Cell division control protein 45-related

Overview
NameCell division control protein 45-related
Smed IDSMED30033683
Length (bp)1808
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell division control protein 45-related (SMED30033683) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell division control protein 45-related (SMED30033683) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell division control protein 45-related (SMED30033683) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell division control protein 45-related (SMED30033683) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033683

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033683SMESG000045786.1 SmedASXL_011414SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033683SMESG000045786.1 SmedASXL_011414SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30033683SMESG000045786.1 dd_Smed_v6_16942_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30033683SMESG000045786.1 dd_Smed_v4_16942_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell division control protein 45-related vs. Ensembl Human
Match: CDC45 (cell division cycle 45 [Source:HGNC Symbol;Acc:HGNC:1739])

HSP 1 Score: 237.269 bits (604), Expect = 9.875e-70
Identity = 169/581 (29.09%), Postives = 307/581 (52.84%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAP-LMQYILPRYILEATYSQRPKL---GKSRKTQSLPLIINAE-SRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D+++ L   E  + + ++ D+ RP++V N YN +Q+K+L  Q+    VP + D+F   +E E       D S  S KRT+L+   +E+ +RRR   EW+++R +I+  YE+Y +HGTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E ++N LS     I+ +   +L L LY+HWSL  ++  T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F    GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   + +GLELAK  +    +   S L T+ V   G FL        SL    P +M +  P  +   +           K+R+ + LPL++ A  S    ++ + GIPP   S   KN FG+ FE +     SR+  + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDE--DTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRH-NHRNEDEENTLSVDCTRISFEY--DLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGM--KDMRVQTFSIHFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYC------SLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS 566          
BLAST of Cell division control protein 45-related vs. Ensembl Human
Match: CDC45 (cell division cycle 45 [Source:HGNC Symbol;Acc:HGNC:1739])

HSP 1 Score: 221.476 bits (563), Expect = 1.258e-63
Identity = 170/613 (27.73%), Postives = 306/613 (49.92%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EW--------------------------------KSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAP-LMQYILPRYILEATYSQRPKL---GKSRKTQSLPLIINAE-SRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D+++ L   E  + + ++ D+ RP++V N YN +Q+K+L  Q+    VP + D+F   +E E       D S  S KRT+L+   +E+ +RRR   EW                                +S R +I+  YE+Y +HGTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E ++N LS     I+ +   +L L LY+HWSL  ++  T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F    GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   + +GLELAK  +    +   S L T+ V   G FL        SL    P +M +  P  +   +           K+R+ + LPL++ A  S    ++ + GIPP   S   KN FG+ FE +     SR+  + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDE--DTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSPRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRH-NHRNEDEENTLSVDCTRISFEY--DLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGM--KDMRVQTFSIHFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYC------SLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS 598          
BLAST of Cell division control protein 45-related vs. Ensembl Human
Match: CDC45 (cell division cycle 45 [Source:HGNC Symbol;Acc:HGNC:1739])

HSP 1 Score: 187.193 bits (474), Expect = 1.215e-51
Identity = 154/580 (26.55%), Postives = 279/580 (48.10%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAP-LMQYILPRYILEATYSQRPKL---GKSRKTQSLPLIINAE-SRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T FL++ +                                               Q+K+L  Q+    VP + D+F   +E E       D S  S KRT+L+   +E+ +RRR   EW+++R +I+  YE+Y +HGTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E ++N LS     I+ +   +L L LY+HWSL  ++  T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F    GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   + +GLELAK  +    +   S L T+ V   G FL        SL    P +M +  P  +   +           K+R+ + LPL++ A  S    ++ + GIPP   S   KN FG+ FE +     SR+  + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKE-----------------------------------------------QIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRH-NHRNEDEENTLSVDCTRISFEY--DLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGM--KDMRVQTFSIHFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYC------SLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS 520          
BLAST of Cell division control protein 45-related vs. Ensembl Human
Match: CDC45 (cell division cycle 45 [Source:HGNC Symbol;Acc:HGNC:1739])

HSP 1 Score: 159.458 bits (402), Expect = 1.401e-42
Identity = 118/407 (28.99%), Postives = 209/407 (51.35%), Query Frame = 1
Query:  556 RRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAP-LMQYILPRYILEATYSQRPKL---GKSRKTQSLPLIINAE-SRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +RREW+++R +I+  YE+Y +HGTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E ++N LS     I+ +   +L L LY+HWSL  ++  T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F    GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   + +GLELAK  +    +   S L T+ V   G FL        SL    P +M +  P  +   +           K+R+ + LPL++ A  S    ++ + GIPP   S   KN FG+ FE +     SR+  + FD   I++   D  K   A+   LS
Sbjct:    5 QRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRH-NHRNEDEENTLSVDCTRISFEY--DLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGM--KDMRVQTFSIHFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYC------SLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS 398          
BLAST of Cell division control protein 45-related vs. Ensembl Human
Match: CDC45 (cell division cycle 45 [Source:HGNC Symbol;Acc:HGNC:1739])

