGADMDDDGHDSMKQALLETNPILLAVTMIVSLLHTVFEFLAFKNDIQFWNNRKDLVGLSVRSVLFNIFQSLIVFLYICDNETNTMVKVTVGIGLLIECWKIPKVMNVSIDWQNKWFGVIPRLVISDKGSYVESETKIYDQMAFKYLGWALFPLLVGYAIYSVIYVEQKGWYSWVLNMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKFINTFIDDLFAFVIRMPLLYRIGCFRDDIIFLIYLYQRWAYRIDPTRLNEFGTSLE 578          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Celegans
Match: T13H5.8 (pep chromosome:WBcel235:II:8518510:8520700:1 gene:WBGene00011761.1 transcript:T13H5.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13H5.8)

HSP 1 Score: 258.455 bits (659), Expect = 2.430e-74
Identity = 133/329 (40.43%), Postives = 196/329 (59.57%), Query Frame = 1
Query: 2176 YYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQES--DEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYG 3156
            Y P++F+++    ++    + +    + L + + P S+ KL L +  + RS          +M+    D++ D L+    +T+  LL +T  VS +H +F+ LAFKNDI FW+ R+S+ GLS +++ +  F   I+  Y+ D  T+ +V +   +  +IE WK+     +T+  +   FG         K S  E +T   D  A KYLS +L PL++G AIYSLLY+ H  W SW+L  S   +  FGF+ M PQLF+NYK+KSVAHLPWR   YKA NTFIDD+FAFVI MPT +R+ C RDD++F +YLYQRW+YP+D  R NE+G
Sbjct:  214 YLPIMFVDEMSMRSKHLYELADFQKSVNLTINYEPTSVAKL-LLLTSTARST-------HQLMKHGFKDKDVDELRGLFTETSIVLLMVTFFVSTLHLLFDALAFKNDISFWKGRKSMVGLSTKTLLWRCFSQTIIFFYLFDQQTSLLVLIPAGIATVIEYWKVTIAYKVTITWKGIKFG---------KHSTEEDETDSIDSQAMKYLSILLVPLVIGGAIYSLLYVPHKSWRSWILETSANGVYAFGFLFMLPQLFVNYKLKSVAHLPWRAFMYKAFNTFIDDLFAFVITMPTAHRMACFRDDIVFLVYLYQRWLYPVDYTRINEFG 525          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Celegans
Match: ulp-1 (Sentrin-specific protease [Source:UniProtKB/Swiss-Prot;Acc:Q09353])

HSP 1 Score: 193.356 bits (490), Expect = 4.259e-51
Identity = 103/262 (39.31%), Postives = 153/262 (58.40%), Query Frame = 1
Query:  664 GSYIEDITDYFRELCYIPPLVFPRLSKKVV-----LPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLLSSM 1434
            G  +ED+     EL  I   + P++ KK V     LP   D +   V  +    N +   V+ F++ I   DL +L    WL D IINFYL+LI  R+N +++YP +    TFFY  + S GY+ VKRWT+K  +F   +VL+P+HLG HWC+  IDM  +++ +YDSL   N   L  ++ +L  +S DK K  ++ S WT +Q+ D P Q NG DCGVF  Q  E+ SRR+   F Q  M Y+R++M +EI++K+LL+++
Sbjct:  442 GDRLEDVRKRL-ELQGIA--IRPKVEKKKVDDFMALPDAADAL---VERAWSGGNPNEQFVDAFSIQICKKDLATLSGLHWLNDEIINFYLQLICDRSNGDSKYPKIYAFNTFFYSNIVSKGYASVKRWTRKVDIFAFDIVLVPVHLGMHWCMAVIDMGEKKIEFYDSLYDGNTAVLPALRGYLEAESLDKKKTAMNFSGWTIQQMTDIPRQQNGSDCGVFSCQFGEWASRRTTPRFTQKNMPYYRKRMVYEIVSKKLLATI 697          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Fly
Match: CG3702 (gene:FBgn0031590 transcript:FBtr0334790)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 304/569 (53.43%), Postives = 407/569 (71.53%), Query Frame = 1
Query: 1507 FWSMMKGFIFRMMVIYFISSLFRRQPVTETPNG--VRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMM----QESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEK 3195
            F++M K  I R ++IYF+SS FRR        G  V +    +   N ++ GT FDL+V+ S+     +F    +L W  K++ YGDWT+G N DG +     +  S++L NNGS YLH ++  +G SPDP++ NY  K+   ++++    K R  R    L + +    +ELK     ++    V+HWHPN+T++++ D T+W  GSVPPPL++ V+F      Y P++F+NDYWNL ++Y  +NET  EL L+L F P+ +FK QLY A+ M++KW G M GE M     +ESDE+QD+LK+T+LDTN YLLG+TV VSI+HSVFE LAFKNDIQFW NR+SLEGLSVRSVFF VFQS+I++LYVLDN+TNFM+++S  +GL IE+WKI KV++I  + +Q I G+ PRI+F  K SY+ES TK YD+LAFKYL W  FPLLV Y +YSL+Y EH GWYS+VL+M YG+LL FGFI+MTPQLFINYK+KSVAH+PWR +TYK LNTFIDDIFAFVIKMPT+YR+GC RDD+IFF++LYQRW Y +D KR NE+G S EM +++ A+K
Sbjct:   47 FFAMTKSLILRALIIYFVSSFFRRPAPDAASQGKSVANAGPKITAWNYFENGTDFDLHVWLSENPDVVNFQQKANLLWLQKDLTYGDWTSGVNGDGIYTHSLKLKTSQHLMNNGSVYLHAFVTRTGMSPDPKAPNYATKMGHQQHQLNKFKKLRVNRNYNLLASEKEKLEHELKHANLKDT---IVSHWHPNLTVNLVVDQTNWAEGSVPPPLDDYVKFVDGGKTYLPILFVNDYWNLQREYQPINETTPELELHLTFQPLGMFKWQLYAAKQMKNKWAGNMLGELMAASQPEESDEDQDSLKETLLDTNIYLLGITVAVSILHSVFELLAFKNDIQFWNNRKSLEGLSVRSVFFGVFQSLIILLYVLDNETNFMIRISCFVGLGIEVWKIHKVVDINYDHDQKILGVLPRISFQDKGSYSESSTKDYDKLAFKYLGWACFPLLVAYFVYSLIYNEHKGWYSFVLNMLYGYLLTFGFILMTPQLFINYKLKSVAHMPWRMMTYKFLNTFIDDIFAFVIKMPTMYRLGCFRDDIIFFVFLYQRWQYRVDLKRVNEFGFSGEMEQQHAAQK 612          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Fly
Match: CG3702 (gene:FBgn0031590 transcript:FBtr0077477)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 304/569 (53.43%), Postives = 407/569 (71.53%), Query Frame = 1
Query: 1507 FWSMMKGFIFRMMVIYFISSLFRRQPVTETPNG--VRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMM----QESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEK 3195
            F++M K  I R ++IYF+SS FRR        G  V +    +   N ++ GT FDL+V+ S+     +F    +L W  K++ YGDWT+G N DG +     +  S++L NNGS YLH ++  +G SPDP++ NY  K+   ++++    K R  R    L + +    +ELK     ++    V+HWHPN+T++++ D T+W  GSVPPPL++ V+F      Y P++F+NDYWNL ++Y  +NET  EL L+L F P+ +FK QLY A+ M++KW G M GE M     +ESDE+QD+LK+T+LDTN YLLG+TV VSI+HSVFE LAFKNDIQFW NR+SLEGLSVRSVFF VFQS+I++LYVLDN+TNFM+++S  +GL IE+WKI KV++I  + +Q I G+ PRI+F  K SY+ES TK YD+LAFKYL W  FPLLV Y +YSL+Y EH GWYS+VL+M YG+LL FGFI+MTPQLFINYK+KSVAH+PWR +TYK LNTFIDDIFAFVIKMPT+YR+GC RDD+IFF++LYQRW Y +D KR NE+G S EM +++ A+K
Sbjct:   47 FFAMTKSLILRALIIYFVSSFFRRPAPDAASQGKSVANAGPKITAWNYFENGTDFDLHVWLSENPDVVNFQQKANLLWLQKDLTYGDWTSGVNGDGIYTHSLKLKTSQHLMNNGSVYLHAFVTRTGMSPDPKAPNYATKMGHQQHQLNKFKKLRVNRNYNLLASEKEKLEHELKHANLKDT---IVSHWHPNLTVNLVVDQTNWAEGSVPPPLDDYVKFVDGGKTYLPILFVNDYWNLQREYQPINETTPELELHLTFQPLGMFKWQLYAAKQMKNKWAGNMLGELMAASQPEESDEDQDSLKETLLDTNIYLLGITVAVSILHSVFELLAFKNDIQFWNNRKSLEGLSVRSVFFGVFQSLIILLYVLDNETNFMIRISCFVGLGIEVWKIHKVVDINYDHDQKILGVLPRISFQDKGSYSESSTKDYDKLAFKYLGWACFPLLVAYFVYSLIYNEHKGWYSFVLNMLYGYLLTFGFILMTPQLFINYKLKSVAHMPWRMMTYKFLNTFIDDIFAFVIKMPTMYRLGCFRDDIIFFVFLYQRWQYRVDLKRVNEFGFSGEMEQQHAAQK 612          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Fly
Match: CG4332 (gene:FBgn0030456 transcript:FBtr0073726)

HSP 1 Score: 287.345 bits (734), Expect = 1.538e-84
Identity = 156/465 (33.55%), Postives = 249/465 (53.55%), Query Frame = 1
Query: 1777 NHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNEL--KANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSY--------TESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKR 3141
            ++D +FE    ++     + NGS YLH+ +   G   + +S   D   T+     +T +   +      L   E      +  K  K   +   P TH   N+ + +L+D  S +   VPP +  ++   +   +  P++  + +    +D + V    TE   +  + P+ + KL+L +     ++          +  + ++ D +K    DTN YLL  T+ VS +H +F+FL+FKND+ FWR ++S EGLS R+  +  F  +++  Y+LD +T+++V V V LG LIE+WK KK+  + ++    +     ++   +             E  T ++D+   +YLS++L+PL +  A+YSLLY  H  WYSW L+     +  FGF+ M PQLF+NYK+KSVA LPWR   YKA NTFIDD FAF+I MPT +R+ CLRDD++F IYLYQRW+YP+D  R
Sbjct:   77 DYDQNFEHDFEVDVPLRTRRNGSLYLHVVLALEGEPLEWRSLRRDGP-TVVHTMSLTDYIVPRAEAFKLLGDSEKGAAAAVQEKEKKKASTTGRPSTHIRSNVYVTLLNDLYSVSQADVPPEMAPLIRV-NRNQQILPILQTDTFNTRLKDLVPVTRNTTEFTFSFHYKPVGVGKLRLMLLMEHATQ------ALLTIGFATKDIDEVKGIFSDTNVYLLCGTIFVSSIHMLFDFLSFKNDVAFWRKKQSYEGLSSRTTMWRAFSQIVIFFYLLDENTSYLVLVPVGLGTLIELWKCKKIFRLELSFSGLVRRKLEQVDRRNGDQAGVKSGQLAEEQKTDQFDRQGMRYLSYLLYPLCICGAVYSLLYQPHRSWYSWTLNSLVNGVYAFGFLFMLPQLFVNYKLKSVAALPWRAFMYKAFNTFIDDFFAFIITMPTAHRVACLRDDIVFIIYLYQRWLYPVDKSR 533          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Fly
Match: CG32110 (gene:FBgn0052110 transcript:FBtr0075931)

HSP 1 Score: 154.836 bits (390), Expect = 3.308e-40
Identity = 81/202 (40.10%), Postives = 121/202 (59.90%), Query Frame = 1
Query:  823 VVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSN-NQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIH-LGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQL 1422
            V+V +FNL I  +D+  L    WL D IINFY+ L+  R+       PSV  ++TFF P+L  SG+ GVKRWT+K  +F   L+L+P+H +  HWCLV ID+  + + YY+S    +P  +  + ++L  +S+DKL   +  SE+  +   + P Q N  DCGVF+   AEYL+R + + F++  M+YFR KM  E+   QL
Sbjct:  208 VIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGDQL 409          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Fly
Match: Ulp1 (gene:FBgn0027603 transcript:FBtr0074693)

