TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30033686
Length (bp)1768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30033686) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30033686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30033686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30033686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30033686SMESG000027283.1 Contig1753GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30033686SMESG000027283.1 Contig1753GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033686SMESG000027283.1 dd_Smed_v4_6768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033686SMESG000027283.1 dd_Smed_v4_6768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30033686SMESG000027283.1 SMED30033686smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033686SMESG000027283.1 SMED30033686smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 89.7373 bits (221), Expect = 3.084e-18
Identity = 123/546 (22.53%), Postives = 236/546 (43.22%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDN--CEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNAD---QSDNTAQSKNTAQSENAAQSE---KKIFSNLREMLHEFQ-EKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSES-QN-VMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C  +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  +++ C +++  C     L  +  H+      KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +     +S+ T Q     ++ +A Q     K+  ++L + +   Q E  +K+  IQ +  ++ S ++E     K+M   NE K L+          I+   ++LK +  E    +  +++  +             MKS  ES QN V  L +V +++  +  + +G++E    + D++   +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIVKDK-VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHL------KNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIER-QKEMLRNNESKILH------LQRVIDSQAEKLKELDKEIRPFRQNWEEADS-------------MKSSVESLQNRVTELESV-DKSAGQVARNTGLLESQLSRHDQM-LSVHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 537          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 89.7373 bits (221), Expect = 3.084e-18
Identity = 123/546 (22.53%), Postives = 236/546 (43.22%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDN--CEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNAD---QSDNTAQSKNTAQSENAAQSE---KKIFSNLREMLHEFQ-EKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSES-QN-VMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C  +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  +++ C +++  C     L  +  H+      KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +     +S+ T Q     ++ +A Q     K+  ++L + +   Q E  +K+  IQ +  ++ S ++E     K+M   NE K L+          I+   ++LK +  E    +  +++  +             MKS  ES QN V  L +V +++  +  + +G++E    + D++   +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIVKDK-VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHL------KNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIER-QKEMLRNNESKILH------LQRVIDSQAEKLKELDKEIRPFRQNWEEADS-------------MKSSVESLQNRVTELESV-DKSAGQVARNTGLLESQLSRHDQM-LSVHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 537          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 89.7373 bits (221), Expect = 3.702e-18
Identity = 123/558 (22.04%), Postives = 238/558 (42.65%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDN--CEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQS-EKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKS----VTDENEILKNEFQDLKALGVIIKESILDIQMKSGSE-SQNVMNLRTVSEQTYDEQQKLSGIVEKLQ------EKIDKLSQDLHEMRENVDS---------TKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C  +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  +++ C +++  C     L  +  H+      KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +      +  S + ++  NA  +   K +  + +  ++  + ++ SS +Q +    N LK  S+S+ K +S L      NE+   +KS  I  +  ++ S    +  + E+L+N    +  L     + ++D Q +   E  + +   R    Q ++E   +   VE LQ      E +DK +  +      ++S         +  + ++  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIVKDK-VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHL------KNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHV----NLLKEWSNSLEKKVSLLQ-----NESVEKNKS--IQSLHNQICSFEIEIERQKEMLRNNESKILHL-----QRVIDSQAEKLKELDKEIRPFR----QNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 89.7373 bits (221), Expect = 3.702e-18
Identity = 123/558 (22.04%), Postives = 238/558 (42.65%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDN--CEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQS-EKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKS----VTDENEILKNEFQDLKALGVIIKESILDIQMKSGSE-SQNVMNLRTVSEQTYDEQQKLSGIVEKLQ------EKIDKLSQDLHEMRENVDS---------TKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C  +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  +++ C +++  C     L  +  H+      KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +      +  S + ++  NA  +   K +  + +  ++  + ++ SS +Q +    N LK  S+S+ K +S L      NE+   +KS  I  +  ++ S    +  + E+L+N    +  L     + ++D Q +   E  + +   R    Q ++E   +   VE LQ      E +DK +  +      ++S         +  + ++  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIVKDK-VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHL------KNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHV----NLLKEWSNSLEKKVSLLQ-----NESVEKNKS--IQSLHNQICSFEIEIERQKEMLRNNESKILHL-----QRVIDSQAEKLKELDKEIRPFR----QNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 87.8113 bits (216), Expect = 1.043e-17
Identity = 116/522 (22.22%), Postives = 219/522 (41.95%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSK-NADQSDNTAQS-KNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSES-QN-VMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C  +L  P    CG RFC SC+   L+ S+  C                        A + S VK K   DNC    E+ A++ +          C   S+GC    L+   +  HL  D  F         ++LP    +  +     D  D+  ++ K    + +  +S+  + +    +L    E  +K+  IQ +  ++ S ++E     K+M   NE K L+          I+   ++LK +  E    +  +++  +             MKS  ES QN V  L +V +++  +  + +G++E    + D++   +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKC-----------------------TACQESIVKDKVFKDNC-CKREILALQIY----------CRNESRGCAEQ-LMLGHLLVHLKNDCHF---------EELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQ--NESVEKNKSIQSLHNQICSFEIEIER-QKEMLRNNESKILH------LQRVIDSQAEKLKELDKEIRPFRQNWEEADS-------------MKSSVESLQNRVTELESV-DKSAGQVARNTGLLESQLSRHDQM-LSVHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 479          
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 49.6766 bits (117), Expect = 4.320e-6
Identity = 41/147 (27.89%), Postives = 66/147 (44.90%), Query Frame = 1
Query: 1231 WRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKM--CLRLW----KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATE------FASCSLKFSCYRTNEAW-KKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIK 1632
            W+ID   +  NEA    +  + S  F S   G KM  C  L+     A + +     L+ G +D  +EWP+   + ISL+DQ    E      +     K    + NE +  +P+ E+N   G +   F +     N +K+DKIY++
Sbjct:  267 WKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKL---KANEKFLARPRGERNAAFGSQ--SFCSLAILQNYVKDDKIYVQ 408          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 109.768 bits (273), Expect = 7.024e-25
Identity = 121/574 (21.08%), Postives = 238/574 (41.46%), Query Frame = 1
Query:   73 PEDIFMDLWRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLD---RDVVSDHPMAVRLSQVKVKCIHD--NCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFH--------IKLIV--------KIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQ------SEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKL----------SQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKS---GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            PE  F  L      ++ H +     +  C  C+ +L  P    CG RFC SCI + L++ N  CP       L P+  D   RDV  +      +  +KV C  +   C+    L  + +H+ IC   +  CPL   G  +  +++ +M +HL +             +K+ +         +    P    N     +  +S+ ++   +  +++          S K +   +RE    F  ++ +   ++    E     V+S         +  YK L     PS S  + ++ ++ + + ++N  L+ +   ++ L     E +L+++M    E + +  LR + E    E + L G VE ++  +  L          S  L  + + +   D       +++ E++ +    E +   G   W+I ++ +   EA+ S    + S  F++   G KMC R++   + +  G      F ++ G YD +++WP++ +V + L+DQ  A +    + K     ++ ++++P  E N   G  L   +T + N   IK+D I+IK  V+ 