HSP 1 Score: 149.443 bits (376), Expect = 2.481e-39
Identity = 109/413 (26.39%), Postives = 209/413 (50.61%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQ--SAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLS 1260
            +  ++ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T FL++ +                                               Q+K+L  Q+    VP + D+F DE E +E   +D      S KRT+L+   +E+ +RRR   EW+++R +I+  YE+Y +HGTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E ++N LS     I+ +   +L L LY+HWSL  ++  T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F    GF+ +  A D  F   + +  E+PE      D F++A+  LS
Sbjct:    1 MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKE-----------------------------------------------QIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRH-NHRNEDEENTLSVDCTRISFEY--DLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGM--KDMRVQTFSIHFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLS 359          
BLAST of Cell division control protein 45-related vs. Ensembl Celegans
Match: evl-18 (pep chromosome:WBcel235:III:3729493:3735039:-1 gene:WBGene00009372.1 transcript:F34D10.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:evl-18)

HSP 1 Score: 80.8777 bits (198), Expect = 7.959e-16
Identity = 83/399 (20.80%), Postives = 174/399 (43.61%), Query Frame = 1
Query:   49 MVITTELKYEFFDKI--IGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFL-KYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFG--YVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRRE---WKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNM-LDLLQSYLCKLVSER--KESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTP-VTLTNFQLYRISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPE 1209
            M+I    + EF++KI    K ++++ +   D++CT  I+T + +  ++ +S   +   S ++  F     +  + +LINCG+   +   L I  +   + +++DS RP H+ N Y   Q+ +L    +     +P+   V  ++ + +E   +D+  +     +       + I+R E   W+ +R  I+  Y    +  + S + +  +   + + S E +W   +G  S +    I+ E Y  + +D ++ ++ + + +    + K ++L  I      EL L LY HW L  A+  +   ++      +  D  +R  L  +GI   E + KF  +  + R+ +V + +           D    +F    G+  +LSA D    +   L+    E
Sbjct:    1 MIIEDNFRQEFYNKIKKGDKSVVLIVSVDTDALCTTMILTHLLRCDDIPFSILAVEGWSSVEKIFADSQEQKCHYILINCGATRSLTR-LQIPPAS--IAFVIDSHRPFHIENVYENGQIHLLANPSEMSELQIPDLESVIREDSDDEEDSDEDEDQEYISYEQRMEKIRRKAIKREEMQIWERQRRTILWRYYESTWFSSPSCVTLLEMAAEMNRVSAETMWFTAVGLNSAMADKLISIEMYTQICVDRMRPFVHRFMPKNIVNQGKVDDLLHITFGR--ELPLALYSHWDLFSAMMVSEYFSIKTKNWTQKGDVNIRHLLAQLGITLHETKQKFEALPTEQRNLVVDVLEKEM--------DSSFATFFGTLGYCGKLSACDVARAVTLRLEMPKSE 386          
BLAST of Cell division control protein 45-related vs. Ensembl Fly
Match: CDC45L (gene:FBgn0026143 transcript:FBtr0070182)