HSP 1 Score: 153.295 bits (386), Expect = 4.610e-37
Identity = 85/251 (33.86%), Postives = 136/251 (54.18%), Query Frame = 1
Query:  697 RELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVE-------EFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSN-NQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGN-HWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQL 1422
            R    I PL  P   K+  L  +T E           R ++M  +E       ++NL IT  D+ +    +WL D IINFY+ ++  R+     + P+   + TFF P+L  +GY+GV+RWT+K  +F   ++ +P+H GN HWC+  I + N+ + YYDS+   N   L+ + ++L E+S DK K+   ++ +  +   + P Q N  DCGVF    AEY++R   + F+Q +M YFR KM+ EI + +L
Sbjct: 1269 RPFFEIGPLEQPEEKKETKLIPLTKEDHA--------RFQEMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRTKMALEIADGKL 1511          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Zebrafish
Match: clptm1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:NCBI gene;Acc:795480])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 327/556 (58.81%), Postives = 425/556 (76.44%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  +   NL+ K T  DLYVY S+   F DF+N   LFW+ +++ YG+WT G + DG +E +  ++ SE++K NGS Y+HIY   SG  PDP+ K   ++L T++  +M+ K+K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +N+T+  LPL L + P+SL++ QLY AQS RS W     GE   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  I GI PR+ F  KS+Y ES TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   51 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRVPSRNLFPKDTLMDLYVYISESEIFTDFNNTEELFWYQQDLVYGEWTTGDSGDGCYEYYKELDLSESVKQNGSIYMHIYFTKSGFHPDPKRKGQYRRLSTVHATRMLNKYKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQHVKFDAVSGDYYPIVYFNDYWNLQKDYYPINDTLLNLPLRLTYCPLSLWRWQLYAAQSARSPW--NFLGEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDFWKITKVMDVRLDRENRIAGIVPRLVFKDKSTYVESSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 599          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Zebrafish
Match: clptm1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:NCBI gene;Acc:795480])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 327/556 (58.81%), Postives = 425/556 (76.44%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  +   NL+ K T  DLYVY S+   F DF+N   LFW+ +++ YG+WT G + DG +E +  ++ SE++K NGS Y+HIY   SG  PDP+ K   ++L T++  +M+ K+K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +N+T+  LPL L + P+SL++ QLY AQS RS W     GE   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  I GI PR+ F  KS+Y ES TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   52 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRVPSRNLFPKDTLMDLYVYISESEIFTDFNNTEELFWYQQDLVYGEWTTGDSGDGCYEYYKELDLSESVKQNGSIYMHIYFTKSGFHPDPKRKGQYRRLSTVHATRMLNKYKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQHVKFDAVSGDYYPIVYFNDYWNLQKDYYPINDTLQNLPLRLTYCPLSLWRWQLYAAQSARSPW--NFLGEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDFWKITKVMDVRLDRENRIAGIVPRLVFKDKSTYVESSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 600          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Zebrafish
Match: clptm1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:NCBI gene;Acc:795480])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 327/556 (58.81%), Postives = 425/556 (76.44%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  +   NL+ K T  DLYVY S+   F DF+N   LFW+ +++ YG+WT G + DG +E +  ++ SE++K NGS Y+HIY   SG  PDP+ K   ++L T++  +M+ K+K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +N+T+  LPL L + P+SL++ QLY AQS RS W     GE   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  I GI PR+ F  KS+Y ES TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   29 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRVPSRNLFPKDTLMDLYVYISESEIFTDFNNTEELFWYQQDLVYGEWTTGDSGDGCYEYYKELDLSESVKQNGSIYMHIYFTKSGFHPDPKRKGQYRRLSTVHATRMLNKYKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQHVKFDAVSGDYYPIVYFNDYWNLQKDYYPINDTLLNLPLRLTYCPLSLWRWQLYAAQSARSPW--NFLGEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDFWKITKVMDVRLDRENRIAGIVPRLVFKDKSTYVESSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 577          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Zebrafish
Match: clptm1l (CLPTM1 like [Source:NCBI gene;Acc:436653])

HSP 1 Score: 331.643 bits (849), Expect = 9.016e-101
Identity = 173/462 (37.45%), Postives = 281/462 (60.82%), Query Frame = 1
Query: 1792 FETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLP-PVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSE--YYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            FE   N++  +  + NG+ Y  +++  +G SP  DP   +   +LT Y   M+ K        +      E + P++ K  +S +S L  PV+HW   +T++++ ++  +   ++P  ++  +  Y S  +  Y P++F+++  N  +D M +N + TELPL + +  I+L KL+ ++           ++       ++++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW++++S+ G+S ++V +  F ++++ LY+LD  T+ +V V   +G LIE+WK+KK   I V       G+ P   F  K   +E  T++YD LA KYLS++L+PL VG A+Y+L+++++  WYSW+++     +  FGF+ M PQLF+NYK+KSVAHLPW+   YKA NTFIDD+FAF+I MPT +R+ C RDDV+F +YLYQRW+YP+D  R NEYGVS
Sbjct:   85 FEKLVNVSLPKKTRKNGTLYAMVFLHQAGVSPWQDPHQVHLVTQLTTY---MLPK----PPEISLITGQDEPEKPDQQK--QSSDSELDRPVSHWRSRLTLNVVSENFLFDREALPGDVHRYMRVYQSGKKMIYLPLLFVDELSNRVKDLMEINSSSTELPLTITYDSIALGKLRFWIHMQ------DAVYSLQQFGFTEKDADEIKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKHKKSMVGMSSKAVLWRCFSTIVIFLYLLDEQTSLLVLVPAGIGSLIEVWKVKKAFKIHVIWR----GLTPTFLFG-KLDESEKRTEEYDTLAMKYLSYLLYPLCVGGAVYALVFVKYKSWYSWIINSLVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFMYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDRSRVNEYGVS 526          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Zebrafish
Match: si:dkey-21c19.3 (si:dkey-21c19.3 [Source:ZFIN;Acc:ZDB-GENE-030131-6462])

HSP 1 Score: 198.364 bits (503), Expect = 2.474e-52
Identity = 94/225 (41.78%), Postives = 145/225 (64.44%), Query Frame = 1
Query:  757 PKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTF--KQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            P++T+EM N V+ ++   ++D ++ E F L+IT  DL +L    WL D +INFY+ L+  R+   +  PS     TFF+PKLRSSGYS V+RWTKK  +F   L+L+P+HLG HWCL  +D  N+ + Y+DS+ G N E   ++  +L ++S+DK  +++  S W+   K+  + P Q NG DCG+F  + AEY+++   + F Q  M YFR++M +EILN++LL
Sbjct:  505 PELTEEMENDVSRALRGGSQDEILSEGFRLTITRKDLQTLSHLNWLNDEVINFYMNLLVERSKQPD-LPSAYTFNTFFFPKLRSSGYSAVRRWTKKVDIFSVDLILVPVHLGVHWCLSVVDFRNKSITYFDSMGGNNDEACRILLNYLKQESEDKKGQKMETSGWSLKSKRPNEIPQQMNGSDCGMFTCKYAEYITKDRSITFTQKHMPYFRKRMVWEILNRKLL 728          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Xenopus
Match: pglyrp1-like.1 (pglyrp1 protein [Source:Xenbase;Acc:XB-GENE-5778936])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 315/609 (51.72%), Postives = 424/609 (69.62%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTE---TPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNK--------------------------------------------MVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAE 3192
            W ++KG +FR+ +I+ ISS FRR    +   TP G   P +     NL+ K T  DL VY S+  +F +F+++  +FW  +++ YGDW++G N DG +E + +I   E ++NNGS+Y+H+Y+  SG  PDP  K   ++L T++ ++                                            ++ K+K+R+  +T NLLTGET+   E+         +  ++HWH N+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY+ VN +VT LPL + F P+SL++ QLY AQS RS W     GE + ++SDEEQD++K  +L+TNPYLL +T+ VSI+HS+FEFLAFKNDIQFW +R+SLEGLSVRSV F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  + GIFPR+T   KS+Y ES TK YD +AF+YLSWIL+PLL  YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S E      A+
Sbjct:   60 WQVIKGVLFRIFIIWAISSWFRRGSAPQDQATPTGAPRPPSR----NLFPKDTLMDLRVYLSEKESFTEFNSSSLVFWEQRDLVYGDWSSGANGDGCYEQYSDIQVPEGVQNNGSYYIHVYLTKSGFDPDPSQKALYRRLATVHTSRSKEVVSTYLSSSIFFPSLASCVLFFALSISFSLLLICFYYLLFPVLNKYKRRRFLKTKNLLTGETEADPEMIKRAEDFGPIEIISHWHTNLTINIVDDHTPWVQGSVPPPLDQYVKFDAVSGDYYPILYFNDYWNLQKDYIPVNTSVTTLPLRVTFCPLSLWRWQLYAAQSSRSPW--NFLGEELYEQSDEEQDSVKVALLETNPYLLALTITVSIIHSIFEFLAFKNDIQFWNSRQSLEGLSVRSVIFGVFQSLVVLLYILDNETNFVVQVSVGIGLLIDFWKITKVMDVRLDRENKVAGIFPRVTVKDKSTYVESSTKVYDDMAFRYLSWILYPLLACYAVYSLLYMEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPTRLNEFGTSGEAPTSLPAQ 662          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Xenopus
Match: pglyrp1-like.1 (pglyrp1 protein [Source:Xenbase;Acc:XB-GENE-5778936])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 309/547 (56.49%), Postives = 413/547 (75.50%), Query Frame = 1
Query: 1540 MMVIYFISSLFRRQPVTE---TPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            + +I+ ISS FRR    +   TP G   P +     NL+ K T  DL VY S+  +F +F+++  +FW  +++ YGDW++G N DG +E + +I   + ++NNGS+Y+H+Y+  SG  PDP  K   ++L T++ ++M+ K+K+R+  +T NLLTGET+   E+         +  ++HWH N+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY+ VN +VT LPL + F P+SL++ QLY AQS RS W     GE + ++SDEEQD++K  +L+TNPYLL +T+ VSI+HS+FEFLAFKNDIQFW +R+SLEGLSVRSV F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ V R+  + GIFPR+T   KS+Y ES TK YD +AF+YLSWIL+PLL  YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S E
Sbjct:   26 IFIIWAISSWFRRGSAPQDQATPTGAPRPPSR----NLFPKDTLMDLRVYLSEKESFTEFNSSSLVFWEQRDLVYGDWSSGANGDGCYEQYSDI---QGVQNNGSYYIHVYLTKSGFDPDPSQKALYRRLATVHTSRMLNKYKRRRFLKTKNLLTGETEADPEMIKRAEDFGPIEIISHWHTNLTINIVDDHTPWVQGSVPPPLDQYVKFDAVSGDYYPILYFNDYWNLQKDYIPVNTSVTTLPLRVTFCPLSLWRWQLYAAQSSRSPW--NFLGEELYEQSDEEQDSVKVALLETNPYLLALTITVSIIHSIFEFLAFKNDIQFWNSRQSLEGLSVRSVIFGVFQSLVVLLYILDNETNFVVQVSVGIGLLIDFWKITKVMDVRV-RKNKVAGIFPRVTVKDKSTYVESSTKVYDDMAFRYLSWILYPLLACYAVYSLLYMEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPTRLNEFGTSGE 562          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Xenopus
Match: cdhr1 (cadherin related family member 1 [Source:Xenbase;Acc:XB-GENE-478982])

HSP 1 Score: 335.109 bits (858), Expect = 7.082e-102
Identity = 188/507 (37.08%), Postives = 297/507 (58.58%), Query Frame = 1
Query: 1669 LYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHL--PPVTHWHPNMTIHMLDDHTSWTPGSVPPPLN---EMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            L VYT+   T +   NN  L  ++ N +          D  FE   N+   +  +NNG+ Y ++++  +G  P  D +  +    LT Y   M+ K          NL+TGET T  ++  +K  E++    PV+HW   +T++++ +   +   S+P  ++   +M++   S   Y P++F++   N  +D M++N + TELPL + +  ISL KL+ ++           ++       S+++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++++ G+S ++V +  F +V++ L++LD  T+ +V +   +G +IE+WK+KK + I+        G+ P I F   S  +E  T++YD  A KYLS++L+PL +G A+YSLL + +  WYSW+++     +  FGF+ M PQLF+NYKMKSVAHLPW+  TYKA NTFIDD+FAF+I MPT +R+ C RDDV+F IYLYQRW+YP+D  R NEYG S E
Sbjct:   55 LSVYTTTRTTISA-ENNVDLVLNVDNFDV---------DSKFERTVNVTVPKKTRNNGTLYAYVFLHHAGVLPWHDGKQVHILSPLTTY---MIPK------PEEVNLITGETGT-QQIDTDKKKETYALDEPVSHWRSRLTLNVMVEDFVFDGSSLPADVHRYMKMIQLGKSVY-YLPIIFIDQLSNRVKDLMMINRSTTELPLTVSYDKISLGKLRFWIHMQ------DAVYSLQQFGFSEKDADEVKGLFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKNMVGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLIPAGIGAIIEVWKVKKALKISFRWN----GLMPEIKFGAHSE-SERKTEEYDTQAMKYLSYLLYPLCIGGAVYSLLNIRYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLIYLYQRWLYPVDKSRVNEYGESYE 529          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Xenopus
Match: cdhr1 (cadherin related family member 1 [Source:Xenbase;Acc:XB-GENE-478982])

HSP 1 Score: 318.546 bits (815), Expect = 6.338e-96
Identity = 182/507 (35.90%), Postives = 291/507 (57.40%), Query Frame = 1
Query: 1669 LYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHL--PPVTHWHPNMTIHMLDDHTSWTPGSVPPPLN---EMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            L VYT+   T +   NN  L  ++ N +          D  FE   N+   +  +NNG+ Y ++++  +G  P  D +  +    LT Y   M+ K          NL+TGET T  ++  +K  E++    PV+HW   +T++++ +   +   S+P  ++   +M++   S   Y P++F++   N  +D M++N + TELPL + +  ISL KL+ ++           ++       S+++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++++ G+S ++V +  F +V++ L++LD  T+ +V +   +G +IE+WK+KK + I+        G+ P I         + +   +   A KYLS++L+PL +G A+YSLL + +  WYSW+++     +  FGF+ M PQLF+NYKMKSVAHLPW+  TYKA NTFIDD+FAF+I MPT +R+ C RDDV+F IYLYQRW+YP+D  R NEYG S E
Sbjct:   55 LSVYTTTRTTISA-ENNVDLVLNVDNFDV---------DSKFERTVNVTVPKKTRNNGTLYAYVFLHHAGVLPWHDGKQVHILSPLTTY---MIPK------PEEVNLITGETGT-QQIDTDKKKETYALDEPVSHWRSRLTLNVMVEDFVFDGSSLPADVHRYMKMIQLGKSVY-YLPIIFIDQLSNRVKDLMMINRSTTELPLTVSYDKISLGKLRFWIHMQ------DAVYSLQQFGFSEKDADEVKGLFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKNMVGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLIPAGIGAIIEVWKVKKALKISFRWN----GLMPEI---------KVNVFLFHVFAMKYLSYLLYPLCIGGAVYSLLNIRYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLIYLYQRWLYPVDKSRVNEYGESYE 521          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Xenopus
Match: cdhr1 (cadherin related family member 1 [Source:Xenbase;Acc:XB-GENE-478982])