Sbjct:   31 PEPGFSPLH---GGFRDHFVTTPEPKYCCETCRLVLCNPRQTECGHRFCESCINELLSKPNPVCPA-----DLLPLFEDKIFRDVCCNR----EIMALKVYCRSEKNGCKEQMCLQQVMEHLVICPYFEVPCPL---GKCKEKMMRKDMPEHLSRKCKHREVTCEFCSLKMALTELQKHKETVCPAFPVACPNHCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKS-------ELMERYKVL-----PSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEM----ELRELRPLRAMRE----EVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPD--PSSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 567          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 75.8702 bits (185), Expect = 9.719e-15
Identity = 52/194 (26.80%), Postives = 93/194 (47.94%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            Q+KI+ LS  + ++   V   D T  E + ++ E+      +   G F WRI +F+K   +AI      + S +F++   G KMCLR++          +L   F ++ G  D +++WP+  +V + L+DQ+N          F    T+ ++++P SE N   G  L           + I++D I+IK +V+
Sbjct:   91 QDKIEALSNKVRQLERQVGVKDLTVAEMEGRLREMS----ATTFDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSNREHIIDA---FRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVD 277          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 73.559 bits (179), Expect = 2.675e-13
Identity = 51/196 (26.02%), Postives = 94/196 (47.96%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENVDSTKKEFQIK-----IMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            QEKI+ LS  + ++   +  T ++ Q+      + E++F        G F W+I  FS+   +A+      + S +F+S   G KMCLRL+          +L   F ++ G YD +++WP+  +V + L+DQ N          F    ++ ++++P SE N   G  L          ++ +++D I+IK +V+
Sbjct:  342 QEKIENLSNKVRQLERTL--TTRDLQLAESEQSLRELQF----CTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 73.559 bits (179), Expect = 2.675e-13
Identity = 51/196 (26.02%), Postives = 94/196 (47.96%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENVDSTKKEFQIK-----IMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            QEKI+ LS  + ++   +  T ++ Q+      + E++F        G F W+I  FS+   +A+      + S +F+S   G KMCLRL+          +L   F ++ G YD +++WP+  +V + L+DQ N          F    ++ ++++P SE N   G  L          ++ +++D I+IK +V+
Sbjct:  342 QEKIENLSNKVRQLERTL--TTRDLQLAESEQSLRELQF----CTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 73.1738 bits (178), Expect = 3.870e-13
Identity = 51/196 (26.02%), Postives = 94/196 (47.96%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENVDSTKKEFQIK-----IMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            QEKI+ LS  + ++   +  T ++ Q+      + E++F        G F W+I  FS+   +A+      + S +F+S   G KMCLRL+          +L   F ++ G YD +++WP+  +V + L+DQ N          F    ++ ++++P SE N   G  L          ++ +++D I+IK +V+
Sbjct:  355 QEKIENLSNKVRQLERTL--TTRDLQLAESEQSLRELQF----CTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 541          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 80.4925 bits (197), Expect = 2.365e-15
Identity = 113/551 (20.51%), Postives = 224/551 (40.65%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPN-----------KSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIH--DNCEFDDELSA-------------IEDHIS-ICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLP--ATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVE----SHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + ++ KC  C+ +L  P    CG RFC +C+   L+ ++  C             K   C+ + + L     ++      L  +    IH   +C+F +ELS              + DHI   C   +  C    K C RN +   EM +H  +D+D        ++   P   ++K+  +S+  +Q     ++ +  Q  N  +           ML    E ++K+  IQ +  ++ S ++E       +  + + + + +++ E           +IR  L+   DE + +K+ ++ L+      + S L++  K+ +      N   +  Q     Q LS                +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  +      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQF-EELSCPRADCKEKVIRKDLSDHIEKTCKYRETPC----KFC-RNQVPLVEMQKH--EDVD-----CPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQ--NESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRN-LRQTGDEADGMKSNYESLQN-----RLSQLEVMAKNAAS----WNPGVLETQINRHDQMLS----------------VHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 530          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 76.2554 bits (186), Expect = 5.090e-14
Identity = 113/561 (20.14%), Postives = 219/561 (39.04%), Query Frame = 1
Query:  154 KCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPN-----------KSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIH--DNCEFDDELSA-------------IEDHI--------SICNKSKNSCPLF-----------------SKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQS-ENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVE----SHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            KC  C+ +L  P    CG RFC +C+   L+ ++  C             K   C+ + + L     ++      L  +    IH   +C+F+ ELS              + DHI        + C   +N  PL                     C    LL+ E+N HL++ ++       K       T K T Q   A ++ +  Q  N  +   N  +++  +  N         E ++K+  IQ +  ++ S ++E       +  + + + + +++ E           +IR  L+   DE + +K+ ++ L+      + S L++  K+ +      N   +  Q     Q LS                +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  +      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   47 KCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFE-ELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYG---CTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQN---------ESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRN-LRQTGDEADGMKSNYESLQN-----RLSQLEVMAKNAAS----WNPGVLETQINRHDQMLS----------------VHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 555          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 67.3958 bits (163), Expect = 3.960e-11
Identity = 68/300 (22.67%), Postives = 126/300 (42.00%), Query Frame = 1
Query:  847 FGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALG--VIIKESILDIQMKSGSESQNVM-NLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDL----HEMRENVDSTKK------EFQIKIMEIEFESGKSEK---SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW-------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNT-GLGDKLIKFETFVHNTNL-----IKNDKIYIKCMVNNFKDI 1659
            FG ++    ND+ + L+  T  +  ++   Q L++    V     + DI     S+ +    ++ TV       Q   +     L+E I++L   L    H++RE +   +       E +  I  ++   G+ E    SG F WRI+NF+ +     +     ++S  F++   G K+CLRL        +   Y+      + G YD+++ WP Q  + +S++DQ+                   A+++P   +N  G G     + TF+H   L     +KND + ++C V    D+
Sbjct:  249 FGCTEKMQRNDLARHLQEFTQAH--MRMMAQTLRSFSSSVTPTSHMPDISFCDPSQFEPAPPSVATVHSSHTPSQNDCTQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFG-----YVTFMHLQALKQRQYVKNDTLLVRCSVTTHLDL 541          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 66.2402 bits (160), Expect = 6.618e-11
Identity = 51/209 (24.40%), Postives = 98/209 (46.89%), Query Frame = 1
Query: 1042 EQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEF-ESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN-LIKNDKIYIKCMVN 1644
            E++    ++L+  +   QEK++ L+  + ++   +   +KE  +  +E    ES  S   G F W+I  F K   +AI      + S  F++   G KMCLR++          +L   F ++ G  D ++ WP+  +V + L+DQ N          F    ++ ++++P SE N   G  L    + +   N  +++D I++K +V+
Sbjct:  274 ERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLG--QKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVID---AFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 477          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 63.1586 bits (152), Expect = 5.944e-10
Identity = 49/198 (24.75%), Postives = 93/198 (46.97%), Query Frame = 1
Query: 1081 VEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKS---GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN-LIKNDKIYIKCMVN 1644
            VE+     ++L++ L      ++ T  + ++ + E+E    +SE S   G F W+I  F K   +AI      + S  F++   G KMCLR++          +L   F ++ G  D ++ WP+  +V + L+DQ N          F    ++ ++++P SE N   G  L    + +   N  +++D I++K +V+
Sbjct:  256 VERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVID---AFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 450          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 92.4337 bits (228), Expect = 2.946e-19