HSP 1 Score: 217.238 bits (552), Expect = 1.537e-62
Identity = 157/597 (26.30%), Postives = 310/597 (51.93%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKY-GKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKIL---TLQEQFGYVPEFHDVF-------------------AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKI----RRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLD----HENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSL-ILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +   +L+ +F+ +++GK+ILI+    +D++C  +I+  +FK   + Y+   I   + L+  + ++ G +  V+L+NCG   D++E L  + SD+   +I DS RP+ V N Y+  QV IL   +L+E    +P F  +F                    D+  + ES+ +D + +S K ++L+    E++I     RR+W+S+R  IM  Y +++++G S++L+++ L   + +++++LLW AI+G T QLLL  I   +Y   L+ +QS++ +L +  K + +N +S   +   ++L L LYRHW + +++  +  +    +L+ +  +KRL E L+ MG+P       +  +   LR E  S+ +   E+++I+  D+   +F    G+R   +A D  + + A ++    H+ PE      D FL A   LS    + +  G++ AK     +++  +S LE   V   G+F    ++++++ + S P    +L R++L    +      ++R+   LPLI +      + + +L GI P++ D  +N FG+ FE +   +   + QDFF+   +++ + D  +   ++   L+
Sbjct:    1 MFVQDLRNDFYRQLVGKRILIVVNYDIDAICASRILQALFKYDHMLYTVVPIMGVTGLKRAYGEHQGDVKYVVLVNCGGCVDIVELL--QPSDDVTFFICDSHRPLDVCNIYSDRQVCILGDASLEEN---IPAFETIFYDSEGEDEDEDESSDTEQQHDDSGAGESDQEDQAPRSRKLSRLERH--EQRILKQRARRQWESERDRIMFEYTQFSYYGRSAALMVFELAWKLSKDNMDLLWWAIVGITEQLLLGKIESGAYTLELEQIQSHVSRLTN--KTNDQNTMSASKITFENDLHLVLYRHWPVTESMRYSRYSSCQLKLWTLRGEKRLHELLLEMGLPLVHARQTYGAMDLVLRKEFFSMVERLAEKYDIA--DIVYGTFTLSYGYRSRYAAADYVYALLAIMESVKKHKTPE------DCFLEASDALSRQHKQLLSAGIDQAKLLHAAVFRQVQSSLEARQVHSAGSFFYYVLQEEHA-FFSYPYALGLLARFLLRGHVAT----SRARQASDLPLIASCPLNASEGMCLLVGIVPVREDSPRNFFGKAFEQAAQKSGVALLQDFFEPAVVQLRQSDLTRFLDSLTVLLA 575          
BLAST of Cell division control protein 45-related vs. Ensembl Zebrafish
Match: cdc45 (CDC45 cell division cycle 45 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040426-2710])

HSP 1 Score: 209.92 bits (533), Expect = 8.886e-60
Identity = 173/586 (29.52%), Postives = 314/586 (53.58%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQS-------AKRTKLDAAYLEEKIRRREWKSKRAE----IMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISD-KRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDV--KKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDK-SLILYGIPPLK--SDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  T+++ EF+D ++ +++ +L ++ +D++C  K++  +F    V Y+   +    +L T FL++  +    +LINCG+  D++E L  +E  + V +I D+ RP+ V N YN SQ+K+L  Q+    VP + D+F D+ E +E++ DD   +S        KR + D   LE +I R+  + +       I+  YE+Y FHGTS++L+++ L  ++ +++ ++LW +IIG T Q + + I    Y   +  LQ ++ +  + + E ++N+LS     IN +   +L L LY+HWSL +++  +  T  +F+L+ I+  K+L+EFL  MG+P  +   KF+ +   ++  +  + +++  +F +  +D+ + +F    GF+    A D     AA L  EN E  E   D F++A+  LS ++   +  G++LAK  ++ I +   S + T+ +   G FL   +     +    S PL   +L +Y+L+A         ++++ + LPLI+ A    +K ++I+ GIPP    SDK KN FG+ FE +     SR   D FDT  I++   D  K   A+   LS
Sbjct:    1 MFVTDIRKEFYDVVVNQRVALLVSSDIDALCACKVLQALFHCDHVQYTLVPVTGWQDLGTAFLEHKEQYKYFVLINCGANVDLLETLQPEE--DSVFFICDTHRPVDVVNVYNDSQIKLLIKQDDDLGVPSYDDIFRDDEEDEEADGDDSGNESDGSAEPSGKRRRFDEDALERRIERQRARREWEARRREILFDYEQYEFHGTSAALVMFELAWVMSKDTKDMLWWSIIGLTDQWVHDKIPHMKYVTDIATLQRHVSRH-NHKNEDEENSLSIDCMRINFEY--DLRLVLYQHWSLYESICNSCYTSCSFKLWSINGQKKLQEFLADMGLPLKQVRQKFNSMDMTIKENLREVIEESATKFGM--KDIRVQTFGVHFGFKNRFLASDVVHAAAALL--ENVEKDETPTDNFIKALDCLSRSNLERLHLGIDLAKKKLKAIQQTVASCICTNLILSQGPFLYCHLLEGTPDVKLFSKPLSLTLLSKYLLKAFVCST----RNKRCKILPLIMAAPLDIEKGTVIVMGIPPESETSDK-KNFFGRAFEKAAESTSSRTLHDHFDTSVIELKMEDRGKFLDALITLLS 572          
BLAST of Cell division control protein 45-related vs. Ensembl Xenopus
Match: CDC45 (cell division cycle 45 [Source:NCBI gene;Acc:779545])