HSP 1 Score: 293.123 bits (749), Expect = 4.759e-87
Identity = 174/507 (34.32%), Postives = 275/507 (54.24%), Query Frame = 1
Query: 1669 LYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHL--PPVTHWHPNMTIHMLDDHTSWTPGSVPPPLN---EMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            L VYT+   T +   NN  L  ++ N +          D  FE   N+   +  +NNG+ Y ++++  +G  P  D +  +    LT Y   M+ K          NL+TGET T  ++  +K  E++    PV+HW   +T++++ +   +   S+P  ++   +M++   S   Y P++F++   N  +D M++N + TELPL + +  ISL KL+ ++           ++       S+++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++++ G+S ++V +  F +V++ L++LD  T+ +V +   +G +IE                                            A KYLS++L+PL +G A+YSLL + +  WYSW+++     +  FGF+ M PQLF+NYKMKSVAHLPW+  TYKA NTFIDD+FAF+I MPT +R+ C RDDV+F IYLYQRW+YP+D  R NEYG S E
Sbjct:   55 LSVYTTTRTTISA-ENNVDLVLNVDNFDV---------DSKFERTVNVTVPKKTRNNGTLYAYVFLHHAGVLPWHDGKQVHILSPLTTY---MIPK------PEEVNLITGETGT-QQIDTDKKKETYALDEPVSHWRSRLTLNVMVEDFVFDGSSLPADVHRYMKMIQLGKSVY-YLPIIFIDQLSNRVKDLMMINRSTTELPLTVSYDKISLGKLRFWIHMQ------DAVYSLQQFGFSEKDADEVKGLFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKKNMVGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLIPAGIGAIIE--------------------------------------------AMKYLSYLLYPLCIGGAVYSLLNIRYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLIYLYQRWLYPVDKSRVNEYGESYE 490          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Mouse
Match: Clptm1 (cleft lip and palate associated transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:1927155])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 317/558 (56.81%), Postives = 424/558 (75.99%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMI 3174
            W ++KG +FR+ +I+ ISS FRR P   +P     P  A  +A  NL+ K T  +L+VY S+   F DF+   +LFW   ++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+T+PYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + GIFP  TF  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E +
Sbjct:   53 WQVIKGVLFRIFIIWAISSWFRRGP---SPQDQSGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPW--NFLGDELYEQSDEEQDSVKVALLETSPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPCPTFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGEDV 605          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Mouse
Match: Clptm1l (CLPTM1-like [Source:MGI Symbol;Acc:MGI:2442892])

HSP 1 Score: 345.51 bits (885), Expect = 7.027e-106
Identity = 185/467 (39.61%), Postives = 284/467 (60.81%), Query Frame = 1
Query: 1783 DGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHL-PPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEF--YSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            D  FE   N++  +  +NNG+ Y +I++  +G  P  D +  +    LT Y   M+ K          NLLTGE+ T  +++A K   + L  PV+HW P +T++++ D   +   S+P  ++  ++      T  Y P++F++   N  +D MV+N + TELPL + +  ISL +L+ ++           ++       S+++ D LK   +DTN YLL +T  V+  H +F+FLAFK+DI FW+ ++S+ G+S ++V +  F +V++ L++LD  T+ +V +   +G  IE+WK+KK + ITV       G+ P   F   S  +E  T+KYD  A KYLS++L+PL VG A+YSLL +++  WYSW+++     +  FGF+ M PQLF+NYKMKSVAHLPW+  TYKA NTFIDD+FAF+I MPT +R+ C RDDV+F +YLYQRW+YP+D  R NE+G S E
Sbjct:   83 DSKFERTVNVSVPKKTRNNGTLYAYIFLHHAGILPWQDGKQVHVVSTLTTY---MIPK------PEEINLLTGESATQQQIEAEKKPSNALDEPVSHWRPRLTLNVMVDDFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKISLGRLRFWIHMQ------DAVYSLQQFGFSEKDADELKGIFVDTNLYLLALTFFVAAFHLLFDFLAFKSDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLIPAGVGAAIELWKVKKALKITVAWR----GLRPVFQFGTHSE-SERKTEKYDAQAMKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKSRVNEFGESYE 529          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Mouse
Match: Senp1 (SUMO1/sentrin specific peptidase 1 [Source:MGI Symbol;Acc:MGI:2445054])

HSP 1 Score: 186.037 bits (471), Expect = 8.782e-49
Identity = 90/226 (39.82%), Postives = 139/226 (61.50%), Query Frame = 1
Query:  754 LPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTF--KQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
             P+IT+EM   +     N N+D V+ E F L+IT  D+ +L    WL D IINFY+ ++  R+     +PSV    TFF+ KL+++GY  VKRWTKK  VF   ++L+PIHLG HWCL  +D   + + YYDS+ G N E   ++ ++L ++S DK +K+   + W    K+  + P Q NG DCG+F  + A+ +++   ++F Q  M YFR++M +EIL+++LL
Sbjct:  416 FPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKG-FPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRRKSITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL 640          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Mouse
Match: Senp1 (SUMO1/sentrin specific peptidase 1 [Source:MGI Symbol;Acc:MGI:2445054])

HSP 1 Score: 186.037 bits (471), Expect = 1.266e-48
Identity = 90/226 (39.82%), Postives = 139/226 (61.50%), Query Frame = 1
Query:  754 LPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTF--KQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
             P+IT+EM   +     N N+D V+ E F L+IT  D+ +L    WL D IINFY+ ++  R+     +PSV    TFF+ KL+++GY  VKRWTKK  VF   ++L+PIHLG HWCL  +D   + + YYDS+ G N E   ++ ++L ++S DK +K+   + W    K+  + P Q NG DCG+F  + A+ +++   ++F Q  M YFR++M +EIL+++LL
Sbjct:  442 FPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKG-FPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRRKSITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL 666          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Mouse
Match: Senp2 (SUMO/sentrin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1923076])

HSP 1 Score: 169.474 bits (428), Expect = 1.630e-43
Identity = 85/224 (37.95%), Postives = 137/224 (61.16%), Query Frame = 1
Query:  760 KITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQI--YDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            + T++M   ++ ++ +   D ++   F L IT  D+ +L+   WL D +INFY+ L+  R+     YP++   +TFFYPKL+S GY  VKRWTK   +F+ +LVL+PIH   HW LV +D+  + + Y DS+  +     E++ ++L ++SK K    +++ EWT   +  ++ P Q NG DCG+F  + A+Y+SR   + F Q QM  FR+KM +EIL++QLL
Sbjct:  366 EFTEDMEKEISNALGHGPPDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERSKKQG-YPALHAFSTFFYPKLKSGGYQAVKRWTKGVNLFEQELVLVPIHRKVHWSLVVMDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNTDLNLLEWTHYSMKPHEIPQQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL 588          
BLAST of Cleft lip and palate transmembrane protein 1 vs. UniProt/SwissProt
Match: sp|Q6DEL2|CLPT1_DANRE (Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio OX=7955 GN=clptm1 PE=2 SV=1)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 327/556 (58.81%), Postives = 424/556 (76.26%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  +   NL+ K T  DLYVY S    F DF+N   LFW+ +++ YG+WT G + DG +E +  ++ SE++K NGS Y+HIY   SG  PDP+ K   ++L T++  +M+ K+K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +N+T+  LPL L + P+SL++ QLY AQS RS W     GE   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  I GI PR+ F  KS+Y ES TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   51 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRVPSRNLFPKDTLMDLYVYISQSEIFTDFNNTEELFWYQQDLVYGEWTTGDSGDGCYEYYKELDLSESVKQNGSIYMHIYFTKSGFHPDPKRKGQYRRLSTVHATRMLNKYKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQHVKFDAVSGDYYPIVYFNDYWNLQKDYYPINDTLLNLPLRLTYCPLSLWRWQLYAAQSARSPW--NFLGEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDFWKITKVMDVRLDRENRIAGIVPRLVFKDKSTYVESSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 599          
BLAST of Cleft lip and palate transmembrane protein 1 vs. UniProt/SwissProt
Match: sp|O96005|CLPT1_HUMAN (Cleft lip and palate transmembrane protein 1 OS=Homo sapiens OX=9606 GN=CLPTM1 PE=1 SV=1)

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 318/556 (57.19%), Postives = 425/556 (76.44%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            W ++KG +FR+ +I+ ISS FRR P  +   G   P  A  +A  NL+ K T  +L+VY S+   F DF+   +LFW   ++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+TNPYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + GIFPR++F  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E
Sbjct:   53 WQVIKGVLFRIFIIWAISSWFRRGPAPQDQAG---PGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPW--NFLGDELYEQSDEEQDSVKVALLETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGE 603          
BLAST of Cleft lip and palate transmembrane protein 1 vs. UniProt/SwissProt
Match: sp|Q2NL17|CLPT1_BOVIN (Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus OX=9913 GN=CLPTM1 PE=2 SV=1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 317/556 (57.01%), Postives = 424/556 (76.26%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            W ++KG +FR+ +I+ ISS FRR P  +   G   P  A  +A  NL+ K T  +L+VY S+   F DF+   +LFW  +++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+TNPYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + G+ PR TF  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E
Sbjct:   53 WQVIKGVLFRIFIIWAISSWFRRGPAPQDQAG---PGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQQDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSAKSPW--NFLGDELYEQSDEEQDSVKVALLETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHKVAGLLPRPTFQDKSTYVESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGE 603          
BLAST of Cleft lip and palate transmembrane protein 1 vs. UniProt/SwissProt
Match: sp|Q8VBZ3|CLPT1_MOUSE (Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus OX=10090 GN=Clptm1 PE=1 SV=1)

