Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30033685
Length (bp)1783
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30033685) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30033685) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30033685) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30033685) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033685

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033685SMESG000028920.1 Contig739GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033685SMESG000077667.1 Contig739GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30033685SMESG000077667.1 SmedASXL_006567SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30033685SMESG000077667.1 dd_Smed_v4_4598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033685SMESG000077667.1 dd_Smed_v4_4598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033685SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033685SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30033685SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033685SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 75.0998 bits (183), Expect = 1.040e-13
Identity = 29/79 (36.71%), Postives = 56/79 (70.89%), Query Frame = 3
Query: 1032 WQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            W +LP+ + ++K  A  VL++F STY CE +F+ +N I +K R R+ +++ ++CV +KV +Y+P+++ L+S   +++SH
Sbjct:  561 WNALPDCYKNMKTYAFGVLSIFGSTYLCEQIFSNMNYIKSKYRTRLTHESLQSCVKIKVTSYMPDVEKLSSDVRKQKSH 639          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4Y2T1Y1 (Dimer_Tnp_hAT domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_200951_1 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.111e-26
Identity = 61/155 (39.35%), Postives = 103/155 (66.45%), Query Frame = 3
Query:  819 IKFIRYND--KFIPENIFGEFRWISFDDFDSELLELKATLIWRENFVDLRI---MVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +KFI Y D   F   N+  +F W+  ++F+ +L++ +++ IW + F++ R    +++ +   ++I+ N N+++L+ W SLP+ F  LKKLA A+LT+F STY CE LF+++N I    RNR+ +D+S AC+ LKV +Y PNI +L+S   Q++SH
Sbjct:   77 LKFIMYPDVTSFDKLNL-SQFDWLEIEEFEMQLIDFQSSSIWIQKFIETRKELELIETERLTSNISKNANNKILETWNSLPDTFNCLKKLARAILTIFSSTYACESLFSKMNNIKDSLRNRLTDDSSSACILLKVTSYNPNISYLSSNLQQQKSH 230          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4Y2TK76 (Dimer_Tnp_hAT domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_247393_1 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.498e-26
Identity = 55/140 (39.29%), Postives = 96/140 (68.57%), Query Frame = 3
Query:  858 NIFGEFRWISFDDFDSELLELKATLIWRENFVDLRI---MVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            N+F +F W+  ++F+ +L++ +++ IW + F++ R    +++ +   ++I+ N N+++L+ W SLP+ F  LKKLA A+LT+F STY CE LF+++N I    RNR+ +D+S  C+ LKV +Y PNI +L+S   Q++SH
Sbjct:   12 NLF-QFDWLENEEFEMQLIDFQSSSIWIQKFIETRKELELIETERLTSNISKNANNKILETWNSLPDTFNCLKKLARAILTIFSSTYACESLFSEMNNIRDSLRNRLTDDSSSGCILLKVTSYNPNISYLSSNMQQQKSH 150          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4Y2TXK5 (General transcription factor II-I repeat domain-containing protein 2A OS=Araneus ventricosus OX=182803 GN=GTF2IRD2_180 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.684e-26
Identity = 62/155 (40.00%), Postives = 104/155 (67.10%), Query Frame = 3
Query:  819 IKFIRYND--KFIPENIFGEFRWISFDDFDSELLELKATLIWRENFVDLRI---MVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +KFI Y D   F   N+  +F W+  ++F+ +L++ +++ IW + F++ R    +++ +   ++I+ N N+++L+ W SLP+ F  LKKLA A+LT+F STY CE LF+++N I    RNR+ +D+S AC+ LKV +Y PNI++L+S   Q+RSH