HSP 1 Score: 201.06 bits (510), Expect = 1.858e-56
Identity = 169/584 (28.94%), Postives = 307/584 (52.57%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSA----KRTKLDAAYLEEK----IRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQV-------DVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++L+ EF+D I+ +++L+L A  VD++C  K++  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D++E L  +E    + YI D+ RPI V N YN SQ+K+L  Q+    +P + D+F D+ + ++ +   +    A    KR + D  Y+       + RRE       I+  YE+Y +HGTSS+++++ L  ++ ++S ++LW AI+G T Q + + I +  Y   +  LQ ++ +  + R E ++N+LS   ++   E  L L LY+HWSL +++  +  T  + +L+ +   K+L+EFL  MG+P  + + KF+ +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F + + L  EN E  E+  D F++A+  LS ++   +  GLE+AK  +  I +   S + T+ +   G FL         DVK   +  +S  L+   L +  + +T ++R KL            ++AE  T   +I+ GIPP  +S   KN FG+ FE +     SR   + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDLRKEFYDVIVTERVLLLVAPDVDALCACKVLQALFQCDHVQYTLVPVSGWQELETLFLEHKEQFRYFVLINCGANIDLLETLQPQEE--AIFYICDTHRPIDVVNIYNDSQIKLLIRQDDDLEIPAYDDIFNDDEDEEDGDDSGNESDGAEPSGKRRRFDEVYVCNVCLLFLCRRE-------ILFDYEQYEYHGTSSAMMMFELAWIMSKDSNDMLWWAIVGLTDQWVQDRITQMKYVTDVGTLQRHVSRH-NHRNEDEENSLSIDCMRIAFEYDLRLSLYQHWSLYESICNSCYTSASLKLWSVQGQKKLQEFLADMGMPLKQVKQKFNSMDISLKENLREMLEESANKFGM--KDVRVQTFSVQFGFKNKFLASDIVFAVLSLL--ENIERDEKGTDNFIKALDSLSRSNLDKLHTGLEMAKKLLRAIQQTVASCICTNLILSQGPFLYCYLMEGTPDVKMFANP-ISLCLLCKYLLKSFVCSTKNKRCKLLPLVLAAP----LDAEKGT---VIMVGIPPEAESSDKKNFFGRAFEKAAESTSSRTLHNHFDMSIIELRTEDRSKFLDALISLLS 562          
BLAST of Cell division control protein 45-related vs. Ensembl Xenopus
Match: CDC45 (cell division cycle 45 [Source:NCBI gene;Acc:779545])

HSP 1 Score: 198.364 bits (503), Expect = 2.622e-55
Identity = 170/584 (29.11%), Postives = 310/584 (53.08%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSA----KRTKLDAAYLEEKIRRREWKSKRAE----IMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFL-------QVDVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++L+ EF+D I+ +++L+L A  VD++C  K++  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D++E L  +E    + YI D+ RPI V N YN SQ+K+L  Q+    +P + D+F D+ + ++ +   +    A    KR + D A +E +I RR  + +       I+  YE+Y +HGTSS+++++ L  ++ ++S ++LW AI+G T Q + + I +  Y   +  LQ ++ +  + R E ++N+LS   ++   E  L L LY+HWSL +++  +  T  + +L+ +   K+L+EFL  MG+P  + + KF+ +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F + + L  EN E  E+  D F++A+  LS ++   +  GLE+AK  +  I +   S + T+ +   G FL         DVK   +  +S  L+   L +  + +T ++R KL            ++AE  T   +I+ GIPP  +S   KN FG+ FE +     SR   + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDLRKEFYDVIVTERVLLLVAPDVDALCACKVLQALFQCDHVQYTLVPVSGWQELETLFLEHKEQFRYFVLINCGANIDLLETLQPQEE--AIFYICDTHRPIDVVNIYNDSQIKLLIRQDDDLEIPAYDDIFNDDEDEEDGDDSGNESDGAEPSGKRRRFDEAAVERRIERRRQRREWEARRREILFDYEQYEYHGTSSAMMMFELAWIMSKDSNDMLWWAIVGLTDQWVQDRITQMKYVTDVGTLQRHVSRH-NHRNEDEENSLSIDCMRIAFEYDLRLSLYQHWSLYESICNSCYTSASLKLWSVQGQKKLQEFLADMGMPLKQVKQKFNSMDISLKENLREMLEESANKFGM--KDVRVQTFSVQFGFKNKFLASDIVFAVLSLL--ENIERDEKGTDNFIKALDSLSRSNLDKLHTGLEMAKKLLRAIQQTVASCICTNLILSQGPFLYCYLMEGTPDVKMFANP-ISLCLLCKYLLKSFVCSTKNKRCKLLPLVLAAP----LDAEKGT---VIMVGIPPEAESSDKKNFFGRAFEKAAESTSSRTLHNHFDMSIIELRTEDRSKFLDALISLLS 569          
BLAST of Cell division control protein 45-related vs. Ensembl Xenopus
Match: CDC45 (cell division cycle 45 [Source:NCBI gene;Acc:779545])