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 317/558 (56.81%), Postives = 424/558 (75.99%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKL-TIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMI 3174
            W ++KG +FR+ +I+ ISS FRR P   +P     P  A  +A  NL+ K T  +L+VY S+   F DF+   +LFW   ++ YGDWT+G N DG +E F  ++  ++++ NGS Y+H+Y   SG  PDP+ K   ++L T++ ++M+ K+K+R+ ++T NLLTGET+   E+         +  ++HWHPN+TI+++DDHT W  GSVPPPL++ V+F + + +YYP+++ NDYWNL +DY  +NE++  LPL + F P+SL++ QLY AQS +S W     G+ + ++SDEEQD++K  +L+T+PYLL +T+IVSIVHSVFEFLAFKNDIQFW +R+SLEGLSVRSVFF VFQS +V+LY+LDN+TNF+V+VSV +G+LI++WKI KV+++ ++RE  + GIFP  TF  KS+Y ES TK YD +AF+YLSWILFPLL  YA+YSLLYLEH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G+S E +
Sbjct:   53 WQVIKGVLFRIFIIWAISSWFRRGP---SPQDQSGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPW--NFLGDELYEQSDEEQDSVKVALLETSPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQVSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPCPTFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGEDV 605          
BLAST of Cleft lip and palate transmembrane protein 1 vs. UniProt/SwissProt
Match: sp|Q54RJ1|CNRB_DICDI (CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum OX=44689 GN=cnrB PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 2.664e-108
Identity = 214/528 (40.53%), Postives = 316/528 (59.85%), Query Frame = 1
Query: 1615 PIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAG---PNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYD-KKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYY-PVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQ--DTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIE 3177
            P  ++   N + +G  F++ VY S   T N+   +  L W    + Y DW      P  + +F+T      +  L+NNGS + HI      +   P+S+ +    L +Y  K   K K     ++ +    E D P EL            +++W P +++H++ DHT + P S+P    E+V +++ T+ +Y P+++ N++W   +    VNETV +L + + +S + LFK QL + Q  +S      FG             D  K+ + D +P++LG+T+IVS++H++FEFLAFKNDIQFW+N +S+EGLSV+++  N     I+ LY+LDN+T++M+  S   G L+E WK+ K + I +     +  +  RI F +K  Y  S TK+YD +A KYLSW+LFPL++G +IYSL Y EH  WYSWV+S     +  F FIMMTPQLFINYK+KSV+HLPWR   Y+ALNTFIDD+FAF+IKMP L+R+ CLRDD+IF +YLYQRWIYP+D KR + YG S+E  E
Sbjct:   76 PSNSVRLANSWPEGIEFNMKVYLS---TSNETVGDW-LVWEQDKLSY-DWKDSNTIPTKNITFDT------TPYLQNNGSLFAHIITSRRAYLNQPKSQLHKVHPLIVYLPKPKPKGKNLLEEKSKDEPEVEYD-PTEL------------ISYWKPTLSLHLIVDHTIYPPDSIP---KEIVSYFNITNGFYSPIIYCNEFWLYREHLKPVNETVKQLSIEINYSSMGLFKWQLQI-QMQKSLDMQESFGGGGNSAMGGASVGDEFKRMLTDNDPWILGLTLIVSVLHTIFEFLAFKNDIQFWKNNKSMEGLSVKTITLNCVCMGIIFLYLLDNETSYMILASSGFGFLVEFWKLGKAMTIKITWMTSL-PLPKRIEFINKDEYM-SKTKQYDDMAMKYLSWLLFPLVIGTSIYSLYYHEHKSWYSWVVSSLVRTVYTFEFIMMTPQLFINYKLKSVSHLPWRVFMYRALNTFIDDLFAFIIKMPLLHRLSCLRDDIIFIVYLYQRWIYPVDKKR-SHYG-SEEAEE 571          
BLAST of Cleft lip and palate transmembrane protein 1 vs. TrEMBL
Match: A0A1I8FTN5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 354/568 (62.32%), Postives = 446/568 (78.52%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRR--QPVTETPNGVRSPIAALAGI-----NLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAE 3192
            W+M+KGFI RM++IYFISSLFRR  QP T  P    +P +A +G      N++ K +  DL+++ ++   F  F+    LFWH   + YGDW +G N DG +   G I   E +  NGS Y+H ++V  G+SPDP S+ +DK+ T++  +M+TK+K+R++  T NL+TG T+ P + +      +HLPP THWHPN+TI ++DDHT WTPGS+PPPL+E V+F+  T+EYYP+++ NDYWNL  DYM VN+T   L L + F P+SLF+ QLY AQSMR+KWYG   GE   QESDEEQDTLK+T+++TNPYLL +TV+VS+VHSVFEFLAFKNDIQFWR+R+SLEGLSVRSVFF+VFQSV+V+LYV+DN+TNF+V+VSV +GLLIE+WKIKKV++I V+    + G+ PR+    KS+YTES TKKYDQ+AF+YLSW+LFPLL  YA+YSLLY EH  WYSWVLSM YGFLL FGFIMMTPQLFINYKMKSVAHLPWR LTYKALNTFIDDIFAFVI+MPTLYRIGCLRDDVIFFIYLYQR+IYP+DPKR NEYGVSQEM+++ E +
Sbjct:   35 WAMVKGFIVRMLIIYFISSLFRRGQQPQT-APGDPSAPASAGSGFRVPCQNIFPKNSKLDLWIFVNEQQNFTRFNEASDLFWHQPGLVYGDWESGENRDGVYYKHGKIKVPETVMKNGSLYIHTFVVRPGNSPDPSSRYHDKRYTMHSGRMLTKYKRRRVSNTQNLITGSTEGPLDKEGLAGGTTHLPPSTHWHPNLTISLIDDHTPWTPGSLPPPLDEYVQFHPPTNEYYPILYYNDYWNLNSDYMPVNDTTPLLNLTVTFQPLSLFRWQLYAAQSMRNKWYGAFLGEDTFQESDEEQDTLKRTLVETNPYLLALTVVVSLVHSVFEFLAFKNDIQFWRSRQSLEGLSVRSVFFSVFQSVVVLLYVMDNETNFVVRVSVFVGLLIELWKIKKVVDIQVDWTAKLLGLIPRVHIREKSTYTESPTKKYDQMAFRYLSWLLFPLLGMYAVYSLLYQEHKSWYSWVLSMLYGFLLTFGFIMMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDIFAFVIRMPTLYRIGCLRDDVIFFIYLYQRYIYPMDPKRVNEYGVSQEMLQQPEQD 601          
BLAST of Cleft lip and palate transmembrane protein 1 vs. TrEMBL
Match: A0A1I8H285 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 352/568 (61.97%), Postives = 445/568 (78.35%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRR--QPVTETPNGVRSPIAALAGI-----NLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAE 3192
            W+M+KGFI RM++IYFISSLFRR  QP T  P    +P +A +       N++ K +  DL+++ ++   F  F+    LFWH   + YGDW +G N DG +   G I   E +  NGS Y+H ++V  G+SPDP S+ +DK+ T++  +M+TK+K+R++  T NL+TG T+ P + +      +HLPP THWHPN+TI ++DDHT WTPGS+PPPL+E V+F+  T+EYYP+++ NDYWNL  DYM VN+T   L L + F P+SLF+ QLY AQSMR+KWYG   GE   QESDEEQDTLK+T+++TNPYLL +TV+VS+VHSVFEFLAFKNDIQFWR+R+SLEGLSVRSVFF+VFQSV+V+LYV+DN+TNF+V+VSV +GLLIE+WKIKKV+++ V+    + G+ PR+    KS+YTES TKKYDQ+AF+YLSW+LFPLL  YA+YSLLY EH  WYSWVLSM YGFLL FGFIMMTPQLFINYKMKSVAHLPWR LTYKALNTFIDDIFAFVI+MPTLYRIGCLRDDVIFFIYLYQR+IYP+DPKR NEYGVSQEM+++ E +
Sbjct:   40 WAMVKGFIVRMLIIYFISSLFRRGQQPQT-APGDPSAPASAGSSFRVPCQNIFPKNSKLDLWIFVNEQQNFTRFNEASDLFWHQPGLVYGDWESGENRDGVYYKHGKIKVPETIMKNGSLYIHTFVVRPGNSPDPSSRYHDKRYTMHSGRMLTKYKRRRVSNTQNLITGSTEGPLDKEGLAGGTTHLPPSTHWHPNLTISLVDDHTPWTPGSLPPPLDEYVQFHPPTNEYYPILYYNDYWNLNSDYMPVNDTTPLLNLTVTFQPLSLFRWQLYAAQSMRNKWYGAFLGEDTFQESDEEQDTLKRTLVETNPYLLALTVVVSLVHSVFEFLAFKNDIQFWRSRQSLEGLSVRSVFFSVFQSVVVLLYVMDNETNFVVRVSVFVGLLIELWKIKKVVDVQVDWTAKLLGLIPRVHMREKSTYTESQTKKYDQMAFRYLSWLLFPLLGMYAVYSLLYQEHKSWYSWVLSMLYGFLLTFGFIMMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDIFAFVIRMPTLYRIGCLRDDVIFFIYLYQRYIYPMDPKRVNEYGVSQEMLQQPEQD 606          
BLAST of Cleft lip and palate transmembrane protein 1 vs. TrEMBL
Match: V4AF27 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_233250 PE=4 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 362/612 (59.15%), Postives = 454/612 (74.18%), Query Frame = 1
Query: 1507 FWSMMKGFIFRMMVIYFISSLFRRQPVTETPN----GVRSPIAALAG-----INLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKN-YDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEKSVXXXXXXXXXXXXXXXXIPNGQASIECAPETPSATECD 3312
            FWS +K    RM+ IY ISS FRR P   TPN    G  +P+  L G      NL+ KGT  DLYVY S+   F DF N  +LFW  KN+ YGDWT G N DG+FE  G I  S+ L+NNGS YLH Y V  G SPDP +K  Y K+ T+Y++K + K KKR    + NLLTGETD   +L   ++M S    ++HWHPN+T+++LDDH+ W  GSVPPPL+E ++F    + YYPV++ NDYWNL +DY  +N+T+  L   L +SPISLFK Q+Y AQ MR+KWY  M G+ MM+ESD++QD+LK   ++TNPYLLGMT++VSI+HS+FEFLAFKNDIQFW++R+SLEGLSVRSVFFNVFQS+IV+LYV+DN+TN +V++S+ +GL IEIWKI KV+++  +RE+ +FGIFPRI+ + KSSYT+S+TK+YD LAFKYLSW+L+PL++GYAIYSLLY EH GWYSWVL M YGFLL FGFIMMTPQLFINYK+KSVAHLPWR LTYKALNTFIDDIFAFVIKMPTLYR+GCLRDDVIFFIYLYQRWIY +DP R NE+GVSQEM+E+    K V        + +  ++ I  G   +   P+T    + D
Sbjct:   50 FWSTIKTLFVRMLFIYLISSFFRRSPTNPTPNTTQDGSPAPVNKLNGPSGPATNLFSKGTIMDLYVYISEQEDFTDFDNEQALFWTKKNLIYGDWTDGENGDGTFEHSGKIPASQKLQNNGSLYLHAYFVSEGRSPDPSNKGKYSKRKTVYRSKQLNKFKKRTFHSSVNLLTGETDVHPDLIKKENMSS-FEILSHWHPNLTLNLLDDHSPWMRGSVPPPLDEYIDFVPGLNHYYPVIYFNDYWNLQRDYTPINDTLKVLNFTLTYSPISLFKWQMYAAQGMRNKWYSFMGGD-MMEESDQDQDSLKTAFIETNPYLLGMTIVVSILHSIFEFLAFKNDIQFWKSRKSLEGLSVRSVFFNVFQSLIVLLYVMDNETNTVVRISIFIGLGIEIWKIHKVMDVKFDRERRVFGIFPRISITDKSSYTQSNTKQYDMLAFKYLSWLLYPLIIGYAIYSLLYQEHKGWYSWVLGMMYGFLLTFGFIMMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDIFAFVIKMPTLYRLGCLRDDVIFFIYLYQRWIYRVDPTRVNEFGVSQEMLEQNGDAKPV--------EGEEDTQAIEGGDGDLSSQPKTEQDKKED 651          
BLAST of Cleft lip and palate transmembrane protein 1 vs. TrEMBL
Match: A0A095AR11 (Cleft lip and palate transmembrane protein 1 OS=Schistosoma haematobium OX=6185 GN=MS3_05064 PE=4 SV=1)

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 353/567 (62.26%), Postives = 443/567 (78.13%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSE--NLKNNGSFYLHIYIVPSGHSPDPQS-KNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMES---HLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMM---QESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKY 3183
            W M+K F FR++  YF+ +LFRR     +PN +      +   NLYQ G+  DL+VY S+  TF+ F+N+ +LFW+  NI YGDW  GP  DGS+     I  S+  NL +NGS Y+H+Y V  G SPDP +  NY  K T+YK+KM+T++K+R+L RTTNL+TG TD+  +L A+ S  S   +LPP+THWHPN+TI+++DDH+ W  GSVP PL++ +EFYS T+EYYPVV+LNDYWNL +DY  VNET   LP+++  +P+SLFK QLY AQ+ +  W+  +   SM+    E+DEEQDT+KK +++TNP LL +TV+VSIVHSVFE LAFKNDIQFW+ RESLEGLSVRSVFFNVFQS IVVLYVLDNDTNF++K+SVV GLLIEIWKIKKV++  ++ +  +F +FPR+   ++SSY ESDTKKYDQ+AF+YLSWILFPLL  Y  YSL+Y EH GWYSW+LS+SYGFLL FGFIMMTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVI+MPTLYRIGCLRDDVIFFIYLYQRWIYP+DP R NE+GVS+EM++ +
Sbjct:   30 WGMLKAFAFRLLTAYFVLNLFRR----PSPNQMDPSKTVIPATNLYQSGSMMDLFVYLSEDPTFHSFNNSNALFWYEPNITYGDWNGGPGGDGSYSKISEIQCSQFPNLMSNGSLYIHVYFVKPGFSPDPNTGNNYSLKYTVYKSKMLTRYKRRRLSRTTNLITGHTDSHPDLVADSSTPSDVQYLPPITHWHPNLTINLVDDHSPWVKGSVPVPLDQFIEFYSPTNEYYPVVYLNDYWNLNEDYKPVNETTPILPIHITLAPLSLFKWQLYAAQTAKKTWFNQLMATSMLPSENENDEEQDTIKKALIETNPLLLAVTVVVSIVHSVFELLAFKNDIQFWKTRESLEGLSVRSVFFNVFQSFIVVLYVLDNDTNFVIKLSVVFGLLIEIWKIKKVLSFRLDYDSLVFNVFPRVHVDYQSSYVESDTKKYDQMAFRYLSWILFPLLAAYCGYSLIYEEHRGWYSWILSVSYGFLLTFGFIMMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIRMPTLYRIGCLRDDVIFFIYLYQRWIYPMDPNRINEFGVSKEMLDAH 592          
BLAST of Cleft lip and palate transmembrane protein 1 vs. TrEMBL
Match: A0A3Q0KUL3 (Cleft lip and palate associated transmembrane protein-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 363/615 (59.02%), Postives = 459/615 (74.63%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSE--NLKNNGSFYLHIYIVPSGHSPDPQS-KNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMES---HLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMM---QESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIE---KYEAEKSVXXXXXXXXXXXXXXXXIPNGQASIECAPETPSATECDES 3318
            W M+K F FR++  YF+ +LFRR     +PN +      +   NLYQ G+  DL+VY S+  TF+ F+N+ +LFW+  NI YGDW  GP+ DGS+     I+ S+  NL  NGS Y+H+Y V  G SPDP +  NY  K T+YK+KM+T++K+R+L RTTNL+TG TD+  +L A  S  S   +LPP THWHPN+TI+++DDH+ W  GSVP PL++ +EFYS T+EYYPVV+LNDYWNL +DY  VNET   LP+++  +P+SLFK QLY AQ+ +  W+  +   SM+    E+DEEQDT+KK +++TNP LL +TV+VSIVHSVFE LAFKNDIQFW+ RESLEGLSVRSVFFNVFQS IVVLYVLDNDTNF++K+SVV GLLIEIWKIKKV++   N +  IF +FPRI   ++SSY ESDTKKYDQ+AF+YLSWILFPLL  Y  YSL+Y EH GWYSW+LS+SYGFLL FGFIMMTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVI+MPTLYRIGCLRDDVIFFIYLYQRWIYP+DP R NE+GVS+EM++   K E ++S                  PN + +   +  +P++++ D++
Sbjct:   31 WGMLKAFAFRLLTAYFVLNLFRR----PSPNQMDPSKTVIPATNLYQSGSLMDLFVYLSEDPTFHSFNNSNALFWYEPNITYGDWNGGPDGDGSYSKISEIHCSQFPNLMFNGSLYIHVYFVKPGFSPDPNTGNNYSLKYTVYKSKMLTRYKRRRLSRTTNLITGHTDSHPDLVAGSSTPSDVQYLPPTTHWHPNLTINLVDDHSPWVKGSVPVPLDQFIEFYSPTNEYYPVVYLNDYWNLNEDYKPVNETTPILPIHITLAPLSLFKWQLYAAQTAKKTWFNQLMATSMLPSENENDEEQDTIKKALIETNPLLLAVTVVVSIVHSVFELLAFKNDIQFWKTRESLEGLSVRSVFFNVFQSFIVVLYVLDNDTNFVIKLSVVFGLLIEIWKIKKVLSFRFNYDSLIFNVFPRIHVDYQSSYVESDTKKYDQMAFRYLSWILFPLLAAYCGYSLIYEEHRGWYSWILSVSYGFLLTFGFIMMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIRMPTLYRIGCLRDDVIFFIYLYQRWIYPMDPNRINEFGVSKEMLDAHNKCEPKQS-----------------DPNSETTPALSLPSPTSSDPDQT 624          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Cavefish
Match: clptm1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:NCBI gene;Acc:103021918])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 326/556 (58.63%), Postives = 424/556 (76.26%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKN-YDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  +   NL+ K T  DLYVY S+   F+DF+N  +LFW  +++ YGDWT G   DG +E +  ++  E+++ NGS Y+H+Y   SG  PDP+ K  Y +  T++  +M+ K K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +N+T+ +LPL L F P+SL++ QLY AQ+ RS W     GE   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  I GIFPR+ F  KS+Y ES TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   53 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRVPSRNLFPKDTLMDLYVYISENEVFSDFNNTEALFWFQRDLVYGDWTTGEGGDGCYEHYQELDTPESVQQNGSLYIHVYFTKSGFHPDPKRKGQYRRLATVHTTRMMNKFKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQHVKFDAVSGDYYPIVYFNDYWNLQKDYYPINDTLKKLPLRLTFCPLSLWRWQLYAAQNARSPW--NFLGEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDFWKITKVMDVKLDRENKIAGIFPRLVFKDKSTYVESSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 601          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Cavefish
Match: clptm1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:NCBI gene;Acc:103021918])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 326/556 (58.63%), Postives = 424/556 (76.26%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKN-YDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  +   NL+ K T  DLYVY S+   F+DF+N  +LFW  +++ YGDWT G   DG +E +  ++  E+++ NGS Y+H+Y   SG  PDP+ K  Y +  T++  +M+ K K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +N+T+ +LPL L F P+SL++ QLY AQ+ RS W     GE   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI+ WKI KV+++ ++RE  I GIFPR+ F  KS+Y ES TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVLSM YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   92 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRVPSRNLFPKDTLMDLYVYISENEVFSDFNNTEALFWFQRDLVYGDWTTGEGGDGCYEHYQELDTPESVQQNGSLYIHVYFTKSGFHPDPKRKGQYRRLATVHTTRMMNKFKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQHVKFDAVSGDYYPIVYFNDYWNLQKDYYPINDTLKKLPLRLTFCPLSLWRWQLYAAQNARSPW--NFLGEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDFWKITKVMDVKLDRENKIAGIFPRLVFKDKSTYVESSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 640          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Cavefish
Match: clptm1l (CLPTM1 like [Source:NCBI gene;Acc:103041925])