Sbjct:  237 LKFIMYPDVTSFDKLNL-SQFDWLEIEEFEMQLIDFQSSSIWIQKFIETRKELELIETERLTSNISKNANNKILESWNSLPDTFNCLKKLARAILTIFSSTYACESLFSEMNNIKDSLRNRLTDDSSSACILLKVTSYNPNINYLSSNLQQQRSH 390          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4Y2P9H0 (General transcription factor II-I repeat domain-containing protein 2A OS=Araneus ventricosus OX=182803 GN=GTF2IRD2_87 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.024e-25
Identity = 62/155 (40.00%), Postives = 104/155 (67.10%), Query Frame = 3
Query:  819 IKFIRYND--KFIPENIFGEFRWISFDDFDSELLELKATLIWRENFVDLRI---MVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +KFI Y D   F   N+  +F W+  ++F+ +L++ +++ IW + F++ R    +++ +   ++I+ N N+++L+ W SLP+ F  LKKLA A+LT+F STY CE LF+++N I    RNR+ +D+S AC+ LKV +Y PNI++L+S   Q+RSH
Sbjct:  232 LKFIMYPDVTSFDKLNL-SQFDWLEIEEFEMQLIDFQSSSIWIQKFIETRKELELIETERLTSNISKNANNKILESWNSLPDTFNCLKKLARAILTIFSSTYACESLFSEMNNIKDSLRNRLTDDSSTACILLKVTSYNPNINYLSSNLQQQRSH 385          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4Y2WWG7 (Dimer_Tnp_hAT domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_41439_1 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.661e-25
Identity = 52/138 (37.68%), Postives = 92/138 (66.67%), Query Frame = 3
Query:  864 FGEFRWISFDDFDSELLELKATLIWRENFVDLRI---MVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
              +F W+  ++F+ +L++ +++ IW + F++ R    +++ +   ++I+ N N+++L+ W SLP+ F  LKKLA A+L +F STY CE LF+++N I     NR+ +D+S AC+ LKV +Y PNI +L+S   Q++SH
Sbjct:   13 LSQFDWLEIEEFEMQLIDFQSSSIWIQKFIETRKELELIETERLTSNISKNANNKILETWNSLPDTFNCLKKLARAILNIFSSTYACESLFSEMNNIKDSLGNRLTDDSSSACILLKVTSYNPNISYLSSNLQQQKSH 150          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053332.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:2353647:2355530:-1 gene:ENSAMXG00000042872.1 transcript:ENSAMXT00000053332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 3.756e-12
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 3
Query:  894 DFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +F +  ++ K++ +W   F +LR                     K  +S P Q      +A+A+L+VF STY CE +F+ +  +L+  R+R+  DNSE+C+ LKV NY P I  L+ +   + SH
Sbjct:  335 EFTNRFVDFKSSPLWVTKFAELR---------------------KQLESTPVQ--QHGSIALALLSVFGSTYLCEQVFSHMKSVLSPIRSRLTTDNSESCLQLKVTNYKPQIRKLSKEKQGQGSH 436          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031692.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:21501471:21504188:-1 gene:ENSAMXG00000043766.1 transcript:ENSAMXT00000031692.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 6.364e-11
Identity = 37/125 (29.60%), Postives = 63/125 (50.40%), Query Frame = 3
Query:  894 DFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +F +  ++ K++ +W   F +LR                     K  +S P Q      +A+A+L+VF STY CE +F+ +  +L+  R+ +  DNSE+C+ LKV NY P I  L+ +   + +H
Sbjct:  300 EFTNRFVDFKSSPLWVTKFAELR---------------------KQLESTPVQ--QHGSIALALLSVFGSTYLCEQVFSHMKSVLSPIRSCLTTDNSESCLQLKVTNYKPQIRKLSKERQGQGTH 401          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000050151.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:23214084:23215952:-1 gene:ENSAMXG00000029603.1 transcript:ENSAMXT00000050151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.297e-9
Identity = 37/139 (26.62%), Postives = 69/139 (49.64%), Query Frame = 3
Query:  858 NIFGEFRWISFDDFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFNMNDEVLKLWQSLPNQ--FLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            ++   F+W +      ++++L+A +  +E F           R    TF         W  + ++  F  LKK+A+ +LT+F STY CE  F+ +N+I TK R+++ N++   C+ + + ++ P    LA Q   + SH
Sbjct:  503 DVTHHFKWANTGPLQMQMIDLQADVALKEQFA----------RTESTTF---------WLQMVSETAFPDLKKVALFILTMFGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTSFKPRFKMLAGQAKAQFSH 622          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054244.1 (SCAN domain-containing protein 3-like [Source:NCBI gene;Acc:111191664])