HSP 1 Score: 184.882 bits (468), Expect = 1.216e-50
Identity = 164/577 (28.42%), Postives = 299/577 (51.82%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSA----KRTKLDAAY----LEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++L+ EF+D I+ +++L+L A  VD++C  K++  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D++E L  +E    + YI D+ RPI V N YN SQ+K+L  Q+    +P + D+F D+ + ++ +   +    A    KR + D  Y    L    RR        EI+  YE+Y +HGTSS+++++ L  ++ ++S ++LW AI+G T Q + + I +  Y   +  LQ ++ +  + R E ++N+LS   ++   E  L L LY+HWSL +++  +  T  + +L+ +   K+L+EFL  MG+P  + + KF+ +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F + + L  EN E  E+  D F++A+   S++   T+ Y + +    +  +    RS+  T   T        DVK   +  +S  L+   L +  + +T ++R KL            ++AE  T   +I+ GIPP  +S   KN FG+ FE +     SR   + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDLRKEFYDVIVTERVLLLVAPDVDALCACKVLQALFQCDHVQYTLVPVSGWQELETLFLEHKEQFRYFVLINCGANIDLLETLQPQE--EAIFYICDTHRPIDVVNIYNDSQIKLLIRQDDDLEIPAYDDIFNDDEDEEDGDDSGNESDGAEPSGKRRRFDEVYAFSCLLFLCRR--------EILFDYEQYEYHGTSSAMMMFELAWIMSKDSNDMLWWAIVGLTDQWVQDRITQMKYVTDVGTLQRHVSRH-NHRNEDEENSLSIDCMRIAFEYDLRLSLYQHWSLYESICNSCYTSASLKLWSVQGQKKLQEFLADMGMPLKQVKQKFNSMDISLKENLREMLEESANKFGM--KDVRVQTFSVQFGFKNKFLASDIVFAVLSLL--ENIERDEKGTDNFIKALD--SLSRLVTLLYPILVFLRQMALVVSQMRSLTGTGSGT-------PDVKMFANP-ISLCLLCKYLLKSFVCSTKNKRCKLLPLVLAAP----LDAEKGT---VIMVGIPPEAESSDKKNFFGRAFEKAAESTSSRTLHNHFDMSIIELRTEDRSKFLDALISLLS 545          
BLAST of Cell division control protein 45-related vs. Ensembl Xenopus
Match: CDC45 (cell division cycle 45 [Source:NCBI gene;Acc:779545])

HSP 1 Score: 185.267 bits (469), Expect = 1.249e-50
Identity = 166/582 (28.52%), Postives = 304/582 (52.23%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSA----KRTKLDAAY--LEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQV-------DVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++L+ EF+D I+ +++L+L A  VD++C  K++  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D++E L  +E    + YI D+ RPI V N YN SQ+K+L  Q+    +P + D+F D+ + ++ +   +    A    KR + D A+  L    RR        EI+  YE+Y +HGTSS+++++ L  ++ ++S ++L C  + + + + L  + R  Y   +  LQ ++ +  + R E ++N+LS   ++   E  L L LY+HWSL +++  +  T  + +L+ +   K+L+EFL  MG+P  + + KF+ +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F + + L  EN E  E+  D F++A+  LS ++   +  GLE+AK  +  I +   S + T+ +   G FL         DVK   +  +S  L+   L +  + +T ++R KL            ++AE  T   +I+ GIPP  +S   KN FG+ FE +     SR   + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDLRKEFYDVIVTERVLLLVAPDVDALCACKVLQALFQCDHVQYTLVPVSGWQELETLFLEHKEQFRYFVLINCGANIDLLETLQPQEE--AIFYICDTHRPIDVVNIYNDSQIKLLIRQDDDLEIPAYDDIFNDDEDEEDGDDSGNESDGAEPSGKRRRFDEAFSCLLFLCRR--------EILFDYEQYEYHGTSSAMMMFELAWIMSKDSNDML-CVFL-YLNYITLTILPRMKYVTDVGTLQRHVSRH-NHRNEDEENSLSIDCMRIAFEYDLRLSLYQHWSLYESICNSCYTSASLKLWSVQGQKKLQEFLADMGMPLKQVKQKFNSMDISLKENLREMLEESANKFGM--KDVRVQTFSVQFGFKNKFLASDIVFAVLSLL--ENIERDEKGTDNFIKALDSLSRSNLDKLHTGLEMAKKLLRAIQQTVASCICTNLILSQGPFLYCYLMEGTPDVKMFANP-ISLCLLCKYLLKSFVCSTKNKRCKLLPLVLAAP----LDAEKGT---VIMVGIPPEAESSDKKNFFGRAFEKAAESTSSRTLHNHFDMSIIELRTEDRSKFLDALISLLS 557          
BLAST of Cell division control protein 45-related vs. Ensembl Xenopus
Match: CDC45 (cell division cycle 45 [Source:NCBI gene;Acc:779545])