HSP 1 Score: 328.176 bits (840), Expect = 1.120e-99
Identity = 171/472 (36.23%), Postives = 282/472 (59.75%), Query Frame = 1
Query: 1792 FETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSE--YYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEK 3195
            FE   N++  +  + NG+ Y  +++  +G SP  DP+  +   +LT Y   M+ K  +  L    +    +         +  ++    PV+HW   +T++++ ++  +   ++P  ++  ++ Y S  +  Y P++F++   N  +D M +N + TE+PL + +  I+L KL+ ++           ++       ++++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++S+ G+S ++V +  F ++++ LY+LD  T+ +V +   +G LIE+WK+KK   I V  +    G+ P   F  KS  +E  T++YD LA KYLS++L+PL VG AIY+L+++++  WYSW+++     +  FGF+ M PQLF+NYK+KSVAHLPW+   YKA NTFIDD+FAF+I MPT +R+ C RDD +F IYLYQRW+YP+D  R NEYGVS +   K +A K
Sbjct:   85 FERLVNVSLPKKTRKNGTLYAMVFVHQAGMSPWQDPRQVHMVTQLTAY---MLPKPPEVSLITGEDEAQQQKQEQKSTPGDDLLDR---PVSHWRSRLTLNIVAENFLFDREALPSDVHRYMKVYQSGRKMVYLPLLFIDQLSNRVKDLMEINSSTTEMPLTISYDTIALGKLRFWIHMQ------DAVYSLQQFGFTEKDADEIKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKQKKSMVGMSSKAVLWRCFSTIVIFLYLLDEQTSLLVLIPAGIGSLIEVWKVKKAFKIYVIWK----GVKPAFMFG-KSDESERRTEEYDSLAMKYLSYLLYPLCVGGAIYALVFVKYKSWYSWLINSLVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFMYKAFNTFIDDVFAFIITMPTSHRLACFRDDAVFLIYLYQRWLYPVDKTRVNEYGVSYDEDLKGKAHK 539          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Cavefish
Match: clptm1l (CLPTM1 like [Source:NCBI gene;Acc:103041925])

HSP 1 Score: 317.39 bits (812), Expect = 7.850e-96
Identity = 172/473 (36.36%), Postives = 281/473 (59.41%), Query Frame = 1
Query: 1792 FETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLP-PVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSE--YYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEK 3195
            FE   N++  +  + NG+ Y  +++  +G SP  DP+  +   +LT Y   M+ K          +L+TGE +   + + +   +  L  PV+HW   +T++++ ++  +   ++P  ++  ++ Y S  +  Y P++F++   N  +D M +N + TE+PL + +  I+L KL+ ++           ++       ++++ D +K   +DTN Y L +T  V+  H +F+FLAFKNDI FW+ ++S+ G+S ++V +  F ++++ LY+LD  T+ +V +   +G LIE+WK+KK   I V  +    G+ P   F  KS  +E  T++YD LA KYLS++L+PL VG AIY+L+++++           Y  +  FGF+ M PQLF+NYK+KSVAHLPW+   YKA NTFIDD+FAF+I MPT +R+ C RDD +F IYLYQRW+YP+D  R NEYGVS +   K +A K
Sbjct:   85 FERLVNVSLPKKTRKNGTLYAMVFVHQAGMSPWQDPRQVHMVTQLTAY---MLPK------PPEVSLITGEDEAQKQEQKSTPGDDLLDRPVSHWRSRLTLNIVAENFLFDREALPSDVHRYMKVYQSGRKMVYLPLLFIDQLSNRVKDLMEINSSTTEMPLTISYDTIALGKLRFWIHMQ------DAVYSLQQFGFTEKDADEIKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKQKKSMVGMSSKAVLWRCFSTIVIFLYLLDEQTSLLVLIPAGIGSLIEVWKVKKAFKIYVIWK----GVKPAFMFG-KSDESERRTEEYDSLAMKYLSYLLYPLCVGGAIYALVFVKYK---------RYSGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFMYKAFNTFIDDVFAFIITMPTSHRLACFRDDAVFLIYLYQRWLYPVDKTRVNEYGVSYDEDLKGKAHK 528          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000000218.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:9157486:9166419:1 gene:ENSAMXG00000000211.2 transcript:ENSAMXT00000000218.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 1.979e-62
Identity = 137/471 (29.09%), Postives = 244/471 (51.80%), Query Frame = 1
Query: 1807 NINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSE-----YYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISL--FKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVN-REQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEK 3195
            +++  E    NGS +  +++  SG SP   S++          ++V +            LT E   P+     ++ +  L  VT+W   ++++M+ +  ++   +VP  L   ++      +     Y P++ +++  +  +D + +N T   +P  + +  I+L  F++ ++V   + S  + G         S++  D +K   ++T  ++L + ++V   H  FE  AFKND+ FWR ++SL    V +V +  F +V++ L++L+  T+++  + + +  LIE+WK+ +V  I    +   IF I   + F             +   A K+LS++L+PL +  AIYS LYL++  WY W+++     +  FGF+ M PQL++NYK+KS AH P   L YK LNTFI D+F+ +I  P  +++ C RDDV+F IYLYQR IYP++  R  EYG S     K +A +
Sbjct:  102 SVSLPELTHKNGSLHAVVFVHKSGVSPWKDSRHV---------RLVAR------------LTAEMLPPSSAATPRTEDQRL--VTYWKSRISLNMMTEDFTFNNAAVPSDLRRYIKIVEDGKKEKKKIYLPLLLVDEMRSRIKDLIEINSTTKAVPFTISYDTITLRKFRIWIHVQAVIYSLKHFGF--------SEQNLDEIKAMFVETGLHILALYILVPAFHLSFEVFAFKNDVSFWRGKKSL---FVSAVIWRCFSTVVIFLHLLEEQTSWLTLIPMGIAALIELWKVSRVFAIQPRFKVNTIFSINITVFF-------------FLSQAMKFLSYLLYPLCISGAIYSFLYLKNKSWYFWIINGLVSGVYAFGFLSMVPQLYVNYKLKSAAHFPMSVLLYKGLNTFISDVFSGIISTPGPHQLACFRDDVVFLIYLYQRRIYPLNKSRCREYGASHRKRCKGKAHE 525          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003093.1 (pep scaffold:Pmarinus_7.0:GL476956:247988:252088:1 gene:ENSPMAG00000002830.1 transcript:ENSPMAT00000003093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 1.221e-51
Identity = 89/226 (39.38%), Postives = 135/226 (59.73%), Query Frame = 1
Query:  754 LPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIY--DGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
             P +T+EM   ++ +    + D V+ E F LSIT  D+ +LQ   WL D +INFY+ LI  R     +  +V    TFFYP+++S+G+ GVKRWTK+  VF   L L+PIHL  HWCL +I+   + + YYDS+   N E   ++ ++L E+SKDK  +   I+ W    +   + P Q NG DCG+F  + A+Y++R   + F Q  M YFR +M +EI++++LL
Sbjct:    2 FPPLTEEMEEEIDRAFGYGSTDEVLSEAFRLSITRKDIKTLQHLNWLNDEVINFYMSLIMERGKGEGK-ATVHAFNTFFYPRVKSAGFQGVKRWTKRVDVFQFDLALVPIHLDVHWCLAAINFKKKTLTYYDSMGNSNNEVCNILMQYLREESKDKKGQPFDITGWKTYSMKPNEIPQQMNGSDCGMFACKYADYITREKPITFTQQHMPYFRRRMVWEIIHQKLL 226          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007736.1 (pep scaffold:Pmarinus_7.0:GL489727:268:6778:-1 gene:ENSPMAG00000006988.1 transcript:ENSPMAT00000007736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 1.939e-45
Identity = 76/179 (42.46%), Postives = 114/179 (63.69%), Query Frame = 1
Query: 2464 VFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYK 3000
            +F+FLAFKNDI FW+++  + G+S R V +  F +V++ L+++D  T+ +V +   +G  IE+WK+ K   + +       G  P++     SS +E  T ++D  A +YLS+ L+PL  G A+YSLLY+ H  WYSWV++     +  FGF+ M PQLF+NYK+KSVAHLPWR   YK
Sbjct:    2 LFDFLAFKNDISFWQSKRDMVGMSARVVLWRCFSTVVIFLFLMDERTSMLVLLPAGIGTFIEVWKVTKAFKLKLTWR----GWLPKVEVG-PSSASERKTDEFDSQAMRYLSYALYPLCAGGALYSLLYVSHKSWYSWVINSLVNGIYAFGFLFMLPQLFVNYKLKSVAHLPWRAFMYK 175          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Yeast
Match: ULP1 (Protease that specifically cleaves Smt3p protein conjugates; required for cell cycle progression; associates with nucleoporins and may interact with septin rings during telophase; sequestered to the nucleolus under stress conditions [Source:SGD;Acc:S000005941])

HSP 1 Score: 100.138 bits (248), Expect = 5.853e-22
Identity = 67/230 (29.13%), Postives = 114/230 (49.57%), Query Frame = 1
Query:  754 LPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQL--VLIPIHLG-NHWCLVSIDMCNQEVHYYDSLK-GRNP---ECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQL 1422
            +P++ ++  + V  ++ +R    ++  + N+ ITV D  +L PR+WL D II F+++ I          P+     +FFY  L   GY GV+RW K++     +L  +  PI+L  +HW L  ID+  + + Y DSL  G N      L  ++++++E+SK  + +   +         D P Q NGYDCG+++     Y S  + LDF+       R  ++  IL   L
Sbjct:  404 VPELNEKDDDQVQKALASRENTQLMNRD-NIEITVRDFKTLAPRRWLNDTIIEFFMKYI------EKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIH------LDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDAL 620          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Yeast
Match: ULP2 (Peptidase that deconjugates Smt3/SUMO-1 peptides from proteins; plays a role in chromosome cohesion at centromeric regions and recovery from checkpoint arrest induced by DNA damage or DNA replication defects; potential Cdc28p substrate; human homolog PML implicated in promyelocytic leukemia can partially complement yeast null mutant [Source:SGD;Acc:S000001293])