HSP 1 Score: 60.4622 bits (145), Expect = 3.484e-9
Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 3
Query: 1014 DEVLKLWQSLP--NQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPN 1226
            + V   W  LP   ++ +LK +A+  LT+FPSTY CE  F+ +N I T  RNR+ + N E C+ +KV +  P+
Sbjct:  538 ESVWGFWVGLPCSEEYSNLKTIALYTLTMFPSTYVCESSFSAMNAIKTHERNRLTHKNLENCLRIKVTSISPD 610          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037411.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:18144228:18145385:-1 gene:ENSAMXG00000033115.1 transcript:ENSAMXT00000037411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.694e-7
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 3
Query: 1014 DEVLKLWQSLPNQ-FLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            + ++  + +LPN  + ++KK A+ + T+F STY CE  F+ + ++ T  R+R+ +++   C+ L V    P+I+ L SQ     SH
Sbjct:  300 NSLIDFYAALPNDTYPNIKKHAMKMSTLFGSTYICEQTFSHMKLLKTPMRSRLTDEHLHQCLRLAVTRMEPDIELLPSQMQAHSSH 385          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033718.1 (general transcription factor II-I repeat domain-containing protein 2 [Source:NCBI gene;Acc:110015985])

HSP 1 Score: 72.7886 bits (177), Expect = 4.259e-13
Identity = 29/83 (34.94%), Postives = 55/83 (66.27%), Query Frame = 3
Query: 1020 VLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            V + W ++P+ ++++K+ A  VL +F STY CE +F+ VN I  K R+R+ + +  +C+ +KV +Y P++  L S+  +++SH
Sbjct:  556 VFETWNAIPDSYINMKRYAFGVLEIFGSTYICEQVFSNVNFIKNKHRSRLTHISLRSCLKMKVTSYSPDVKKLCSEVQEQKSH 638          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028910.1 (pep primary_assembly:ASM223467v1:18:2548265:2550717:1 gene:ENSORLG00000029755.1 transcript:ENSORLT00000028910.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.640e-12
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 3
Query:  882 ISFDDFDSELLELKATLIWRENFVDL----------RIMVKNQLRENDIT-FNMNDE-VLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +S  DF+ +  +LKA+ +W   F  L          +  + +Q +  +I      D+ +LK W +LP  F +L+++++AVLT+F STY CE  F+ +  I T  R+R+ + +  AC+ L + +Y P+   ++     ++SH
Sbjct:  505 VSVRDFELQAADLKASDLWVNKFKSLNEDLERLERQKAELASQHKWEEIKKLQPADQLILKTWNALPVTFFTLQRVSVAVLTMFGSTYACEQSFSHLKNIKTNVRSRLTDGSLNACMKLNLTSYQPDYKSISKTMQHQKSH 645          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035623.1 (pep primary_assembly:ASM223467v1:9:5067000:5069708:1 gene:ENSORLG00000026230.1 transcript:ENSORLT00000035623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 3.124e-12
Identity = 41/141 (29.08%), Postives = 76/141 (53.90%), Query Frame = 3
Query:  882 ISFDDFDSELLELKATLIWRENFVDL----------RIMVKNQLRENDIT-FNMNDE-VLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +S  DF+ +  +LKA+ +W   F  L          +  + +Q +  +I      D+ +LK W +LP  F +L+++++AVLT+F STY CE  F+ +  I T  R+R+ + +  AC+ L + +Y P+   ++     ++SH
Sbjct:  532 VSVRDFELQAADLKASDLWVNKFKSLNEDLERLERQKAELASQHKWEEIKKLQPADQLILKTWNALPVTFFTLQRVSVAVLTMFGSTYACEQSFSHLKNIKTNVRSRLTDGSLNACMKLNLTSYQPDYKSISKTMQHQKSH 672          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038486.1 (pep primary_assembly:ASM223467v1:11:14048492:14066451:1 gene:ENSORLG00000022236.1 transcript:ENSORLT00000038486.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 5.065e-11