HSP 1 Score: 174.096 bits (440), Expect = 5.278e-47
Identity = 153/576 (26.56%), Postives = 283/576 (49.13%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSA----KRTKLDAAYLEEK----IRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++L+ EF+D I+ +++L+L A  VD++C  K++  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D++E L  +E    + YI D+ RPI V N YN SQ+K+L  Q+    +P + D+F D+ + ++ +   +    A    KR + D  Y+       + RR       EI+  YE+Y +HGTSS+++++ L  ++ ++S ++L C  + + + + L  + R  Y   +  LQ ++ +  + R E ++N+LS   ++   E  L L LY+HWSL +++  +  T  + +L+ +   K+L+EFL  MG+P  + + KF+ +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F + + L  EN E  E+  D F++A+  LS ++   +  GLE+AK  +  I +   S + T+ +   G FL                       Y++E + S                                 P  +SDK KN FG+ FE +     SR   + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDLRKEFYDVIVTERVLLLVAPDVDALCACKVLQALFQCDHVQYTLVPVSGWQELETLFLEHKEQFRYFVLINCGANIDLLETLQPQEE--AIFYICDTHRPIDVVNIYNDSQIKLLIRQDDDLEIPAYDDIFNDDEDEEDGDDSGNESDGAEPSGKRRRFDEVYVCNVCLLFLCRR-------EILFDYEQYEYHGTSSAMMMFELAWIMSKDSNDML-CVFL-YLNYITLTILPRMKYVTDVGTLQRHVSR-HNHRNEDEENSLSIDCMRIAFEYDLRLSLYQHWSLYESICNSCYTSASLKLWSVQGQKKLQEFLADMGMPLKQVKQKFNSMDISLKENLREMLEESANKFGM--KDVRVQTFSVQFGFKNKFLASDIVFAVLSLL--ENIERDEKGTDNFIKALDSLSRSNLDKLHTGLEMAKKLLRAIQQTVASCICTNLILSQGPFLYC---------------------YLMEKSLSA--------------------------------PSHRSDK-KNFFGRAFEKAAESTSSRTLHNHFDMSIIELRTEDRSKFLDALISLLS 506          
BLAST of Cell division control protein 45-related vs. Ensembl Mouse
Match: Cdc45 (cell division cycle 45 [Source:MGI Symbol;Acc:MGI:1338073])

HSP 1 Score: 236.113 bits (601), Expect = 1.915e-69
Identity = 168/580 (28.97%), Postives = 312/580 (53.79%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN---SLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLI-LYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  T+ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T +L++  + S  +LINCG+  D+++ L   E  + + ++ D+ RP++V N YN +Q+K+L  QE    VP + D+F    E E       D S  S KRT+L+   +E   +RR   EW+++R +I+  YE+Y ++GTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E+++N LS     I+ +   +L L LY+HWSL +++Y T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   +  GLELAK +++   +   S L T+ VT  G FL   + +     +L+     +  +    +    YS      K+R+ + LPL++ A    ++  + + GIPP   S   KN FG+ FE +     SR   ++FD   I++   D  K   A+   LS
Sbjct:    1 MFVTDFRKEFYETVHNQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAYLEHKEQFSYFILINCGANVDLLDILQPDE--DSIFFVCDTHRPVNVVNVYNDTQIKLLIKQEDDLEVPAYDDIFRDEAEDEDLSDSDGDGSEPSEKRTRLEEEIVERNRKRRQRREWEARRKDILFDYEQYEYYGTSSAMVMFDLAWMMSKDLNDMLWWAIVGLTDQWVHDKITQMKYVTDVGILQRHVSRH-NHRNEAEENMLSVDCTRISFEY--DLCLVLYQHWSLHESLYNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQSMDVSLKGNLREMIEESANKFGM--KDMRVQTFSIQFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYLGLELAKKHLQATQQTIASCLCTNLVTSQGPFLYCSLMEGTPDVTLFSKPASLSLLSRHLLKSFVYST-----KNRRCKLLPLVMAAPLSVEQGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRTLHNYFDLSVIELKAEDRSKFLDALVSLLS 566          
BLAST of Cell division control protein 45-related vs. Ensembl Mouse
Match: Cdc45 (cell division cycle 45 [Source:MGI Symbol;Acc:MGI:1338073])