HSP 1 Score: 58.151 bits (139), Expect = 8.547e-9
Identity = 49/188 (26.06%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  847 SITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNN---QYPSVQILTTFFYPKLRSSG---YSGVKRWTKKRPVFDSQLVLIPIHLGNHW--CLVS--------------IDMCNQE----------VHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFL 1314
            +IT  D   L  + W+ D+I++F+ +  Y  ++      +   V ++++FFY KL S+    YS VK+W     +F  + V+IPI++  HW  C+++               D  N +          +  +DSL+  +   ++ +KEFL+  + DK   Q+  ++   K     P Q N  DCGV +
Sbjct:  443 TITNQDFKCLFNKDWVNDSILDFFTKF-YIESSIEKSIIKREQVHLMSSFFYTKLISNPADYYSNVKKWVNNTDLFSKKYVVIPINISYHWFSCIITNLDAILDFHQNKDKNDAINSDEISINNPLVNILTFDSLRQTHSREIDPIKEFLISYALDKYSIQLDKTQIKMKTC-PVPQQPNMSDCGVHV 628          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Nematostella
Match: EDO35670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKS8])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 320/564 (56.74%), Postives = 425/564 (75.35%), Query Frame = 1
Query: 1522 KGFIFRMMVIYFISSLFR---RQPVTETPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQ------------LAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQE 3168
            KG +FR+ + +F+++LFR   +QP +++P+G    ++     NL+      +LYVY S++  F +F + GSL WH K++++G+WT GP  DG F     +  SENL NNGS Y H+YI   G +P+P S  +DK+  +Y++KM+T +KKR++ +T NLL G T+ P E +  K  +     + +WHPN+TI+M+DD T WTPGSVPPP++E +EF + TS+YYP+++LN YWNL  +YM +NET   L L+L +SPISLFK Q+Y +Q MR KW+  + G+ M Q+S+EEQD +K+T+++TNPYLLG+T+IV++VH+VFEFLAFKNDIQFWR+R++LEGLSVRSVFFNVFQ+ +V+LYV DNDTN ++ +S  +GLLIE+WKI KV+NI ++RE  I G+FPRI+F  K SY ES T+ YDQ            +AFKYLSW LFPLLV Y IYSL Y+EH GWYSWVLSM YGFLL FGFI MTPQLFINYK+KSVAHLPWR +TYKALNTFIDD+FAFVIKMP +YRIGC RDD++FFIYLYQRWIY +D KR NE+G++ E
Sbjct:   40 KGILFRIFIFWFVTNLFRGKQQQPSSDSPSG----MSLKPATNLFNTNQKMELYVYLSELSNFQNFEDKGSLIWHQKDLQFGNWTDGPAKDGVFMFSTQLKTSENLMNNGSLYAHVYITKIGKNPNPASPKFDKRAVVYRSKMLTVYKKRRVSKTVNLLYGSTEAPPEQQI-KDPKKEQEIINYWHPNLTINMMDDQTPWTPGSVPPPMDEFIEFDNVTSKYYPLLYLNTYWNLGSEYMPINETTPTLDLHLTYSPISLFKWQMYESQRMRQKWFS-VLGDDM-QQSEEEQDAMKRTIVETNPYLLGVTMIVTLVHTVFEFLAFKNDIQFWRSRKTLEGLSVRSVFFNVFQATVVLLYVADNDTNTVIIISCFVGLLIELWKINKVVNIKLDRENRILGMFPRISFEDKESYVESSTRVYDQASYKLTHFSPLQMAFKYLSWALFPLLVCYCIYSLFYVEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMMTYKALNTFIDDLFAFVIKMPMMYRIGCFRDDIVFFIYLYQRWIYKVDHKRVNEFGLTGE 596          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Nematostella
Match: EDO33037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STD2])

HSP 1 Score: 322.013 bits (824), Expect = 7.772e-98
Identity = 174/463 (37.58%), Postives = 271/463 (58.53%), Query Frame = 1
Query: 1789 SFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEF---YSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVA--QSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            SF    N +     +NNGS Y+ +Y+ P G +P     NY   +T Y +  +T +   K      L  G+   P        ++  LP V+HW P +  H++ +  ++   ++P  +  ++ +        +Y P+V++++   + +    +N+T  ++PLNL +SPISL KL+++ A  QSM      GM     +   D++ D ++    DTN YLLG+T ++SI H +F+FLAFKND+ FW+N +S+ GLS R+V +    S+I+ LY++D   + +V     +G +IE+WK+ K + +T+       G  P + F  +S+  E  T ++D  A  YL ++++PL+V  A+YSLLY     WYSW ++     + + GF+ M PQLF+NY++KSVAHLPWR   YKA NTFIDD+FAF+I MPT +R+ C RDD IF IYLYQRW+YP+D  R NE+GVS
Sbjct:   84 SFTEILNASIPRRTRNNGSLYVTVYVYPVGQTP--FRNNY---MTSYASSALTTYAVPKDEVVNLLSGGKKSQP--------IKDDLP-VSHWRPTLNFHVMSEKVAFNRYAIPGEIFSLLRYSRMMGKNEQYLPIVYIDELQVVYRHIQPLNKTSHQMPLNLKYSPISLGKLRIWSAVHQSM------GMMKN--LGFKDKDLDEIRGLFTDTNLYLLGLTFLISIFHLLFDFLAFKNDVNFWQNADSMVGLSSRTVIWRCVCSIIIFLYLMDEKASLLVLFPQGIGSIIEMWKLTKALKVTIIWR----GAKPTLKFGERST-QEKQTDEFDGEALYYLKYVMYPLVVASAVYSLLYHPQKSWYSWTINSLVNGIYVLGFLFMMPQLFVNYRLKSVAHLPWRAFMYKAFNTFIDDVFAFIITMPTAHRLACFRDDFIFVIYLYQRWLYPVDMARVNEFGVS 519          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Nematostella
Match: EDO48885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHN4])

HSP 1 Score: 200.675 bits (509), Expect = 1.031e-58
Identity = 98/217 (45.16%), Postives = 134/217 (61.75%), Query Frame = 1
Query:  775 MRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            M   +N ++   N    + E FNL+IT  DL +L    WL D +INFY  +I  R+  +  +P V    +FFYPKL  +G++ +KRWT+K  +F   L+L+PIHLG HWCL +ID   + V YYDSLKG N +CL+ ++++L ++S DK K     + WT     D P Q NG DCGVF    AEYLSR +K  FNQ +M Y R KM +EIL+K+LL
Sbjct:    1 MEQKINAALAPGNPGDNLTEGFNLTITRGDLATLSNLNWLNDEVINFYFNMIAARSKEDPVFPKVHFFNSFFYPKLIKTGHASLKRWTRKVDIFTVDLILVPIHLGMHWCLAAIDFRKKTVLYYDSLKGTNIQCLDALQKYLKDESLDKKKVPFDTTGWTAACPKDIPEQLNGCDCGVFTCTYAEYLSRDAKFTFNQLRMPYIRRKMVYEILSKKLL 217          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Nematostella
Match: EDO26327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCA7])

HSP 1 Score: 139.813 bits (351), Expect = 2.370e-37
Identity = 72/147 (48.98%), Postives = 102/147 (69.39%), Query Frame = 1
Query: 1807 NINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETV 2247
            N N   NL NNGS Y H+YI   G +P+P S  +DK+  +Y++KM+T +KKR++ +T NLL G T  P E +  K  +     + +WHPN+TI+M+DD T WTPGSVPPP++E +EF + TS+YYP+++LN YWNL  +YM +NET 
Sbjct:   81 NTNQKMNLMNNGSLYAHVYITKIGKNPNPASPKFDKRAVVYRSKMLTVYKKRRVSKTVNLLYGSTKAPPEQQI-KDPKKEQEIINYWHPNLTINMMDDQTPWTPGSVPPPMDEFIEFDNVTSKYYPLLYLNTYWNLGSEYMPINETT 226          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Nematostella
Match: EDO38314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD74])

HSP 1 Score: 54.6842 bits (130), Expect = 1.005e-8
Identity = 33/113 (29.20%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  832 EEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKL--RSSG----------YSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQE 1134
            ++  ++IT  +L  LQ  ++L D II+FYL+ I+    ++       I ++FFY +L  R+S           +S VK WTK   +F    +++PI+  +HW L  +    Q+
Sbjct:   22 QQGGINITTANLDCLQEGEFLNDVIIDFYLKYIFHEKLTDFDRERTHIFSSFFYKRLTQRASSETNLSVIERMHSQVKTWTKYVDIFQKDFIVVPINESSHWYLAIVCFPGQD 134          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Medaka
Match: clptm1 (CLPTM1 regulator of GABA type A receptor forward trafficking [Source:NCBI gene;Acc:101157473])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 322/556 (57.91%), Postives = 423/556 (76.08%), Query Frame = 1
Query: 1510 WSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAA--LAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKN-YDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPP--VTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVS 3162
            W ++KG +FR+ +I+ ISS FRR P T  PN   +P  A  L   NL+ K T  DLYV+ S    F+DF+N  +LFW  +++ YGDW+ G + DG ++ +  ++  E L++NGS Y+H+Y   SG  PDP+ K  Y +  T++  KM+ K K+RK  +T NLLTGET+   E+   K  ESH P   ++HWHPN+TI+M+DDHT+W  GSVPPPL++ V+F + + +YYP+V+ NDYWNL +DY  +NET+T+LPL L + P+SL++ QLY AQ+ RS W      E   ++SDE+QD++K  +L+TNPYLLG+T++VSIVHS+FEFLAFKNDIQFW +R+SLEGLSVRS+ F VFQS++V+LY+LDN+TNF+V+VSV +GLLI++WKI KV+++ ++RE  I G+ PR+ F  KS+Y +S TK YD +AFKYLSW+L+PL   YA+YSLLY+EH GWYSWVL M YGFLL FGFI MTPQLFINYKMKSVAHLPWR LTYKALNTFIDD+FAFVIKMP +YRIGCLRDDV+FFIYLYQRWIY +DP R NE+G S
Sbjct:   54 WQVIKGVLFRIFIIWAISSWFRRGPSTPDPN---TPAGAPRLPSRNLFPKDTLMDLYVFISQEEVFSDFNNTDALFWFHRDLVYGDWSTGEDGDGCYQQYKELDIPEKLQHNGSLYMHVYFTKSGFHPDPKRKGQYRRLATVHSTKMLNKFKRRKFLKTKNLLTGETEADPEMI--KRAESHGPVEIISHWHPNLTINMVDDHTAWVKGSVPPPLDQYVKFDAVSGDYYPIVYFNDYWNLQKDYYPINETLTKLPLRLNYCPLSLWRWQLYAAQNARSPW--NFLPEDTYEQSDEDQDSVKVALLETNPYLLGLTIVVSIVHSIFEFLAFKNDIQFWNSRQSLEGLSVRSIIFGVFQSLVVLLYILDNETNFVVQVSVFIGLLIDLWKITKVMDVRLDRENKIAGVIPRLVFKDKSTYVQSSTKIYDDMAFKYLSWLLYPLFGCYAVYSLLYVEHKGWYSWVLGMLYGFLLTFGFITMTPQLFINYKMKSVAHLPWRMLTYKALNTFIDDLFAFVIKMPMMYRIGCLRDDVVFFIYLYQRWIYRVDPNRVNEFGTS 602          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Medaka
Match: si:dkey-21c19.3 (sentrin-specific protease 1 [Source:NCBI gene;Acc:100820721])

HSP 1 Score: 186.037 bits (471), Expect = 2.108e-48
Identity = 93/232 (40.09%), Postives = 141/232 (60.78%), Query Frame = 1
Query:  736 LSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTF--KQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            L +K   P++T+ M   V+ ++   N   ++ E F LS+T  DL +L    WL D +INFY+ L+  R+  +   PSV    TFFYPKL S+GY  V+RWTKK  +F   ++L+PIHLG HWCL  +D   + + Y+DS+ G+N +  + +  +L  +SKDK  K+++ S WT   K+  + P Q NG DCG+F  + A+Y+++   + F Q  M YFR +M +EILN +LL
Sbjct:  479 LKEKPEFPELTESMEAEVSRALKGGNPHEILSEGFGLSLTRKDLQTLSNLNWLNDEVINFYMNLLVERSK-DPSLPSVNTFNTFFYPKLCSNGYYAVRRWTKKMDIFAKDILLVPIHLGMHWCLSVVDFRKKSITYFDSMGGKNEKACQALFNYLQLESKDKKGKELATSGWTLHSKESKEIPQQMNGSDCGMFTCKYADYVTKDKPITFTQKHMPYFRRRMVWEILNHKLL 709          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Medaka
Match: ENSORLT00000017171.2 (sentrin-specific protease 2 [Source:NCBI gene;Acc:101165680])