Identity = 43/165 (26.06%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  807 REYLIKFIRY-NDKFIPENIFGEFRWISFDDFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFN---------MNDE-VLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            R  L KFI + ++  +          +S  DF+ +  +LKA+ +W   F  +   ++   R+     +         + D+ +LK W +LP  F +L+++++AVLT+F STY CE  F+ +  I T  R+ + + +  AC+ L + +Y P+   ++     ++SH
Sbjct:  369 RTRLFKFITHPHECAVNSTDLSYIPGVSVRDFELQAADLKASDLWVNKFKSMNEDLERLERQKAELASQHKWCYEEWLKDQLILKTWNALPVTFFTLQRVSVAVLTMFGSTYACEQSFSHLKNIKTNVRSLLTDGSLNACMKLNLTSYQPDYKSISKTMQHQKSH 533          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000017252.2 (pep primary_assembly:ASM223467v1:13:14820116:14821987:-1 gene:ENSORLG00000013757.2 transcript:ENSORLT00000017252.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.853e-8
Identity = 43/153 (28.10%), Postives = 66/153 (43.14%), Query Frame = 3
Query:  813 YLIKFIRYNDKFIPENIFGEFRWISFDDFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFNMNDEVLKLWQSLP-NQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            +LI+ IR   K + +     F+W        EL +L+A +  R +F                     D      Q +P   F  L K+A+  LT+F STY CE  F+ +N+I TK R+R+ N++    + L +  + P    LA Q     SH
Sbjct:  493 FLIREIRGFSKEVTQT----FKWAHPGSLQLELTDLQADVALRRHF------------------ETTDSATFWLQIVPETMFPGLTKVALHTLTMFGSTYSCETAFSSMNIIKTKYRSRLTNEHLHMSMRLALTPFKPRFKLLAGQLHAHFSH 623          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000077667.1 (SMESG000077667.1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.532e-146
Identity = 213/214 (99.53%), Postives = 214/214 (100.00%), Query Frame = 3
Query:  135 MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVANDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQIKTDNETPNDEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGGETFRGFCKCLVDSN 776
            MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVANDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQIKTDNETP+DEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGGETFRGFCKCLVDSN
Sbjct:    1 MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVANDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQIKTDNETPSDEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGGETFRGFCKCLVDSN 214          

HSP 2 Score: 296.204 bits (757), Expect = 2.974e-95
Identity = 144/150 (96.00%), Postives = 145/150 (96.67%), Query Frame = 2
Query: 1292 FCSLLI*--NYGELMEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGKEDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILKFLRIRNKIFSVDLKIKVIDCDYLIALGAMKKESYEL 1735
            FC  L+   NYGELMEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGKEDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILKFLRIRNKIFSVDLKIKVIDCDYLIALGAMKKESYEL
Sbjct:  206 FCKCLVDSNNYGELMEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGKEDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILKFLRIRNKIFSVDLKIKVIDCDYLIALGAMKKESYEL 355          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000052058.1 (SMESG000052058.1)