Identity = 123/544 (22.61%), Postives = 238/544 (43.75%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNAD---QSDNTAQSKNTAQSENAAQSE---KKIFSNLREMLHEFQ-EKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSES-QN-VMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C+ +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  ++V C ++     ++L+    H+ +    KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +     +S+ T Q     ++ +A Q     K+  ++L + +   Q E  +K+  IQ +  ++ S ++E     K+M   NE K L+          I+   ++LK +  E    +  +++  +             MKS  ES QN V  L +V +++  +  + +G++E    + D++   +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIIKDK-VFKDNCCKREILALQVYCRNEGRGCAEQLTL--GHLLV--HLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIER-QKEMLRNNESKILH------LQRVIDSQAEKLKELDKEIRPFRQNWEEADS-------------MKSSVESLQNRVTELESV-DKSAGQAARNTGLLESQLSRHDQM-LSVHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 536          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 92.4337 bits (228), Expect = 2.946e-19
Identity = 123/544 (22.61%), Postives = 238/544 (43.75%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNAD---QSDNTAQSKNTAQSENAAQSE---KKIFSNLREMLHEFQ-EKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSES-QN-VMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C+ +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  ++V C ++     ++L+    H+ +    KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +     +S+ T Q     ++ +A Q     K+  ++L + +   Q E  +K+  IQ +  ++ S ++E     K+M   NE K L+          I+   ++LK +  E    +  +++  +             MKS  ES QN V  L +V +++  +  + +G++E    + D++   +H++R           +  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIIKDK-VFKDNCCKREILALQVYCRNEGRGCAEQLTL--GHLLV--HLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIER-QKEMLRNNESKILH------LQRVIDSQAEKLKELDKEIRPFRQNWEEADS-------------MKSSVESLQNRVTELESV-DKSAGQAARNTGLLESQLSRHDQM-LSVHDIR-----------LADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 536          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 90.8929 bits (224), Expect = 9.014e-19
Identity = 121/556 (21.76%), Postives = 237/556 (42.63%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQS-EKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKS----VTDENEILKNEFQDLKALGVIIKESILDIQMKSGSE-SQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTK---------------KEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C+ +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  ++V C ++     ++L+    H+ +    KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +      +  S + ++  NA  +   K +  + +  ++  + ++ SS +Q +    N LK  S+S+ K +S L      NE+   +KS  I  +  ++ S    +  + E+L+N    +  L     + ++D Q +   E  + +   R    Q ++E   +   VE LQ ++ +L        +   +T                 + ++  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIIKDK-VFKDNCCKREILALQVYCRNEGRGCAEQLTL--GHLLV--HLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHV----NLLKEWSNSLEKKVSLLQ-----NESVEKNKS--IQSLHNQICSFEIEIERQKEMLRNNESKILHL-----QRVIDSQAEKLKELDKEIRPFR----QNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 561          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 72.7886 bits (177), Expect = 5.174e-13
Identity = 52/214 (24.30%), Postives = 101/214 (47.20%), Query Frame = 1
Query: 1033 TVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN-LIKNDKIYIKCMVN 1644
             V+ +    Q +L       Q+KI+ LS  + ++  ++   D    + + K+ E+E     S   G F W+I +F++   EA+      + S +F++   G KMCLR++          +L   F ++ GP D +++WP+  +V + L+D  N          F    T+ ++++P S+ N   G  L    + +   N  +++D I+IK +V+
Sbjct:  304 AVTAEACSRQHRLD------QDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEV----STYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVID---AFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 72.4034 bits (176), Expect = 6.112e-13
Identity = 49/194 (25.26%), Postives = 95/194 (48.97%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN-LIKNDKIYIKCMVN 1644
            Q+KI+ LS  + ++  ++   D    + + K+ E+E     S   G F W+I +F++   EA+      + S +F++   G KMCLR++          +L   F ++ GP D +++WP+  +V + L+D  N          F    T+ ++++P S+ N   G  L    + +   N  +++D I+IK +V+
Sbjct:  311 QDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEV----STYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVID---AFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 6.305e-18
Identity = 121/556 (21.76%), Postives = 237/556 (42.63%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQS-EKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKS----VTDENEILKNEFQDLKALGVIIKESILDIQMKSGSE-SQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTK---------------KEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C+ +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  ++V C ++     ++L+    H+ +    KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +      +  S + ++  NA  +   K +  + +  ++  + ++ SS +Q +    N LK  S+S+ K +S L      NE+   +KS  I  +  ++ S    +  + E+L+N    +  L     + ++D Q +   E  + +   R    Q ++E   +   VE LQ ++ +L        +   +T                 + ++  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIIKDK-VFKDNCCKREILALQVYCRNEGRGCAEQLTL--GHLLV--HLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHV----NLLKEWSNSLEKKVSLLQ-----NESVEKNKS--IQSLHNQICSFEIEIERQKEMLRNNESKILHL-----QRVIDSQAEKLKELDKEIRPFR----QNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 561          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.778e-17
Identity = 123/558 (22.04%), Postives = 238/558 (42.65%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDN--CEFDDELSAIEDHISICNKSKNSCPLFSKGCDRND----LLQDEMNQHLIKDIDF------HIKLIVKII-------DDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQS-EKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKS----VTDENEILKNEFQDLKALGVIIKESILDIQMKSGSE-SQNVMNLRTVSEQTYDEQQKLSGIVEKLQ------EKIDKLSQDLHEMRENVDS---------TKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            YK   +  + D+ KC  C  +L  P    CG RFC SC+   L+ S+  C      CQ + I  D+ V  D+     +  +++ C +++  C     L  +  H+      KN C      C R D    +L+ ++  H+ K   +      H K  V +I        D P  + +     +      +  S + ++  NA  +   K +  + +  ++  + ++ SS +Q +    N LK  S+S+ K +S L      NE+   +KS  I  +  ++ S    +  + E+L+N    +  L     + ++D Q +   E  + +   R    Q ++E   +   VE LQ      E +DK +  +      ++S         +  + ++  M++ F+  ++   +G   W+I ++ +   EA+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ ++      + K      + ++KKP  E N   G  +   +T + N   IK+D I+IK +V+ 
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKC----TACQ-ESIVKDK-VFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHL------KNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHV----NLLKEWSNSLEKKVSLLQ-----NESVEKNKS--IQSLHNQICSFEIEIERQKEMLRNNESKILHL-----QRVIDSQAEKLKELDKEIRPFR----QNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 6.823e-13
Identity = 119/560 (21.25%), Postives = 223/560 (39.82%), Query Frame = 1
Query:  118 KYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTY--CPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIH-DNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDF------HIKLIVKIID----------DLPATLKNT--------------AQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDK-SSVIQEIQRELNSLKVESHSIMKDMSAL-NEYKKLNETFGPSKS--PAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGI------VEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN--LIKNDKIYIKCMVN 1644
            +Y  ++ + +  KC  C  +L  P    CG RFC  CI   L E NT   CP        K +   ++V  D+     +  + V C +   C     L   +DH+  C      C   ++ C R  +L+ ++ +HL     F      + K  V +I+          + P    N               A    A+Q D   +    A ++     ++   S LRE +    EKN +    I ++ + L   + +   + + +  L  E+K+  + FG + S  P I    Q   S  D++  L+ +   L             +QM +  + QN  +LR + E     +QK++ +      +  L+E+ +K   D H        +K E + K++E    +GK        W++ ++     EA+  +   + S SF++   G ++C R +          +L   F ++ G +D++++WP++  V + L+DQ+           F     + ++K+P  E N   G       + + N     IK+D +++K  V+
Sbjct:   32 EYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILS-LRELNTVPICPVD------KEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS--NEKC-REPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQ-DCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNI----QVFASHIDKSAWLEAQVHQL-------------LQMVN--QQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNK--HDTHINIHKAQLSKNEERFKLLEGTCYNGK------LIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIME---TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.275e-12