HSP 1 Score: 157.147 bits (396), Expect = 1.549e-39
Identity = 86/230 (37.39%), Postives = 133/230 (57.83%), Query Frame = 1
Query:  754 LPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSG----VKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQI--YDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            LP++T EM   V+ ++   + + V+   F L IT  DL +LQ   WL D +INFYL LI  R++       V   +TFF+PKLR  G +G    VKRWTK   +F   L+L+P+HLG HW +  ID  ++ V  YDS+  R+ +   L+  ++ E+ K K  K++  ++WT   +   + P Q NG DCGVF+ + A+++++     F Q  M  FR+ M +EIL+++LL
Sbjct:  377 LPRLTREMAAEVSGALTQSDPNRVLSSAFKLRITQRDLATLQEGGWLNDEVINFYLSLIMERSSGEPSRLKVYSFSTFFFPKLRGGGQAGGHAAVKRWTKTVDLFLFDLILVPLHLGVHWAMAVIDFRSKTVKSYDSMGQRHDDICSLLLHYIKEEHKAKKGKELDSAKWTIGSLKACEIPQQKNGSDCGVFVCKYADFIAKEKSFTFKQCHMPLFRKLMIWEILHQKLL 606          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Medaka
Match: CLPTM1L (CLPTM1 like [Source:NCBI gene;Acc:101155458])

HSP 1 Score: 149.828 bits (377), Expect = 6.605e-38
Identity = 116/457 (25.38%), Postives = 213/457 (46.61%), Query Frame = 1
Query: 1786 GSFETFGNINPSENLKNNGSFYLHIYIVPSGHSP--DPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSE--YYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSI--VHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLP--------WRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQR 3114
             +FE   N++  E  + NG+ Y  +Y+   G SP  D +  +Y  +LT Y N                    + D  +  K        + PV+HW P ++I M+ +  S++   +P  +   +  +    +  Y P++ +N+  +  +D   +  +  +LPL + +  ISL K + ++        +  ++       S+E  D +K+T++ +N YLL +T +V+   V  + EFLA KNDI  WR ++S+ G+S +SV +    ++++ L++L+ +T+ +V + V LG  +E+                           H S               +YLS++++PL +  A++SL+YL    +YSW+++     +  FGF+ M PQLFIN+K++              W+ +TY     F     A        +++ C RD+V+FF+YLYQR
Sbjct:   94 STFERQVNVSLPEETRANGTLYAVVYLHKVGVSPLEDRKEVHYAAQLTTYMNP-----------------ANKEDQKDPQKVGS-----VRPVSHWTPLLSITMMSEDFSFSKAGLPSDVRRYMRVFQEGRQMIYLPLLLVNELSSRVKDLKEIGSSSVQLPLTISYEGISLRKFRFWI------HLHDIVYSLRQFGFSEENIDEIKETLVGSNLYLLVLTALVTALQVGLICEFLALKNDICSWREKKSMAGISRKSVLWRCLCTLLIFLHLLE-ETSLLVLLPVGLGACVEV--------------------------VHAS---------------RYLSYLVYPLCISGAVFSLVYLRKRNYYSWLINSLVTGVYAFGFLSMAPQLFINHKVRPTRRQNKVLTSGKIWKCITYACSFAFFFSSTASFSSS---HQLSCFRDEVLFFLYLYQR 477          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Medaka
Match: senp3b (sentrin-specific protease 5 [Source:NCBI gene;Acc:101163035])

HSP 1 Score: 114.39 bits (285), Expect = 9.215e-26
Identity = 66/192 (34.38%), Postives = 105/192 (54.69%), Query Frame = 1
Query:  850 ITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            +T+ DL +L  + WL D ++N Y +L+      ++    V    +FFY KLR+ GY GVKRWTK   +F   L+LIPIHL  HW LVS+D+ ++ + Y+DS +  N  C + + ++L  ++  K  +Q  +S W      +   Q+N  DCG F+ Q  + L+      F Q  MQ  R +M  E+ + +L+
Sbjct:  396 LTMDDLGTLYGQNWLNDQVMNMYGDLVM-----DSVPDKVHFFNSFFYDKLRTKGYEGVKRWTKNVDIFQKDLLLIPIHLEVHWSLVSVDIQHRAITYFDSQRTLNRRCPKHIFKYLQAEAVKK-NQQDFLSGWKGFFKMNVGRQNNDSDCGAFVLQYCKCLALGQPFSFGQQDMQRLRRQMYKELCHCKLI 581          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Planmine SMEST
Match: SMESG000033674.1 (SMESG000033674.1)

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 628/637 (98.59%), Postives = 632/637 (99.22%), Query Frame = 1
Query: 1423 LSSMSSEVANPIXXXXXXXXXXXXXXXXFWSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHXXXXXXXXXXXXXGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEKSVXXXXXXXXXXXXX-XXXIPNGQASIECAPETPSATECDESKKTK 3330
            +SSMSSEVANPIENQPAEQNNANQPRNNFWSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQ+KNYDKKLTIYKNKMVTKHKKRKLRRTTNLLTGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEKSVNN  NN E+DD+  SEDIPNGQASIECAPETPSATECDESKKTK
Sbjct:    3 ISSMSSEVANPIENQPAEQNNANQPRNNFWSMMKGFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAGINLYQKGTWFDLYVYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSENLKNNGSFYLHIYIVPSGHSPDPQNKNYDKKLTIYKNKMVTKHKKRKLRRTTNLLTGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMIEKYEAEKSVNNNINNNEEDDDNGSEDIPNGQASIECAPETPSATECDESKKTK 639          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Planmine SMEST
Match: SMESG000033662.1 (SMESG000033662.1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 258/258 (100.00%), Postives = 258/258 (100.00%), Query Frame = 1
Query:  652 KKYDGSYIEDITDYFRELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            KKYDGSYIEDITDYFRELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL
Sbjct:  193 KKYDGSYIEDITDYFRELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 450          

HSP 2 Score: 318.161 bits (814), Expect = 0.000e+0
Identity = 191/193 (98.96%), Postives = 191/193 (98.96%), Query Frame = 2
Query:   77 MLAMFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKTKLKLNNENQNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNCQITQYVHNDCKSPNNKISRIDSVDFXXXXXXXXXXXXXXXXXDFQSNPELTALTVKSKSHLLSSNFISNLTKPSIHSDSXXXXXXXXXIESSVNNEEIK 655
            MLAMFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKT LKLNNENQNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNC ITQYVHNDCKSPNNKISRIDSVDFKSNESKYINNNNNKKISDFQSNPELTALTVKSKSHLLSSNFISNLTKPSIHSDSRQRRLQRLQIESSVNNEEIK
Sbjct:    1 MLAMFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKTNLKLNNENQNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNCHITQYVHNDCKSPNNKISRIDSVDFKSNESKYINNNNNKKISDFQSNPELTALTVKSKSHLLSSNFISNLTKPSIHSDSRQRRLQRLQIESSVNNEEIK 193          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Planmine SMEST
Match: SMESG000033662.1 (SMESG000033662.1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 258/258 (100.00%), Postives = 258/258 (100.00%), Query Frame = 1
Query:  652 KKYDGSYIEDITDYFRELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 1425
            KKYDGSYIEDITDYFRELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL
Sbjct:  190 KKYDGSYIEDITDYFRELCYIPPLVFPRLSKKVVLPKITDEMRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKLKKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQMQYFREKMSFEILNKQLL 447          

HSP 2 Score: 311.612 bits (797), Expect = 0.000e+0
Identity = 188/190 (98.95%), Postives = 188/190 (98.95%), Query Frame = 2
Query:   86 MFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKTKLKLNNENQNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNCQITQYVHNDCKSPNNKISRIDSVDFXXXXXXXXXXXXXXXXXDFQSNPELTALTVKSKSHLLSSNFISNLTKPSIHSDSXXXXXXXXXIESSVNNEEIK 655
            MFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKT LKLNNENQNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNC ITQYVHNDCKSPNNKISRIDSVDFKSNESKYINNNNNKKISDFQSNPELTALTVKSKSHLLSSNFISNLTKPSIHSDSRQRRLQRLQIESSVNNEEIK
Sbjct:    1 MFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKTNLKLNNENQNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNCHITQYVHNDCKSPNNKISRIDSVDFKSNESKYINNNNNKKISDFQSNPELTALTVKSKSHLLSSNFISNLTKPSIHSDSRQRRLQRLQIESSVNNEEIK 190          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Planmine SMEST
Match: SMESG000063457.1 (SMESG000063457.1)

HSP 1 Score: 256.914 bits (655), Expect = 2.992e-74
Identity = 140/389 (35.99%), Postives = 223/389 (57.33%), Query Frame = 1
Query: 2011 NELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGSVPPPLNEMVEFYSSTSE---YYPVVFLNDYWNLAQDYMV----VNETVTELPLNLVFSPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPYLLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVIVVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRITFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYSWVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDDIFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYG 3156
            NE  ++++      P  H +  + +  L +   +    VP  ++++++          Y P+++ N +  L+QD +V     N  V  + + L+   +S+ KL+L+      ++        + +  +++  D+++    +TN YLL +T  V+ +H +F+ L+FKNDI FWRN  +  GLS R+V +    SVI+  Y+++ DT+ +V +   +  LIE WK+ ++  +T+      F I  R          E  T  +D    +YL W++ PL +G AIYSLLY  H  WYSW ++     + +FGF+ MTPQLFINYK+KSVAHLPW+ LTYKA NTFIDD FAF+I MPT +R+ C RDD++F +Y+YQRW+YP+D  R NE+G
Sbjct:  138 NEDNSSRAKFQDGRPEMHLYKKIVMTTLTELAVFDYHQVPQEISQLLKVTRGGDGKLVYQPIIYFNAFL-LSQDDLVRVSGTNLDVINITVELM--SVSVGKLRLWRLIEHATQ------DLNKLGFNEKNVDSVRGLFTNTNFYLLVVTFSVAALHLLFDVLSFKNDISFWRNARTTCGLSGRTVMWRCVSSVIIFFYLMEEDTSLLVLIPFGVSTLIEFWKLARIFKVTIGLSG--FRINAR-------DQGELATDTFDSEGMRYLMWLVIPLCIGGAIYSLLYQPHKSWYSWTVTTLANGVYVFGFLFMTPQLFINYKLKSVAHLPWKALTYKAFNTFIDDFFAFIITMPTSHRLACFRDDIVFVVYIYQRWLYPVDKSRVNEFG 508          
BLAST of Cleft lip and palate transmembrane protein 1 vs. Planmine SMEST
Match: SMESG000052086.1 (SMESG000052086.1)