HSP 1 Score: 249.595 bits (636), Expect = 6.497e-80
Identity = 122/154 (79.22%), Postives = 135/154 (87.66%), Query Frame = 3
Query:  807 REYLIKFIRYNDKFIPENIFGEFRWISFDDFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRSH 1268
            ++ LIKFIRY DKFIPEN FGEFR + FDDFDSELLEL+A+L WRE FVDLRIMV+NQLREN ITFNM+ E+LKLW+SLPNQF SLK LAIAV+TVFPSTYFCEFLFA +NVILTKTRNR ANDNSEAC ALKV NY+PNIDHLASQF +  S 
Sbjct:    6 KKNLIKFIRYPDKFIPENNFGEFRLLGFDDFDSELLELQASLFWREKFVDLRIMVENQLRENVITFNMDGEILKLWKSLPNQFSSLKNLAIAVITVFPSTYFCEFLFAHMNVILTKTRNRKANDNSEACGALKVTNYIPNIDHLASQFRKNNSR 159          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000052058.1 (SMESG000052058.1)

HSP 1 Score: 212.616 bits (540), Expect = 8.578e-66
Identity = 103/128 (80.47%), Postives = 114/128 (89.06%), Query Frame = 3
Query:  882 ISFDDFDSELLELKATLIWRENFVDLRIMVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFCEFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRS 1265
            + FDDFDSELLEL+A+L WRE FVDLRIMV+NQLREN ITFNM+ E+LKLW+SLPNQF SLK LAIAV+TVFPSTYFCEFLFA +NVILTKTRNR ANDNSEAC ALKV NY+PNIDHLASQF +  S
Sbjct:   26 LGFDDFDSELLELQASLFWREKFVDLRIMVENQLRENVITFNMDGEILKLWKSLPNQFSSLKNLAIAVITVFPSTYFCEFLFAHMNVILTKTRNRKANDNSEACGALKVTNYIPNIDHLASQFRKNNS 153          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000077669.1 (SMESG000077669.1)

HSP 1 Score: 187.963 bits (476), Expect = 5.249e-54
Identity = 100/216 (46.30%), Postives = 140/216 (64.81%), Query Frame = 3
Query:  135 MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVA--NDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQIKTDNETPNDEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGGETFRGFCKCLVDSN 776
            ML E   L ES LPFI+ N LAIDCGI  +KIVF  + +     F ++   N++L + LLEI E F ++   KI++ GFKNL    +VK++F++DA +V+E  A+ NG  L+S N +LSEIE  I NE +    DKYK+D+ NPMF++ I+ MQI T NET + E  I+ P I++L GS +K++L+  D S +L+  S   GET +G  KCLVDSN
Sbjct:    1 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWATTVVKSVFDVDANVVEEISALSNGVQLVSDNFQLSEIE--IKNEESLSLYDKYKIDLKNPMFQKVIQAMQISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSN 214          

HSP 2 Score: 119.398 bits (298), Expect = 2.883e-29
Identity = 66/136 (48.53%), Postives = 92/136 (67.65%), Query Frame = 2
Query: 1313 NYGELMEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGKEDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILKFLRIRNKIFSVDLKIKVIDCDYLIALGAMKK 1720
            N+ E +  A+ G+RE  DTQV+EV+S+N  SPYG+ P  LPIFSFGK ADYNKGKED +P+D+LESL  LF  ET   V  LCK  K K +YFCG +F   +  K L++   +    ++ K+++ +Y++ALG +KK
Sbjct:  215 NFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDLLESLSFLFLIETNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK 350          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000077668.1 (SMESG000077668.1)