Identity = 49/194 (25.26%), Postives = 95/194 (48.97%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN-LIKNDKIYIKCMVN 1644
            Q+KI+ LS  + ++  ++   D    + + K+ E+E     S   G F W+I +F++   EA+      + S +F++   G KMCLR++          +L   F ++ GP D +++WP+  +V + L+D  N          F    T+ ++++P S+ N   G  L    + +   N  +++D I+IK +V+
Sbjct:  311 QDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEV----STYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVID---AFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 6.236e-12
Identity = 49/194 (25.26%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1093 QEKIDKLSQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTN-LIKNDKIYIKCMVN 1644
            Q+KI+ LS  + ++  ++   D    + + K++E+E     S   G F W+I +F++   EA+      + S +F++   G KMCLR++          +L   F ++ GP D ++ WP+  +V + L+DQ N          F    T+ ++++P ++ N   G  L    + +   N  +++D I+IK +V+
Sbjct:  311 QDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEME----ASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVID---AFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.034e-33
Identity = 123/527 (23.34%), Postives = 241/527 (45.73%), Query Frame = 1
Query:  103 VIQKYKYHLID-NISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSV----IQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEI-----LKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTN-EAWKKPKSEKN-TGLG-DKLIKFETFVHNTNLIKNDKIYIKCMVN 1644
            ++ KY    +D ++++++ C LC  ++   C   CGC +C++CI  YL++++ YCP     C+   ++L+ DV  +  ++ R+S++ VKC +  C +  EL  +++H+  C      CP  + GC+   LL+DEM +HL   +  H +LI+   ++L + + +  ++   D S      K   + + A   EK   + +  ++ E + K++   V    IQE++ E+ +L     S +K + +                  I   RQ ++ + ++ E+     +KN+ +DL       K+ I  I+M   S ++             + ++K++ ++             L+++  NVD                         F WRI+ +SK      +     V SDSF  QS   K CL L+   + L     ++ G  D+ +EWP +  V +S+I+Q +     +   ++  Y+ N +A+ +PK E+N   +G D L+++        ++ ND I + C+V+
Sbjct:   12 LLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDIS----HLKEVLRVQKALNDEKT--AQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKS-----------------DIQIFRQEIEFMKNDLEVVGSTDIKNQVKDL-------KKEIFGIKMNIDSNNE-------------ERERKMNNLIR------------LNKLCPNVDMD-----------------------FMWRIEEYSKK-----RRTVTDVYSDSF--QSHNYKFCLNLYIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVVH 453          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.172e-24
Identity = 56/187 (29.95%), Postives = 102/187 (54.55%), Query Frame = 1
Query:  100 RVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSEN 660
            R++  Y + +   + D +KC LCK +LV  C  RCGCRFC  CI +Y++  N YCP  +  C+ + + +  ++ +D+ +  ++++++VKC  + C+   EL  IE+H+ +C     +CP F  GC++  ++  ++  HL      H KLI+ II ++         +K  +  ++    KN  QS+N
Sbjct:    8 RLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLT-TKEVELREDINLIKNHFQSQN 193          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: F2YA57 (TNF receptor-associated factor OS=Cyprinus carpio OX=7962 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.751e-23
Identity = 128/574 (22.30%), Postives = 239/574 (41.64%), Query Frame = 1
Query:   73 PEDIFMDLWRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLD---RDVVSDHPMAVRLSQVKVKCIHD--NCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVI--------------QEIQRELNSLKVESHSIMKDMSALNEYK------KLNETFG--PSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQ-------------DLHEMRENVDSTKKEFQIKIMEIEFESGKSEKS---GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            PE  F+ L      ++ H +     + +C  C+++L  P    CG RFC SCIT  L++ N  CP       L+P+  D   RDV  +      +  +KV C  +   C+    L  + DH+ +C   +  CPL   G  +  +++ +M++HL +    H ++  +  +         A ++     D    +   A   + + S     S LR  L   Q    K+ V               QE++   +S   E   +M   +   E K      +L E +   PS S  + ++  + + + ++N  L+ +   ++ L     E +L+++M    E + +  LR + E    E + L G VE ++  +  L                L +     D       I++ E++ +    E +   G   W+I ++ +   EA+ S    + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  A +    + K      + ++++P +E N   G  L   +T + N   IK+D I+IK  V+ 
Sbjct:   31 PEPSFLPLH---GGFRDHFVTMPEAKYRCESCRHVLCKPRQTECGHRFCESCITDLLSKPNPVCPA-----DLEPLFEDKIFRDVCCNR----EIMALKVYCRSEKNGCKEQMSLQQVMDHLEVCPYFEVPCPL---GKCKEKMMRKDMSEHLSRKCK-HREITCEFCNH------KMALTELQKHKDTVCPAFPVACPNHCSFS-----SILRSELSSHQHDCPKAQVTCSFIRYGCSFKGLNQEMREHESSFASEHLRLMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVETQYEEMREKNRQLEQKLVSMQKLMSSHSEKLLEVEM----ELRELRPLRAMRE----EVEALRGSVENMRSIVSSLDSGRVGSSSGSHTLGSLEQQLSRHDDMMSVHDIRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPD--PNSSSFRRPTAEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 567          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A2S0NLP0 (TNF receptor-associated factor OS=Ctenopharyngodon idella OX=7959 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.699e-23
Identity = 117/547 (21.39%), Postives = 229/547 (41.86%), Query Frame = 1
Query:  157 CGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLD---RDVVSDHPMAVRLSQVKVKCIHD--NCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVK-----------------IIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQ------SEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKL----------SQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKS---GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            C  C+ +L +P    CG RFC SCIT  L++ N  CP       L+P+  D   RDV  +      +  +KV C  +   C+    L  + DH+ +C   +  CPL   G  +  +++ +M +HL +    H ++  +                 +    P    N     +  +S+ ++   +  +++          + K +   +RE    F  ++ +   ++    E     V+S         +  YK L     PS S  + ++  + + + ++N  L+ +   ++ L     E +L+++M    E + +  LR + E    E + L G VE ++  +  L          S  L  + + +   D       I++ E++ +    E +   G   W+I ++ +   EA+ S    + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  A +    + K   +  + ++++P  E N   G  L   +T + N   IK+D I+IK  V+ 
Sbjct:   56 CEACRLVLCIPRQTECGHRFCESCITDLLSKPNPVCPA-----DLEPLFEDKIFRDVCCNR----EIMALKVYCRSEKNGCKEQMSLQRVMDHLEVCPYFEVPCPL---GKCKEKMMRKDMPEHLSRKCK-HREITCEFCNHKMALTELQKHKETVCPAFPVACPNHCSFSSILRSELSSHQHDCPKAQVTCSFIRFGCTYKGLNQEMREHETSFASEHLRMMAVRNTTLEAKVEDVKS-------ELMERYKVL-----PSLSSRLAEVETQYEEMREKNRQLEQKLVSMQMLMSAHSEKLLEVEM----ELRELRPLRAIRE----EVEALRGSVESMRSVVSSLDAGRVGSGSGSHTLGTLEQQLSRHDDMMSVHDIRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPH--SSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 567          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A2I6ZHU7 (TNF receptor-associated factor OS=Mylopharyngodon piceus OX=75356 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.611e-22
Identity = 114/543 (20.99%), Postives = 230/543 (42.36%), Query Frame = 1
Query:  157 CGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLD---RDVVSDHPMAVRLSQVKVKCIHD--NCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVK-----------------IIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKK--IFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQ-------------DLHEMRENVDSTKKEFQIKIMEIEFESGKSEKS---GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            C  C+ +L +P    CG RFC SCIT  L++ N  CP       L+P+  D   RDV  +      +  +KV C  +   C+    L  + DH+ +C   +  CPL   G  +  +++ +M +HL +    H ++  +                 +    P    N     +  +S+ ++   +  +++      +    ++ L + + E  E +  S  ++ +     +L+ +   +  ++  +  YK L     PS S  + ++  + + + ++N  L+ +   ++ L     E +L+++M    E + +  LR + E    E + L G VE ++  +  L                L +     D       I++ E++ +    E +   G   W+I ++ +   EA+ S    + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  A +    + K   +  + ++++P  E N   G  L   +T + N   IK+D I+IK  V+ 
Sbjct:   56 CEACRLVLCIPRQTECGHRFCESCITYLLSKPNPVCPA-----DLEPLFEDKIFRDVCCNR----EIMALKVYCRSEKNGCKEQMSLQRVMDHLEVCPYFEVPCPL---GKCKEKMMRKDMPEHLSRKCK-HREITCEFCNHKMALTELQKHKETVCPAFPVACPNQCSFSSILRSELSSHQHDCPKAQVTCSFIRFGCTYTGLNQEMRE-HETSFASEHLRMMAVRNTTLEAKVEDVKSEL--MERYKVL-----PSLSSRLAEVETQYEEMREKNRQLEQKLVSMQMLMSAHSEKLLEVEM----ELRELRPLRAIRE----EVEALRGSVESMRSVVSSLDSGRVGSGSGSHTLGTLEQQLSRHDDMMSVHDIRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPH--SSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 567          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 83.5741 bits (205), Expect = 1.453e-16