HSP 1 Score: 65.855 bits (159), Expect = 1.698e-10
Identity = 37/95 (38.95%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  859 TDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKL-RSSG--------YSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSI 1116
            +DL  L   ++L DNIINFYL  I F   +  Q     +   FFY KL R +G        ++ V +WTKK  +FD   ++IPI+  NHW L  I
Sbjct:  655 SDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAII 749          
The following BLAST results are available for this feature:
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLPTM10.000e+057.19CLPTM1 regulator of GABA type A receptor forward t... [more]
CLPTM10.000e+057.19CLPTM1 regulator of GABA type A receptor forward t... [more]
CLPTM10.000e+059.16CLPTM1 regulator of GABA type A receptor forward t... [more]
CLPTM1L1.879e-10338.89CLPTM1 like [Source:HGNC Symbol;Acc:HGNC:24308][more]
CLPTM1L1.879e-10338.89CLPTM1 like [Source:HGNC Symbol;Acc:HGNC:24308][more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
C36B7.60.000e+053.32pep chromosome:WBcel235:X:7097434:7100338:-1 gene:... [more]
R166.20.000e+051.79pep chromosome:WBcel235:II:10534332:10537671:-1 ge... [more]
T13H5.82.430e-7440.43pep chromosome:WBcel235:II:8518510:8520700:1 gene:... [more]
ulp-14.259e-5139.31Sentrin-specific protease [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG37020.000e+053.43gene:FBgn0031590 transcript:FBtr0334790[more]
CG37020.000e+053.43gene:FBgn0031590 transcript:FBtr0077477[more]
CG43321.538e-8433.55gene:FBgn0030456 transcript:FBtr0073726[more]
CG321103.308e-4040.10gene:FBgn0052110 transcript:FBtr0075931[more]
Ulp14.610e-3733.86gene:FBgn0027603 transcript:FBtr0074693[more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clptm10.000e+058.81CLPTM1 regulator of GABA type A receptor forward t... [more]
clptm10.000e+058.81CLPTM1 regulator of GABA type A receptor forward t... [more]
clptm10.000e+058.81CLPTM1 regulator of GABA type A receptor forward t... [more]
clptm1l9.016e-10137.45CLPTM1 like [Source:NCBI gene;Acc:436653][more]
si:dkey-21c19.32.474e-5241.78si:dkey-21c19.3 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pglyrp1-like.10.000e+051.72pglyrp1 protein [Source:Xenbase;Acc:XB-GENE-577893... [more]
pglyrp1-like.10.000e+056.49pglyrp1 protein [Source:Xenbase;Acc:XB-GENE-577893... [more]
cdhr17.082e-10237.08cadherin related family member 1 [Source:Xenbase;A... [more]
cdhr16.338e-9635.90cadherin related family member 1 [Source:Xenbase;A... [more]
cdhr14.759e-8734.32cadherin related family member 1 [Source:Xenbase;A... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clptm10.000e+056.81cleft lip and palate associated transmembrane prot... [more]
Clptm1l7.027e-10639.61CLPTM1-like [Source:MGI Symbol;Acc:MGI:2442892][more]
Senp18.782e-4939.82SUMO1/sentrin specific peptidase 1 [Source:MGI Sym... [more]
Senp11.266e-4839.82SUMO1/sentrin specific peptidase 1 [Source:MGI Sym... [more]
Senp21.630e-4337.95SUMO/sentrin specific peptidase 2 [Source:MGI Symb... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DEL2|CLPT1_DANRE0.000e+058.81Cleft lip and palate transmembrane protein 1 homol... [more]
sp|O96005|CLPT1_HUMAN0.000e+057.19Cleft lip and palate transmembrane protein 1 OS=Ho... [more]
sp|Q2NL17|CLPT1_BOVIN0.000e+057.01Cleft lip and palate transmembrane protein 1 homol... [more]
sp|Q8VBZ3|CLPT1_MOUSE0.000e+056.81Cleft lip and palate transmembrane protein 1 homol... [more]
sp|Q54RJ1|CNRB_DICDI2.664e-10840.53CLPTM1-like membrane protein cnrB OS=Dictyostelium... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FTN50.000e+062.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2850.000e+061.97Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V4AF270.000e+059.15Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A095AR110.000e+062.26Cleft lip and palate transmembrane protein 1 OS=Sc... [more]
A0A3Q0KUL30.000e+059.02Cleft lip and palate associated transmembrane prot... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clptm10.000e+058.63CLPTM1 regulator of GABA type A receptor forward t... [more]
clptm10.000e+058.63CLPTM1 regulator of GABA type A receptor forward t... [more]
clptm1l1.120e-9936.23CLPTM1 like [Source:NCBI gene;Acc:103041925][more]
clptm1l7.850e-9636.36CLPTM1 like [Source:NCBI gene;Acc:103041925][more]
ENSAMXT00000000218.21.979e-6229.09pep primary_assembly:Astyanax_mexicanus-2.0:10:915... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003093.11.221e-5139.38pep scaffold:Pmarinus_7.0:GL476956:247988:252088:1... [more]
ENSPMAT00000007736.11.939e-4542.46pep scaffold:Pmarinus_7.0:GL489727:268:6778:-1 gen... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ULP15.853e-2229.13Protease that specifically cleaves Smt3p protein c... [more]
ULP28.547e-926.06Peptidase that deconjugates Smt3/SUMO-1 peptides f... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356700.000e+056.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330377.772e-9837.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488851.031e-5845.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263272.370e-3748.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383141.005e-829.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clptm10.000e+057.91CLPTM1 regulator of GABA type A receptor forward t... [more]
si:dkey-21c19.32.108e-4840.09sentrin-specific protease 1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000017171.21.549e-3937.39sentrin-specific protease 2 [Source:NCBI gene;Acc:... [more]
CLPTM1L6.605e-3825.38CLPTM1 like [Source:NCBI gene;Acc:101155458][more]
senp3b9.215e-2634.38sentrin-specific protease 5 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Cleft lip and palate transmembrane protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033674.10.000e+098.59SMESG000033674.1[more]
SMESG000033662.10.000e+0100.00SMESG000033662.1[more]
SMESG000033662.10.000e+0100.00SMESG000033662.1[more]
SMESG000063457.12.992e-7435.99SMESG000063457.1[more]
SMESG000052086.11.698e-1038.95SMESG000052086.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033688 ID=SMED30033688|Name=Cleft lip and palate transmembrane protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3617bp
CCCTGATTTGTTTGAATTCTTCTTTATTTTTGTGTAATTTTAAAAATCTT
GCAAATTTTAATTTTTCATCTTTTCAATGTTAGCAATGTTTGATCGTATT
AAATCTATATTTTTCCCTGTTAATTCTCATAAAAGAAAATCCACAGATCC
ACTTGACACATTAAATGAAAATAATTCTTTTTATGAAAATTCTTCAAAAA
CAAAATTAAAACTGAATAATGAAAATCAAAATCACACTAGAGAATTAACA
GTTTATGACAGCATATTTAAACCTAATAATCGGTCTAGTACAGTTTTTAA
AGATAATTCATCAGTTGTTCTTAATTGCAATATCAAAAAAATCAGGGTAG
ATAATTGTCAAATTACTCAATATGTCCATAATGATTGCAAAAGTCCGAAT
AATAAAATAAGTCGTATAGATTCAGTCGATTTTAAGTCAAATGAATCGAA
ATATATAAATAACAATAATAATAAAAAAATTTCAGATTTCCAATCCAATC
CTGAATTAACAGCTCTCACTGTGAAATCCAAATCTCATTTATTAAGTTCT
AATTTCATTTCCAATTTGACAAAGCCGTCGATTCACAGTGACAGCAGACA
AAGGCGATTACAAAGATTACAAATAGAAAGTTCTGTAAACAATGAAGAAA
TAAAAAATACGATGGTAGTTACATTGAAGATATTACTGACTATTTTAGAG
AATTATGTTACATTCCTCCACTCGTTTTCCCTAGACTTTCAAAGAAAGTA
GTTCTTCCAAAGATAACGGATGAGATGAGGAACATGGTGAACTGCTCAAT
AGTGAACCGGAACCGAGATATGGTTGTTGTTGAGGAGTTCAATCTGTCCA
TCACTGTCACAGATTTGATATCTTTGCAACCGCGCCAGTGGCTGACGGAC
AATATAATAAATTTCTATTTGGAGTTGATTTATTTCCGCAATAACAGTAA
TAATCAATATCCGTCGGTGCAGATTCTTACCACATTCTTTTATCCTAAAC
TACGTAGTTCTGGATATTCAGGTGTTAAAAGGTGGACTAAGAAACGGCCG
GTGTTCGACAGCCAGTTGGTGTTGATTCCCATTCATTTGGGCAATCATTG
GTGCTTGGTGTCAATTGATATGTGCAATCAGGAGGTGCATTACTATGACT
CGTTGAAGGGTCGCAATCCCGAGTGCTTGGAATTGATGAAGGAGTTTCTA
GTTGAGGATTCTAAAGATAAATTAAAAAAACAGATCTCTATTTCCGAGTG
GACATTTAAACAGATTTATGATGGACCTACTCAACACAACGGTTACGACT
GTGGAGTATTTTTAAGTCAGACTGCAGAATATTTATCCAGAAGATCAAAA
TTAGATTTTAATCAAGATCAAATGCAATATTTTAGAGAAAAAATGAGTTT
TGAAATTTTAAATAAACAGTTGCTATCCAGTATGTCAAGTGAAGTTGCTA
ACCCGATAGAAAATCAACCAGCTGAACAAAATAATGCAAATCAGCCTAGG
AATAACTTCTGGTCAATGATGAAAGGATTTATTTTCAGAATGATGGTAAT
ATACTTCATAAGTAGTTTATTTCGAAGACAACCAGTTACTGAAACACCAA
ATGGAGTCAGATCACCAATAGCAGCACTAGCGGGAATAAACTTGTATCAG
AAAGGTACATGGTTCGACTTATATGTATATACATCAGATATGTACACGTT
TAATGATTTTTCAAATAATGGAAGTTTATTTTGGCATTTGAAAAATATTG
AATATGGAGATTGGACTGCTGGTCCTAACCACGATGGGAGTTTTGAAACG
TTTGGTAACATTAATCCGTCTGAAAACTTAAAAAATAACGGTTCATTTTA
TTTGCATATTTATATTGTACCAAGTGGACACAGTCCTGATCCACAAAGCA
AGAATTATGACAAGAAATTAACTATTTATAAAAATAAAATGGTTACAAAG
CATAAAAAGCGAAAATTGCGACGAACTACCAATTTATTAACAGGAGAAAC
TGATACTCCAAATGAACTTAAAGCCAATAAAAGCATGGAATCTCATTTAC
CACCTGTCACACATTGGCATCCAAATATGACCATTCATATGTTAGATGAC
CATACTTCTTGGACTCCGGGATCAGTTCCACCACCTTTAAATGAGATGGT
GGAATTTTATTCCAGTACCAGCGAATACTACCCGGTTGTTTTTTTGAATG
ATTATTGGAATTTGGCGCAGGATTACATGGTTGTCAACGAGACTGTGACA
GAGTTGCCATTGAATTTGGTGTTCTCGCCGATATCTCTGTTTAAATTGCA
GTTGTATGTCGCACAGTCGATGCGATCGAAATGGTACGGAGGCATGTTCG
GTGAGAGTATGATGCAGGAATCTGATGAGGAGCAGGACACTTTAAAAAAA
ACCATGCTTGATACGAATCCATATCTGCTAGGAATGACGGTGATTGTATC
AATCGTTCACAGTGTTTTTGAGTTCCTGGCATTTAAAAACGATATACAAT
TCTGGCGCAACAGAGAATCACTCGAAGGATTATCAGTTCGATCTGTATTT
TTCAACGTGTTTCAGTCTGTCATTGTCGTTCTGTATGTGCTTGACAACGA
TACAAATTTCATGGTGAAAGTTTCTGTCGTGCTCGGTTTATTGATTGAAA
TATGGAAAATCAAAAAGGTGATCAACATCACAGTCAATAGGGAGCAACCT
ATATTTGGTATTTTCCCGAGAATTACTTTTTCCCACAAATCGTCCTACAC
GGAATCAGATACCAAGAAATATGATCAGTTGGCATTTAAATATTTATCAT
GGATCTTGTTCCCATTATTGGTTGGATATGCAATATATTCTCTCCTTTAT
CTTGAGCATACCGGGTGGTATTCATGGGTATTGTCCATGTCATATGGATT
CTTGCTGATGTTTGGATTCATCATGATGACACCGCAGTTATTCATCAATT
ATAAAATGAAATCAGTCGCTCATCTTCCATGGAGAAAATTGACCTACAAA
GCATTGAATACTTTCATTGATGATATATTTGCATTTGTTATCAAAATGCC
AACCCTTTATAGGATCGGTTGTCTGAGAGACGATGTGATATTCTTTATCT
ACCTTTACCAGCGCTGGATCTATCCAATAGATCCTAAACGTCCAAATGAG
TACGGTGTTAGTCAGGAAATGATAGAAAAGTACGAAGCGGAGAAATCCGT
TAATAATATCAACAACAATGAGGAGGATGATGACAATGGTAGTGAGGATA
TTCCCAATGGTCAAGCCAGTATTGAATGTGCTCCTGAAACTCCTTCTGCC
ACTGAATGTGATGAATCCAAGAAAACAAAATAATTGATTATTTGTTTATA
ATTTAGTGCACTTGTTATTAAATATTTGTATTTTAAATTGACTTGATTTG
TTTTAACTGCTGTTTGTGTGTATATGCGTGTGTTGTTGATATTGTACGAG
ATATTGTGCTCGTTACTGGGATTTATTGAGCAAGGACGTTTTGGTCCATT
TCAGAAATCCGTAATAATAATCATATAGATTATAGTTTTTGGGTTTTTAT
TGAATATTGTATTAATATTTATTTTTAAAATAAATCCAGCGTTAGTTAAA
AAAAAAAGATCGGAAGA
back to top

protein sequence of SMED30033688-orf-1

>SMED30033688-orf-1 ID=SMED30033688-orf-1|Name=SMED30033688-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MLAMFDRIKSIFFPVNSHKRKSTDPLDTLNENNSFYENSSKTKLKLNNEN
QNHTRELTVYDSIFKPNNRSSTVFKDNSSVVLNCNIKKIRVDNCQITQYV
HNDCKSPNNKISRIDSVDFKSNESKYINNNNNKKISDFQSNPELTALTVK
SKSHLLSSNFISNLTKPSIHSDSRQRRLQRLQIESSVNNEEIKNTMVVTL
KILLTILENYVTFLHSFSLDFQRK*
back to top

protein sequence of SMED30033688-orf-2

>SMED30033688-orf-2 ID=SMED30033688-orf-2|Name=SMED30033688-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=853bp
MRNMVNCSIVNRNRDMVVVEEFNLSITVTDLISLQPRQWLTDNIINFYLE
LIYFRNNSNNQYPSVQILTTFFYPKLRSSGYSGVKRWTKKRPVFDSQLVL
IPIHLGNHWCLVSIDMCNQEVHYYDSLKGRNPECLELMKEFLVEDSKDKL
KKQISISEWTFKQIYDGPTQHNGYDCGVFLSQTAEYLSRRSKLDFNQDQM
QYFREKMSFEILNKQLLSSMSSEVANPIENQPAEQNNANQPRNNFWSMMK
GFIFRMMVIYFISSLFRRQPVTETPNGVRSPIAALAGINLYQKGTWFDLY
VYTSDMYTFNDFSNNGSLFWHLKNIEYGDWTAGPNHDGSFETFGNINPSE
NLKNNGSFYLHIYIVPSGHSPDPQSKNYDKKLTIYKNKMVTKHKKRKLRR
TTNLLTGETDTPNELKANKSMESHLPPVTHWHPNMTIHMLDDHTSWTPGS
VPPPLNEMVEFYSSTSEYYPVVFLNDYWNLAQDYMVVNETVTELPLNLVF
SPISLFKLQLYVAQSMRSKWYGGMFGESMMQESDEEQDTLKKTMLDTNPY
LLGMTVIVSIVHSVFEFLAFKNDIQFWRNRESLEGLSVRSVFFNVFQSVI
VVLYVLDNDTNFMVKVSVVLGLLIEIWKIKKVINITVNREQPIFGIFPRI
TFSHKSSYTESDTKKYDQLAFKYLSWILFPLLVGYAIYSLLYLEHTGWYS
WVLSMSYGFLLMFGFIMMTPQLFINYKMKSVAHLPWRKLTYKALNTFIDD
IFAFVIKMPTLYRIGCLRDDVIFFIYLYQRWIYPIDPKRPNEYGVSQEMI
EKYEAEKSVNNINNNEEDDDNGSEDIPNGQASIECAPETPSATECDESKK
TK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008429CLPTM1
IPR003653Peptidase_C48_C
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 36..56