HSP 1 Score: 122.094 bits (305), Expect = 3.910e-32
Identity = 70/163 (42.94%), Postives = 102/163 (62.58%), Query Frame = 3
Query:  135 MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVA--NDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQI-KTDNETP 614
            ML E   L ES LPFI+ N LAIDCGI  +KIVF  + +     F ++   N++L + LLEI E F ++   KI++ GFKNL  + +VK++F+ DA +V+E  A+ NG  LIS N +LSEIE KI  E      +KYK++  NP++ +F++ M+   TD+  P
Sbjct:    1 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKI--EEGLHLYEKYKINFANPLWNKFLQAMKFPSTDDANP 161          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR392001.31.040e-1336.71pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2T1Y11.111e-2639.35Dimer_Tnp_hAT domain-containing protein OS=Araneus... [more]
A0A4Y2TK763.498e-2639.29Dimer_Tnp_hAT domain-containing protein OS=Araneus... [more]
A0A4Y2TXK59.684e-2640.00General transcription factor II-I repeat domain-co... [more]
A0A4Y2P9H01.024e-2540.00General transcription factor II-I repeat domain-co... [more]
A0A4Y2WWG71.661e-2537.68Dimer_Tnp_hAT domain-containing protein OS=Araneus... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053332.13.756e-1231.20pep primary_assembly:Astyanax_mexicanus-2.0:1:2353... [more]
ENSAMXT00000031692.16.364e-1129.60pep primary_assembly:Astyanax_mexicanus-2.0:7:2150... [more]
ENSAMXT00000050151.11.297e-926.62pep primary_assembly:Astyanax_mexicanus-2.0:17:232... [more]
ENSAMXT00000054244.13.484e-939.73SCAN domain-containing protein 3-like [Source:NCBI... [more]
ENSAMXT00000037411.11.694e-731.40pep primary_assembly:Astyanax_mexicanus-2.0:13:181... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033718.14.259e-1334.94general transcription factor II-I repeat domain-co... [more]
ENSORLT00000028910.12.640e-1229.08pep primary_assembly:ASM223467v1:18:2548265:255071... [more]
ENSORLT00000035623.13.124e-1229.08pep primary_assembly:ASM223467v1:9:5067000:5069708... [more]
ENSORLT00000038486.15.065e-1126.06pep primary_assembly:ASM223467v1:11:14048492:14066... [more]
ENSORLT00000017252.22.853e-828.10pep primary_assembly:ASM223467v1:13:14820116:14821... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077667.11.532e-14699.53SMESG000077667.1[more]
SMESG000052058.16.497e-8079.22SMESG000052058.1[more]
SMESG000052058.18.578e-6680.47SMESG000052058.1[more]
SMESG000077669.15.249e-5446.30SMESG000077669.1[more]
SMESG000077668.13.910e-3242.94SMESG000077668.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033685 ID=SMED30033685|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1783bp
CCGATCTCTTAAGTGAATTTTTTAAATAATTTCTAAACTACTCGAAAATT
ATTAAAGGTCAATTTTTCGTTGGTCATAGTTCAAAGTGTCTATTTAAATG
AAACATTTTGAGCACATTTTAGTGTTACGCAGTCATGTTGATTGAAGGTG
CAGTTTTATTGGAATCATTTCTCCCATTTATTGATGAGAACAGTTTAGCC
ATTGACTGTGGAATCGTGTTGGCAAAGATTGTGTTTATTTGTCGAACTGA
TAAAGTTTCTTTGCGTTTTTCAACGGTTGCTAATGACAAATTAGATAGTT
TCCTCCTTGAAATTCATGAAGGATTTGATAGACAGACAATTAACAAAATA
TATTTGACTGGATTTAAAAATTTATCTATCAGAAAAATTGTAAAAGCAAT
ATTTAACATCGACGCAATTTTAGTGGATGAAAGTTTTGCGGTCTTCAATG
GATTTGATTTGATATCAAAAAATATGAAATTAAGTGAAATAGAATATAAG
ATTGATAACGAAAGTACAACAGAGAATGTAGATAAATATAAAGTAGATAT
GAATAATCCCATGTTTAAACAATTTATTAAAGGAATGCAAATTAAAACTG
ACAATGAAACTCCTAATGATGAGGATTGTATCAATGTTCCGCATATTTTG
ATTTTGGCGGGTTCAACTATTAAATATTTTCTAGTGAAAAAAGATAAATC
AGTTCAACTGTTAGATTCATCATTTTGTGGAGGAGAAACTTTTCGAGGCT
TCTGTAAATGTCTGGTTGATTCTAACGTGAGACTTTAATTATTTTGTAAA
ATTTTGAGAGAATATTTAATTAAATTTATCCGATATAATGACAAATTTAT
TCCGGAAAATATTTTCGGTGAATTTAGATGGATAAGCTTTGACGATTTTG
ATAGTGAACTGCTAGAACTCAAAGCCACTTTGATTTGGCGCGAAAATTTT
GTCGATTTAAGAATAATGGTCAAAAATCAATTAAGAGAAAATGATATAAC
ATTTAACATGAACGACGAAGTTCTGAAGTTGTGGCAAAGTCTTCCAAATC
AGTTCTTATCATTAAAAAAGCTAGCAATAGCTGTATTAACAGTATTTCCT
TCAACTTACTTTTGCGAATTCTTATTTGCTCAAGTGAATGTAATTTTAAC
CAAAACCAGAAACAGAATGGCTAATGACAATTCCGAGGCTTGTGTTGCTT
TAAAAGTAGCCAATTATTTACCAAATATAGACCACCTAGCGTCGCAATTT
ATACAAAAAAGATCTCATACTGGACAACAGTAGGAAAAATATTCTGTTCC
TTACTAATTTAAAATTATGGTGAACTCATGGAAAAAGCAAACAAGGGCAA
CCGAGAAAATACCGACACTCAAGTATGGGAAGTAATGTCCGACAATGAGA
AATCGCCATATGGAAAATTGCCACAACAGCTTCCTATTTTTTCATTTGGT
AAAAGTGCAGATTACAATAAAGGAAAAGAGGATTTTTCCCCTGATGACAT
ACTGGAGTCTTTATGCAGTTTGTTTTTCAACGAAACGATGATACACGTGA
TTCAATTGTGTAAAACTCATAAATTGAAAACGATTTACTTTTGTGGAGGA
ATGTTTAAAGCTCCCGTTATTTTAAAGTTTCTGCGAATTAGAAATAAAAT
TTTTTCGGTCGACTTGAAGATCAAAGTGATTGACTGTGATTATCTAATTG
CTCTCGGAGCGATGAAAAAAGAGTCCTACGAATTATAATTTCCTGAATTT
TTTACATGAATTTGATAATACATTTAAGATTTC
back to top