Identity = 122/541 (22.55%), Postives = 229/541 (42.33%), Query Frame = 1
Query:  136 NISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPI-DLDRDVVS------DHPMAVRLSQVKVKCIHDNCEFDDELSAIE-DHISICNKSKNSCPLFSKGCDRNDLLQDEMNQH-------------------LIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQ-SE---KKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            ++  + +C  CK +L  P   +CG RFC  C  K L  S    P   + C+ + I +++  ++S      D+     +  +  KC +D C ++  L   E  H   C   +  C    + C    LL D+ ++H                     KDI  H ++  K     P   K+  + K   +      SK+ A+S++A Q SE   + +  N ++  HE      +SS+I+ ++  L  L     ++        E+++ +   G  + P          +  +       + Q + AL  I+   +L+ +++     + V+ L  ++ Q   +Q+K    +E L  K+ +L + L  MR   D    E +  + E++F        G F W+I +FS+   +A+      + S +F+S   G KMCLRL+          +L   F ++ G YD +++WP+  +V + L+DQ N          F    ++ ++++P SE N   G  L          ++ +++D I+IK +V+
Sbjct:   35 SMEPKYQCQQCKGVLRKPFQAQCGHRFCVFCF-KQLTSSG---PIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKC----EACQMMILLSDK-DRHNERECEARTLNCKYCKVTFSFKDIKAHDEICQK----FPMQCKDCGK-KKIPREKFAEHSKSCAKSKSACQFSEIGCRAVVDNGKQHEHE------QSSIIEHLRLMLAVLS----TVRVRSDGPGEWQE-DSGLGLYRGPEDAAPPGAHAAAHNAAGGPGVQ-QKMTALENIV--CVLNREVE-----RTVLRLEALTRQQQLDQEK----IENLSNKVRQLERTL-TMR---DLQLAESEQALRELQF----CTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 77.7962 bits (190), Expect = 1.011e-14
Identity = 122/555 (21.98%), Postives = 227/555 (40.90%), Query Frame = 1
Query:  157 CGLCKYILVVPCSIRCGCRFCHSCITKYL-NESNTYCPNKSKFCQLKP---------IDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDL-PATLKNTAQSKNADQSDNTAQ-SKNTAQSENAAQSEKKIFSNL-----------RE--------MLHEFQE--KNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLN---------ETFGPSKSPAIND------IRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKS-EKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI----KFETFVHNTNLIKNDKIYIKCMVN 1644
            C  C  +L      +CG R+C +C+   L N  +  C      C+  P         + LD    SD+ +   + +++V C++  C +   L   EDH S C  +   C +   GC    +L+  +  HL K    +          L PA L+  + S   ++  + A+  K  ++ E+  + E  +FS +           RE         LH   E  +N + SV    +R +    ++ H   +DM+ L +   LN         +T    K+ +++D      + Q+L ++    +I++N    + AL   ++++ L + +    ++ N MNL           Q L  +V + Q+++                 +K+ QI  ++    + +     G F WRI + S+   EA         S +F++   G K+C+RL+   + +  G      F ++ G YD ++ WP++ +V   LIDQ            F     + ++++P SE N   G  L     K  +  H    +K+D ++IKC+V+
Sbjct:   29 CSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTK----CKEDPGSESDSSMMLTLDH-FFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNI---GCGLM-VLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQKHSCSNGTEKDLSKAEKRKKDSKQESPKRKETCVFSEIGCTFKGNPDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDI-TLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMEN---IITALNREVEKTQLTVVVLE-RDNHNNMNLI----------QHLEAVVAEQQQRL----------------IRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVD---AFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKH--AYVKDDTLFIKCVVD 538          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.751e-12
Identity = 40/149 (26.85%), Postives = 73/149 (48.99%), Query Frame = 1
Query: 1219 GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            G   W+I ++ +   EA+ S    + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  A +    + K      + ++++P  E N   G  L   +T + N   IK+D I+IK  V+ 
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPD--PNSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 150          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 70.8626 bits (172), Expect = 1.795e-12
Identity = 88/418 (21.05%), Postives = 168/418 (40.19%), Query Frame = 1
Query:  415 DHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEF-ESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            DHI +C K +  C     GCD + + +++++ H       H+ L++  I  +   L+                   + Q ++   +  KI   L + L E + K  + S    +Q           +             L  +F P  +     +  +L S   +   L    Q+L+ L V   E+I+ +  +    S   M       + Y+ Q +L       Q+KI+ L+  + ++   V    ++  I  ME +  E   +   G F W+I +FSK   +A+      + S +F++   G KMCLR++          +L   F ++ G  D +++WP+  +V + L+DQ N          F    ++ ++++P S+ N   G  L           + I++D I+IK +V+
Sbjct:  204 DHIKLCTKFRTPCRFHVVGCDMS-VEKEKIHDHERACSYEHLNLLLHFIMGIKVNLE-------------------SLQPQSLELASHKI-QELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPT-------------LATSFTPLPTTVGAALELQLHSEKTKVAELSRRCQELE-LKVGTFENIVCVLNREMERSATTM-------EAYNRQHRLD------QDKIEILNNKVRQLERTVGL--RDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID---AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 568          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 66.6254 bits (161), Expect = 3.230e-11
Identity = 52/216 (24.07%), Postives = 99/216 (45.83%), Query Frame = 1
Query: 1021 MNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEF-ESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            M     + + Y+ Q +L       Q+KI+ L+  + ++   V    ++  I  ME +  E   +   G F W+I +FSK   +A+      + S +F++   G KMCLR++          +L   F ++ G  D +++WP+  +V + L+DQ N          F    ++ ++++P S+ N   G  L           + I++D I+IK +V+
Sbjct:  251 MERSATTMEAYNRQHRLD------QDKIEILNNKVRQLERTVGL--RDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID---AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 2.080e-11
Identity = 38/167 (22.75%), Postives = 80/167 (47.90%), Query Frame = 1
Query: 1162 EFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVN 1644
            E +++++E    SGK        W+I ++++   EA       + S  F++   G KMC R +   + +  G      F ++ G YD ++EWP++  V +SL+DQ  A      S  F+    + ++++P  + N   G  L      +  ++ + +D ++++ +V+
Sbjct:  255 ERRLQVLETAGYSGK------LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHL--SDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 5.338e-11
Identity = 34/149 (22.82%), Postives = 73/149 (48.99%), Query Frame = 1
Query: 1219 GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            G   W+I ++++   +A+      + S  F++   G +MC R +   + +  G      F ++ G YD ++ WP++  V ++L+DQ  A    S + K      + ++++P S+ N   G  L      + + + +++D I+IK +V+ 
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPD--PASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVDT 471          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 60.077 bits (144), Expect = 9.871e-10
Identity = 58/264 (21.97%), Postives = 106/264 (40.15%), Query Frame = 1
Query:  982 DIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRE------NVDSTKKEFQIKIMEIEFESGKSEK---SGYFYWRIDNFSKVWNEAIKSN----------NGKVNSDSFFSQSKGCKMCLRL-----------WKAEEYLCAG--------FCLIPGPYDNVIEWPYQMEVFISLIDQ-----TNATEFASCSLKFSCYRTNEAWKKPKSEKNT-GLGDKLIKFETFVHNTNLIKNDKIYIKCMV 1641
            D+Q    S SQ   +    +     E  +L  I   L+E++      LH++RE      N      E    +  +E    +SE    +G F WR++ FS++    + S              ++S  F++   G ++CLRL             +   L AG          L+ G YD+ + WP++  + IS++DQ      + TE      + S      A+++P   +N  G G         +H+ + +++D + ++C V
Sbjct:  310 DVQTAGASRSQGSRD--RAACDCAQELDRLREITRTLEERV---VLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLS------AFQRPSVHRNPKGFGYMNFMDINTLHHRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 2.884e-8
Identity = 27/77 (35.06%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 1219 GYFYWRIDNFSKVWNEAIKSNNG-----KVNSDSFFSQSKGCKMCLRLWKAEEYLCAGFCLIPGPYDNVIEWPYQME 1434
            G F W+I +   V N   ++ NG     +++S +FF+   G ++ LRL ++ E++ A   L PGPYD  + WPYQ++
Sbjct:  325 GMFLWKIKH---VINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGEHVSAYAMLGPGPYDATLAWPYQLK 398          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 96.6709 bits (239), Expect = 3.633e-21
Identity = 122/554 (22.02%), Postives = 215/554 (38.81%), Query Frame = 1
Query:  130 IDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLP-ATLKNTAQSKNA--DQSDNTAQSKNTAQSENAAQSEK--KIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMN---------LRTVSEQTYDE-----------------QQKLSGIVEKL------QEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWK------AEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFA------SCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVN 1644