HSP 1 Score: 184.496 bits (467), Expect = 7.024e-51
Identity = 149/577 (25.82%), Postives = 287/577 (49.74%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN---SLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLI-LYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  T+ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T +L++ +   +L               IK+ D       D + P + + F + ++ + L+  +  G  P                       S KRT+L+   +E   +RR   EW+++R +I+  YE+Y ++GTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E+++N LS     I+ +   +L L LY+HWSL +++Y T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   +  GLELAK +++   +   S L T+ VT  G FL   + +     +L+     +  +    +    YS      K+R+ + LPL++ A    ++  + + GIPP   S   KN FG+ FE +     SR   ++FD   I++   D  K   A+   LS
Sbjct:    1 MFVTDFRKEFYETVHNQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAYLEHKEQIKLL---------------IKQED-------DLEVPAYDDIFRDEAEDEDLSDSDGDGSEP-----------------------SEKRTRLEEEIVERNRKRRQRREWEARRKDILFDYEQYEYYGTSSAMVMFDLAWMMSKDLNDMLWWAIVGLTDQWVHDKITQMKYVTDVGILQRHVSRH-NHRNEAEENMLSVDCTRISFEY--DLCLVLYQHWSLHESLYNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQSMDVSLKGNLREMIEESANKFGM--KDMRVQTFSIQFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYLGLELAKKHLQATQQTIASCLCTNLVTSQGPFLYCSLMEGTPDVTLFSKPASLSLLSRHLLKSFVYST-----KNRRCKLLPLVMAAPLSVEQGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRTLHNYFDLSVIELKAEDRSKFLDALVSLLS 520          
BLAST of Cell division control protein 45-related vs. Ensembl Mouse
Match: Cdc45 (cell division cycle 45 [Source:MGI Symbol;Acc:MGI:1338073])