protein sequence of SMED30033685-orf-1

>SMED30033685-orf-1 ID=SMED30033685-orf-1|Name=SMED30033685-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVAN
DKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDES
FAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKG
MQIKTDNETPNDEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGG
ETFRGFCKCLVDSNVRL*
back to top

protein sequence of SMED30033685-orf-2

>SMED30033685-orf-2 ID=SMED30033685-orf-2|Name=SMED30033685-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGK
EDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILK
FLRIRNKIFSVDLKIKVIDCDYLIALGAMKKESYEL*
back to top

protein sequence of SMED30033685-orf-3

>SMED30033685-orf-3 ID=SMED30033685-orf-3|Name=SMED30033685-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MVKNQLRENDITFNMNDEVLKLWQSLPNQFLSLKKLAIAVLTVFPSTYFC
EFLFAQVNVILTKTRNRMANDNSEACVALKVANYLPNIDHLASQFIQKRS
HTGQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR008906HATC_C_dom
IPR016020Transl_init_fac_sub12_N_euk
IPR012337RNaseH-like_sf
IPR004567Type_II_PanK
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0043022ribosome binding
GO:0003743translation initiation factor activity
GO:0003676nucleic acid binding
GO:0004594pantothenate kinase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005852eukaryotic translation initiation factor 3 complex
Vocabulary: biological process
TermDefinition
GO:0006446regulation of translational initiation
GO:0015937coenzyme A biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 21..212