            ID + D   C  C+  L  P   +CG RFC  CI   L      CP   +  Q   +  DR  + +  M         +C  D C++   ++ I  H  +C   K SC   S GC    +L+ ++ +H+ K+  F +   V   +D+P  TL    +   A   +  N    K   + + +A + +     ++ R     F        V +   RE  +  V  H I+           L  T G    P + ++  +L+    EN   K E +  K     +KE   D   + G   + V N         +R   E    E                 ++ L  ++++L      Q   +KL++ L ++  ++   K +   + + I+ +   S   G F W+ID F++ + EA   N   + S  F++   G K+C RL+        + YL     L+ G YD+++ WP+Q  + I+LIDQ N    +       CS+ F         ++P    N   G      +T +     +  + +++K +V+
Sbjct:    3 IDVLEDRYICNACRMPLNHPMQAQCGHRFCKHCIDVILISPFPACPRDGQTIQALSVFHDRCALVE--MQALPCYCHGRC--DGCQWTGPVAMITVHEEVCAFIKVSCIHASDGCG-EIMLRFQLAKHVEKECPFRLITCVYCQNDVPERTLIEHLKKCPAFPIECPNECGVKRIERKKLSAHTRECPNALTDCR-----FSPLGCTYKVKKIALREHQNKHVIKHMIL-----------LGRTTG-EPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAIS-YDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISETFDPDPCSISF---------QRPTRNINVASGCPRFCSQTVLRTRGYMNENCVFVKVVVD 524          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 66.2402 bits (160), Expect = 1.679e-11
Identity = 35/149 (23.49%), Postives = 68/149 (45.64%), Query Frame = 1
Query: 1219 GYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            G + W+ID +++ + E +      + S  F+    G K C R++   + +  G      F L+ G +D ++ WP++ +V   L+DQ    +       F    T+ ++K+P S  N   G  L    T +     +++D ++IK  V+ 
Sbjct:  378 GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGD---TFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKIAVDT 523          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 62.3882 bits (150), Expect = 2.114e-10
Identity = 47/191 (24.61%), Postives = 96/191 (50.26%), Query Frame = 1
Query: 1099 KIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNE-AIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCA-----------GFCLIPGPYDNVIEWPYQMEVFISLIDQ-TNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLG-DKLIKFETFVHNTNLIKNDKIYI 1629
            K+ ++  + H +++++ S      I+I E+E    K   +G F W+I N+++++ + A K    K+ S  F++   G K+     +AE +L                ++ G YD+V+ WP+Q  V   LIDQ  + T   + + + +C R ++ + +P   K+ G G  K +  ET + + N ++++ ++I
Sbjct:  190 KVKRIEMEKH-LQDSMASHLDMAHIRIRELEQRQEKICTNGKFLWKISNYTQLFQQSATKKEKEKLCSPPFYTGQYGYKL-----RAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRLTCDRNSDYFGRPNKAKSLGFGCPKFVSQET-LKSRNFVRDNTVFI 373          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 60.8474 bits (146), Expect = 6.744e-10
Identity = 46/173 (26.59%), Postives = 78/173 (45.09%), Query Frame = 1
Query:  103 VIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKY-LNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSC--PLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNAD 612
            V   Y    +  +++E  C +C   L VP   +CG RFC  C+ +    +S   CP        +P+DL +DV  D      +    VKC    C+++ EL  +E H   C+    +C  P+ S    R D+     ++HL+ + D+ + +     D+ P  L+  A ++N D
Sbjct:    7 VPSGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDR-----EPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCSNPMCSAQLPRMDV-----DEHLLVECDWRLIVCEYCGDESPYCLQK-AHARNCD 168          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 58.9214 bits (141), Expect = 3.550e-9
Identity = 38/143 (26.57%), Postives = 71/143 (49.65%), Query Frame = 1
Query: 1054 DEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRL------WKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTN 1464
            DE ++    +E+  E + K S D    R   + T K  +++  EIE E      +G F W++DNF +    +I      ++S  F++   G KMCLR+          E++     ++ G +D ++EWP+   + +S++DQ++
Sbjct:  284 DEYRQFLAYLERKVEDV-KTSSD----RRIAELTHKLMRLETREIELEGRVC--NGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSD 419          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 78.5666 bits (192), Expect = 6.173e-15
Identity = 112/542 (20.66%), Postives = 217/542 (40.04%), Query Frame = 1
Query:  139 ISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQL-----KPIDL--DRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIE-DHISICNKSKNSCP-----LFSKGCDR-NDLLQDEMNQHL--------IKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQ-SE---KKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSI--MKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIK-----IMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            + D+ KC  C  +L  P   +CG RFC  C  +  +      P   + C+      +P+ +    +   D+     ++ +  +C++  C++   +   E  H   C   +  C      +  K  DR ND   +E   +          KDI  H ++  K     P   K+  + K   +  N   +K+ A+S++A   SE   K +  N +   HE     +   ++  +   +   ++++      ++ S L  Y+  ++  G + S    D+ +++ ++ +   +L  E +                        ++ + L   S Q   +Q+K    +E L  KI +L + L         T K+ Q+      + E+++        G F W+I +FS    EA+      + S +F+S   G KMCLRL+          +L   F ++   YD +++WP+  +V + L+DQ N          F    T+ ++++P SE N   G  L          +  +++D I+IK +V+
Sbjct:   24 MEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSG----PKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDIKAHDEICQK----FPLQCKDCGKKKIPREKFND-HAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVE------------------------RSSLTLEAFSHQHRLDQEK----IENLSNKIRQLERSL---------TVKDLQLSEAEQMVRELQY----CTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 78.5666 bits (192), Expect = 6.350e-15
Identity = 112/542 (20.66%), Postives = 217/542 (40.04%), Query Frame = 1
Query:  139 ISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQL-----KPIDL--DRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIE-DHISICNKSKNSCP-----LFSKGCDR-NDLLQDEMNQHL--------IKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQ-SE---KKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSI--MKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIK-----IMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            + D+ KC  C  +L  P   +CG RFC  C  +  +      P   + C+      +P+ +    +   D+     ++ +  +C++  C++   +   E  H   C   +  C      +  K  DR ND   +E   +          KDI  H ++  K     P   K+  + K   +  N   +K+ A+S++A   SE   K +  N +   HE     +   ++  +   +   ++++      ++ S L  Y+  ++  G + S    D+ +++ ++ +   +L  E +                        ++ + L   S Q   +Q+K    +E L  KI +L + L         T K+ Q+      + E+++        G F W+I +FS    EA+      + S +F+S   G KMCLRL+          +L   F ++   YD +++WP+  +V + L+DQ N          F    T+ ++++P SE N   G  L          +  +++D I+IK +V+
Sbjct:   31 MEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSG----PKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDIKAHDEICQK----FPLQCKDCGKKKIPREKFND-HAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVE------------------------RSSLTLEAFSHQHRLDQEK----IENLSNKIRQLERSL---------TVKDLQLSEAEQMVRELQY----CTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIID---AFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 74.3294 bits (181), Expect = 1.586e-13
Identity = 59/232 (25.43%), Postives = 112/232 (48.28%), Query Frame = 1
Query:  982 DIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKL-QEKIDKLSQDLHEMRENV---DSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            ++++KSG+  +NV+ +     + +    + S    KL Q+KI+ LS  + ++   V   D T  E + ++ E+      +   G F WRI +F+K   +A+      + S +F++   G KMCLR++          +L   F ++ G  D +++WP+  +V + L+DQ+N          F    T+ ++++P SE N   G  L           + I++D I+IK +V+
Sbjct:  369 ELEVKSGT-FENVVCVLNREVERFTTTMEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTVAEMEGRLREM----AATTFDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIID---AFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVD 592          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 70.0922 bits (170), Expect = 2.034e-12
Identity = 46/214 (21.50%), Postives = 103/214 (48.13%), Query Frame = 1
Query: 1045 QTYDEQQKLSGIVEKLQEKIDKLSQ------DLHEMRENVDSTKKEFQIKIMEIEFESGKSEK-SGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAG------FCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNN 1647
            Q  DE + L G ++ ++ ++  L Q      +    R +   +  E ++  M++ F+  ++   +G   W+I ++ +   +A+      + S  F++   G KMC R++   + +  G      F ++ G YD ++ WP++ +V + L+DQ  + +    + K     ++ ++++P +E N   G  L   ++ + +   IK+D I+IK  V+ 
Sbjct:  233 QLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTVDT 444          

HSP 2 Score: 53.1434 bits (126), Expect = 5.490e-7
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 1
Query:  115 YKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLD---RDVVSDHPMAVRLSQVKVKCIHD--NCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHL 516
            ++ H ++    +  C  C+ +L  P    CG RFC+SCI   L+  N  CP       ++P+  D   RDV         +  +KV C  +   C+    L  I DH+++C   +  CPL   G  +  +++ E+ +HL
Sbjct:   34 FRDHFVEAPEAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPA-----DMEPLFKDKIFRDVCCHR----EIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPL---GKCKERMMRKEIPEHL 160          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 63.1586 bits (152), Expect = 4.993e-10
Identity = 49/208 (23.56%), Postives = 98/208 (47.12%), Query Frame = 1
Query: 1045 QTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEF-ESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLW------KAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLI-KFETFVHNTNLIKNDKIYIKCMVN 1644
            + Y+ Q +L       Q+KI+ LS  + ++   V  + ++  I  ME +  +   +   G F W+I +F+K   +A+      + S +F++   G KMCLR++          +L   F ++ G  D +++WP+  +V + L+DQ N          F    ++ ++++P S+ N   G  L           + I+++ I+IK +V+
Sbjct:  369 EAYNRQHRLD------QDKIEILSNKVRQLERTV--SLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID---AFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000027283.1 (SMESG000027283.1)

HSP 1 Score: 1141.72 bits (2952), Expect = 0.000e+0
Identity = 557/567 (98.24%), Postives = 560/567 (98.77%), Query Frame = 1
Query:   70 MPEDIFMDLWRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSE------KKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNNFKDIGMVRTLNTLEQPNKTIGSIRILDLYKNFSSS 1752
            MPEDIFMDLWRVIQKYKYHLIDNISDEMKCGLCKY+LVVPCSIRCGCRFCHSC+TKYLNESNTYCPNKSK+CQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSE      KKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFES KSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNNFKDIGMVRTLNTLEQPNKTIGSIRILDLYKNFSSS
Sbjct:    1 MPEDIFMDLWRVIQKYKYHLIDNISDEMKCGLCKYMLVVPCSIRCGCRFCHSCLTKYLNESNTYCPNKSKYCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESVKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNNFKDIGMVRTLNTLEQPNKTIGSIRILDLYKNFSSS 567          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000014706.1 (SMESG000014706.1)

HSP 1 Score: 229.565 bits (584), Expect = 4.687e-68
Identity = 147/526 (27.95%), Postives = 284/526 (53.99%), Query Frame = 1
Query:   97 WRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESN-TYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQK----LSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLR-----LWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDK-LIKFETFVHNTNLIKNDKIYIKCMV 1641
            W++I++  + LI+ +++++ C +CK I++   +  CGCR+C  CI ++LN ++  YCP  +K+C +  ID DRD+  D  + +R+SQ+ VKC  + CEF DELS +E+H+  C++    CP    GC + ++ Q+E+N+HL+ D   H KL+V+ +++    L+N  +      S     ++N    EN  +S K+     ++ +H+ +        I  +  E N++K++ +S+   + A  + +K  +            +++ +  + +EN+ +      LKA    +K+   + Q K     + +   +   E   D  ++    +S  VE+L+E ++ L  ++  ++ ++ + K  F+ ++ ++E E   ++++  F W+I+NFSKV  +A ++ N ++ SDSFF    G +MCL      L K+  ++   F ++ GPYDN++ WP Q++V + LIDQ +   F S +  +     NE ++KP S  N+G G    IK +  +    L +N++++IKC+V
Sbjct:    8 WKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLVVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNEVNKHLLNDSFPHNKLLVEYVNN----LRNEIEELKTQMS--KTNTENFCLIENLGESRKRFI--YQQAVHKKE--------IDILAEENNAMKIQINSLNFKIGAFKQNEKQEQV----------QLKEEMSRLVEENKAIGIHINSLKAEIATLKKE--NKQEKLEKTLKGLEGKQEEIEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSVKLDIFTEKLSFENRLSDLE-ERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIV 504          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000021123.1 (SMESG000021123.1)

HSP 1 Score: 224.172 bits (570), Expect = 3.800e-66
Identity = 158/531 (29.76%), Postives = 272/531 (51.22%), Query Frame = 1
Query:   97 WRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESN-TYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMN-----LRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVD---STKKEFQIKIMEIEFE-SGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLR-----LWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLG-DKLIKFETFVHNTNLIKNDKIYIKCMV 1641
            W++I +  + LI+ ++D++ C +CK I+V   +  CGCR+C  CI KYLNE++  YCP  SK+C +  ID DRD+  D  + +R+SQ+ VKC  + C+F DELS +E H+  C++    CP    GC + D+ +DE+N+HL  +   H KL+V  +++    L+N  ++ N+  S  T +  N   ++  A+S KK          EFQ++  K   I ++ +E NS+K++ +S+   M+ L +                           DE ++L  E           +  +L+ + +   ES   +N     +    ++  ++   L   V  L  +ID L++D+ ++ ++VD   ++K+ +++KI +I+ +    S K   F W++++F++V       +   + SD FF    G KM L      L K+  +    F +I GPYD+++ WP Q++V   LI+Q     F S    F     + A++KP +EKN GLG    IK +  +    LIKND+++IKC V
Sbjct:    8 WKIISEKNFQLINPLNDDLICLICKGIMVNATNAPCGCRYCCLCIKKYLNETDDNYCPGLSKYCGINWIDFDRDICVDRSINIRISQLIVKCPMETCDFTDELSMMEKHLKDCDRKFIGCPYSEIGCCKPDIRKDEVNKHLFNESFPHNKLLVDYVNN----LRNEMEALNSKISAITTE--NICLAKTLAKSNKKF---------EFQQRTFKRE-IDKLTKENNSMKIQINSLNIKMTVLKQ---------------------------DEKQVLVQE-----------RLGLLEGRQEKTEESVGKLNEANTTINGTVDRLTNDMNSLKEDVGSLNNEIDDLTEDVSKLEDSVDEINTSKESYEMKIDKIQVQLDNLSNKE--FIWKLEDFTEVVENCKTKSTKMIISDFFFVSENGYKMGLYAYPKGLGKSAGFFGIYFNIIKGPYDDLLCWPCQIDVTFELINQETKCSFISKKKLFENNPDHTAYQKPTTEKNNGLGYPYFIKLDYLLKQNQLIKNDQLFIKCFV 482          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000049812.1 (SMESG000049812.1)

HSP 1 Score: 223.016 bits (567), Expect = 8.862e-66
Identity = 146/541 (26.99%), Postives = 282/541 (52.13%), Query Frame = 1
Query:   82 IFMDLWRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKN----TAQSKNADQSDNTAQSKNTAQSE---NAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQI-------KIMEIEFESGKSE--KSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCLR-LWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKLIKFETFVHNTNLIKNDKIYIKCMVNNFK 1653
            +F +LW+++++ ++   + I  E+KC +CK +++  C+  CGCRFC  CI +YL++++ +CP +++FCQ++ ++  R+V  DHP+++R+S+V VKC   NCE   EL  +E+H++ C+K   SCP  + GC  N++  DEMN HL +    H  L++ +I++L + +++      + K   +     + KNTA+ E   N   + KK   +LR+ + E  ++N K       ++++++++++S  + + M  +   ++ N                 ++ + +E  +LKNE++ + +            QM++ +E+ N + ++    +   +QQ             D L Q+  + R   +   K FQ+       +I +I+   G     KSG+F W ID  SK      +  + ++ S  F+S   G KMCL  +   ++Y+  GF L+   +DN +EWP++  V I +ID  N     S S+K+S    +  W+KP S++N    D +  +   +   ++ KN+K+ +KC ++ F+
Sbjct:    1 MFTNLWKMMRENQFESDNEICSELKCRICKCLMIKACNAPCGCRFCSDCIEQYLSKNDKFCPGQARFCQVQKVNFTRNVSEDHPISLRISKVIVKCPRQNCETKTELIKMEEHMNNCDKRPISCPFNTFGCAINEVASDEMNAHLNESSYCHSNLLIAMINNLNSQMESMMNENMELKQRMRRMEAKERKNTAKIEDLNNVILAVKKNNQSLRDEMTELSKENRK------FKQQIDTIELQSADLQQKMGEMEAREQENAG--------------EIELLNEEMVVLKNEYRSMSS------------QMETNAEAINQIRMQIERIEINSQQQS------------DALKQNCEQQRLQAN---KNFQLEMEKCANEIRQIQSTFGYENFLKSGFFEWEIDKISK------QKRDNRIYSKPFYSGPFGYKMCLAVIIGGDDYIAVGFNLMRSDFDNNLEWPFKYSVAIDVIDSANGNIIDSRSVKYSDCPDDVGWRKPTSDRN----DPICIYYNSISIKSVAKNNKLLLKCKIDKFE 484          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000014700.1 (SMESG000014700.1)

HSP 1 Score: 218.779 bits (556), Expect = 2.231e-64
Identity = 149/526 (28.33%), Postives = 259/526 (49.24%), Query Frame = 1
Query:   85 FMDLWRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFCHSCITKYLNESN-TYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKCIHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLIKDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQSEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSALNEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIKESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQDLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEAIKSNNGKVNSDSFFSQSKGCKMCL-----RLWKAEEYLCAGFCLIPGPYDNVIEWPYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLG-DKLIKFETFVHNTNLIKNDKIYIKCMV 1641
            F  +W++I++  + LI+++  ++ C +CK I++   +  CGCR+C  CI ++LNE++  YCP  +K+C +  ID DRD+  D  + +R+SQ+ VKC  + CEF DELS +E+H+  C++    CP    GC + ++ Q+E+N+HL+ D   H KL+V+ +++L   ++      +  +++N                          ++   +++ DKS +      E + LK E  +++KD                    A+ DI+     + D N  +    QD +     I   + ++Q K    S+N+  L+  +E       K+S  V  L+E ID           + D  K  F  +++EI  +         F W+I+N SKV   A +SNN K+ SD +F    G +MCL      L K + +    F ++ GPYD+++ WP +++V   LI+Q N + F S S K+     +  +KKP +E+N   G    IK +  +    +I+ D+I+IKC V
Sbjct:    4 FEIVWKIIKENNFKLINSLKKDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNETDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCSKPEVRQNEVNEHLLNDSFLHNKLLVEYVNNLRNEIEELKTQMSLVKTENIC------------------------LIESLEKRGDKSGL------EQSKLKEELSALVKD-------------------NAVKDIQ-----IKDLNNKINTLIQDRRNDE--ISGQMKELQEKQEKVSENLDLLQNSNEVVSVRFHKISRKVSTLKESID-----------DFDMLKFAFAKRLIEITAQLN----VKIFVWKIENLSKVIEGAKESNNTKIFSDPYFVSENGYQMCLCVIPNGLVKTKGFFGVYFNVMKGPYDDILSWPCKIDVTFELINQDNGSAFRSESEKYELNSKSGVYKKPTTERNASFGFPYFIKLKDLLKQEEVIRKDQIFIKCNV 458          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF33.084e-1822.53TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.084e-1822.53TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.702e-1822.04TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.702e-1822.04TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.043e-1722.22TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-14.320e-627.89TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf37.024e-2521.08TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
unm_sa8089.719e-1526.80un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2b2.675e-1326.02Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.675e-1326.02Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.870e-1326.02Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh22.365e-1520.51slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh25.090e-1420.14slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf3.960e-1122.67epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
TRAF26.618e-1124.40TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF25.944e-1024.75TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf32.946e-1922.61TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.946e-1922.61TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf39.014e-1921.76TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf25.174e-1324.30TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf26.112e-1325.26TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE6.305e-1821.76TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.778e-1722.04TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|O00463|TRAF5_HUMAN6.823e-1321.25TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE4.275e-1225.26TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN6.236e-1225.26TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1011.034e-3323.34TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID82.172e-2429.95TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
F2YA571.751e-2322.30TNF receptor-associated factor OS=Cyprinus carpio ... [more]
A0A2S0NLP05.699e-2321.39TNF receptor-associated factor OS=Ctenopharyngodon... [more]
A0A2I6ZHU73.611e-2220.99TNF receptor-associated factor OS=Mylopharyngodon ... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.453e-1622.55TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf11.011e-1421.98TNF receptor-associated factor 1-like [Source:NCBI... [more]
ENSAMXT00000035169.11.751e-1226.85pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2a1.795e-1221.05TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a3.230e-1124.07TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002130.12.080e-1122.75pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.15.338e-1122.82pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf69.871e-1021.97TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.12.884e-835.06pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352373.633e-2122.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.679e-1123.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406652.114e-1024.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412436.744e-1026.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487733.550e-926.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b6.173e-1520.66TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b6.350e-1520.66TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8081.586e-1325.43TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf32.034e-1221.50TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.24.993e-1023.56TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027283.10.000e+098.24SMESG000027283.1[more]
SMESG000014706.14.687e-6827.95SMESG000014706.1[more]
SMESG000021123.13.800e-6629.76SMESG000021123.1[more]
SMESG000049812.18.862e-6626.99SMESG000049812.1[more]
SMESG000014700.12.231e-6428.33SMESG000014700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033686 ID=SMED30033686|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1768bp
TTCCGATCTATTGAATTGTATTCCTTTAATAAATATTTTACATAATTTAG
GTATATTAATACTCTGTGAATGCCCGAGGATATATTCATGGATCTTTGGC
GCGTAATACAAAAGTACAAATATCATTTGATAGACAATATTTCCGACGAA
ATGAAATGTGGTTTATGCAAATATATATTAGTGGTTCCTTGCAGCATTCG
GTGCGGTTGCAGGTTCTGCCATTCCTGTATAACTAAGTACTTAAATGAAT
CCAATACTTACTGTCCAAATAAATCAAAGTTTTGTCAACTCAAACCGATA
GATCTGGACCGGGATGTCGTATCCGATCACCCCATGGCCGTCCGATTGTC
ACAAGTCAAAGTGAAATGTATTCACGATAATTGTGAATTTGATGATGAAT
TAAGCGCTATCGAAGACCACATAAGCATCTGTAATAAATCAAAAAACAGT
TGCCCACTTTTCTCTAAGGGATGTGATAGGAATGATTTATTGCAAGACGA
AATGAACCAGCACCTTATAAAAGACATAGATTTTCACATTAAACTTATAG
TAAAAATCATCGATGATCTTCCCGCGACATTAAAAAATACTGCCCAATCA
AAGAATGCTGACCAATCAGATAATACTGCCCAATCAAAGAATACTGCCCA
ATCAGAAAATGCTGCCCAATCAGAAAAGAAAATCTTTTCAAATTTGAGGG
AGATGTTGCATGAGTTCCAAGAAAAGAATGATAAATCTTCCGTCATTCAA
GAAATACAAAGAGAACTCAATTCTTTAAAAGTGGAGAGCCATTCTATAAT
GAAAGATATGTCAGCTTTAAATGAATATAAAAAATTGAATGAAACTTTCG
GTCCCTCGAAATCTCCGGCAATAAATGACATCAGACAACGTTTAAAATCG
GTAACGGATGAGAATGAAATACTGAAAAACGAATTTCAAGATCTTAAAGC
ACTTGGAGTAATTATAAAAGAATCAATCCTGGATATCCAAATGAAATCAG
GATCAGAGTCCCAGAACGTAATGAATCTCAGAACGGTTTCAGAGCAGACC
TATGATGAACAACAAAAGCTATCAGGCATAGTTGAGAAGCTTCAAGAGAA
GATAGATAAATTATCTCAGGATCTTCATGAAATGAGAGAAAATGTGGATA
GCACGAAGAAAGAATTCCAAATTAAAATAATGGAAATTGAATTCGAATCG
GGAAAAAGCGAAAAGAGCGGTTATTTTTATTGGAGAATTGATAACTTTTC
TAAAGTATGGAATGAGGCGATAAAGTCGAACAATGGAAAAGTAAATAGTG
ATTCATTTTTTTCCCAATCAAAAGGGTGCAAAATGTGTTTGCGTTTGTGG
AAGGCAGAAGAATATTTATGCGCGGGATTTTGTTTGATCCCAGGCCCATA
TGACAATGTTATTGAATGGCCGTATCAAATGGAAGTTTTTATTTCTCTAA
TAGATCAAACAAATGCAACAGAATTTGCATCCTGTTCCTTGAAGTTCAGT
TGTTATCGGACTAACGAAGCCTGGAAGAAACCGAAAAGTGAGAAGAACAC
GGGACTCGGGGACAAACTGATAAAATTCGAAACATTTGTCCATAATACGA
ATTTGATAAAAAATGATAAAATCTATATAAAGTGTATGGTTAATAATTTT
AAGGATATTGGTATGGTTAGAACATTGAATACATTAGAACAACCTAATAA
AACAATCGGTTCAATACGAATTCTTGATTTGTATAAGAATTTCAGTTCGT
CATGATTTTTCAGATGCG
back to top

protein sequence of SMED30033686-orf-1

>SMED30033686-orf-1 ID=SMED30033686-orf-1|Name=SMED30033686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MPEDIFMDLWRVIQKYKYHLIDNISDEMKCGLCKYILVVPCSIRCGCRFC
HSCITKYLNESNTYCPNKSKFCQLKPIDLDRDVVSDHPMAVRLSQVKVKC
IHDNCEFDDELSAIEDHISICNKSKNSCPLFSKGCDRNDLLQDEMNQHLI
KDIDFHIKLIVKIIDDLPATLKNTAQSKNADQSDNTAQSKNTAQSENAAQ
SEKKIFSNLREMLHEFQEKNDKSSVIQEIQRELNSLKVESHSIMKDMSAL
NEYKKLNETFGPSKSPAINDIRQRLKSVTDENEILKNEFQDLKALGVIIK
ESILDIQMKSGSESQNVMNLRTVSEQTYDEQQKLSGIVEKLQEKIDKLSQ
DLHEMRENVDSTKKEFQIKIMEIEFESGKSEKSGYFYWRIDNFSKVWNEA
IKSNNGKVNSDSFFSQSKGCKMCLRLWKAEEYLCAGFCLIPGPYDNVIEW
PYQMEVFISLIDQTNATEFASCSLKFSCYRTNEAWKKPKSEKNTGLGDKL
IKFETFVHNTNLIKNDKIYIKCMVNNFKDIGMVRTLNTLEQPNKTIGSIR
ILDLYKNFSSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 190..210
NoneNo IPR availableCOILSCoilCoilcoord: 274..301
NoneNo IPR availableCOILSCoilCoilcoord: 225..252
NoneNo IPR availableCOILSCoilCoilcoord: 337..371
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..207
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 114..531
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 11..129
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 3.05872E-7
score: 44.7657
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 16..67
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 336..532
e-value: 3.0E-31
score: 110.5
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 389..535
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..129
e-value: 2.2E-13
score: 52.2
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 114..531
coord: 11..129
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..66
score: 8.904