HSP 1 Score: 86.6557 bits (213), Expect = 1.053e-19
Identity = 42/136 (30.88%), Postives = 83/136 (61.03%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF 456
            +  T+ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T +L++  + S  +LINCG+  D+++ L   E  + + ++ D+ RP++V N YN +Q+K+L  QE    VP + D+F
Sbjct:    1 MFVTDFRKEFYETVHNQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAYLEHKEQFSYFILINCGANVDLLDILQPDE--DSIFFVCDTHRPVNVVNVYNDTQIKLLIKQEDDLEVPAYDDIF 134          
BLAST of Cell division control protein 45-related vs. UniProt/SwissProt
Match: sp|O75419|CDC45_HUMAN (Cell division control protein 45 homolog OS=Homo sapiens OX=9606 GN=CDC45 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 4.742e-69
Identity = 169/581 (29.09%), Postives = 307/581 (52.84%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAP-LMQYILPRYILEATYSQRPKL---GKSRKTQSLPLIINAE-SRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D+++ L   E  + + ++ D+ RP++V N YN +Q+K+L  Q+    VP + D+F   +E E       D S  S KRT+L+   +E+ +RRR   EW+++R +I+  YE+Y +HGTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E ++N LS     I+ +   +L L LY+HWSL  ++  T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F    GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   + +GLELAK  +    +   S L T+ V   G FL        SL    P +M +  P  +   +           K+R+ + LPL++ A  S    ++ + GIPP   S   KN FG+ FE +     SR+  + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDE--DTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRH-NHRNEDEENTLSVDCTRISFEY--DLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGM--KDMRVQTFSIHFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYC------SLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS 566          
BLAST of Cell division control protein 45-related vs. UniProt/SwissProt
Match: sp|Q9Z1X9|CDC45_MOUSE (Cell division control protein 45 homolog OS=Mus musculus OX=10090 GN=Cdc45 PE=1 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 1.340e-68
Identity = 168/580 (28.97%), Postives = 312/580 (53.79%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRR---EWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLS----EINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN---SLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLI-LYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  T+ + EF++ +  +++L+  A+ VD++C  KI+  +F+   V Y+   ++   EL+T +L++  + S  +LINCG+  D+++ L   E  + + ++ D+ RP++V N YN +Q+K+L  QE    VP + D+F    E E       D S  S KRT+L+   +E   +RR   EW+++R +I+  YE+Y ++GTSS+++++ L  ++ ++  ++LW AI+G T Q + + I +  Y   + +LQ ++ +  + R E+++N LS     I+ +   +L L LY+HWSL +++Y T  T   F+L+ +   KRL+EFL  MG+P  + + KF  +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F   + +  E+PE      D F++A+  LS ++   +  GLELAK +++   +   S L T+ VT  G FL   + +     +L+     +  +    +    YS      K+R+ + LPL++ A    ++  + + GIPP   S   KN FG+ FE +     SR   ++FD   I++   D  K   A+   LS
Sbjct:    1 MFVTDFRKEFYETVHNQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAYLEHKEQFSYFILINCGANVDLLDILQPDE--DSIFFVCDTHRPVNVVNVYNDTQIKLLIKQEDDLEVPAYDDIFRDEAEDEDLSDSDGDGSEPSEKRTRLEEEIVERNRKRRQRREWEARRKDILFDYEQYEYYGTSSAMVMFDLAWMMSKDLNDMLWWAIVGLTDQWVHDKITQMKYVTDVGILQRHVSRH-NHRNEAEENMLSVDCTRISFEY--DLCLVLYQHWSLHESLYNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQSMDVSLKGNLREMIEESANKFGM--KDMRVQTFSIQFGFKHKFLASDVVFATMSLM--ESPEKDGSGTDHFIQALDSLSRSNLDKLYLGLELAKKHLQATQQTIASCLCTNLVTSQGPFLYCSLMEGTPDVTLFSKPASLSLLSRHLLKSFVYST-----KNRRCKLLPLVMAAPLSVEQGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRTLHNYFDLSVIELKAEDRSKFLDALVSLLS 566          
BLAST of Cell division control protein 45-related vs. UniProt/SwissProt
Match: sp|Q9YHZ6|CDC45_XENLA (Cell division control protein 45 homolog OS=Xenopus laevis OX=8355 GN=cdc45 PE=1 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 1.534e-57
Identity = 174/582 (29.90%), Postives = 307/582 (52.75%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFA--XXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAE----IMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRI-SDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFL-------QVDVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP-LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  ++L+ EFFD I+ +++L+L A  VD++C  KI+  +F+   V Y+   ++   EL+T FL++  +    +LINCG+  D++E L  +E    + YI D+ RPI V N YN SQVK+L  Q+    +P + D+F   +E   D     D +  S KR + D A +E +I RR  + +       I+  YE+Y +HGTSS+++++ L  ++ ++S ++LW AI+G T Q + + I +  Y   +  LQ ++ +  + R E ++N+LS   ++   E  L L LY+HWSL +++  +  T    +L+ +   K+L+EFL  MG+P  + + KF+ +   L+  +  + +++  +F +  +D+ + +F  + GF+ +  A D  F + + L  EN E  E+  D F++A+  LS ++   +  GLE+ K  +  I +   S + T+ +   G FL         DVK  ++  +S  L+   L +  + +T ++R KL            ++AE  T   +I+ GIPP  +S   KN FG+ FE +     SR   + FD   I++   D  K   A+   LS
Sbjct:    1 MFVSDLRKEFFDVIVTERVLLLVAPDVDALCACKILQALFQCDHVQYTLVPVSGWQELETLFLEHKEQFRYFVLINCGANIDLLETLQPQEE--AIFYICDTHRPIDVVNIYNDSQVKLLIRQDDDLEIPAYDDIFNDDEEDGEDSGNESDGAEPSGKRRRFDEAAVERRIERRRQRREWEARRREIIFDYEQYEYHGTSSAMMMFELAWIMSKDSNDMLWWAIVGLTDQWVQDRITQMKYVTDVGTLQRHVSRH-NHRNEDEENSLSIDCMRIAFEYDLRLSLYQHWSLYESICNSCYTSATLKLWSLQGQKKLQEFLADMGMPLKQVKQKFNSMDISLKENLREMLEESANKFGM--KDVRVQTFSVQFGFKNKFLASDIVFAVLSLL--ENTERDEKGTDNFIKALDSLSRSNLDKLHTGLEMGKKLLCAIQQTVASCICTNLILSQGPFLYCYLMEGTPDVKMFSNP-ISLCLLCKYLLKSFVCSTKNKRCKLLPLVLAAP----LDAEKGT---VIMVGIPPEAESSDKKNFFGRAFEKAAESTSSRTLHNHFDMSIIELRTEDRSKFLDALISLLS 567          
BLAST of Cell division control protein 45-related vs. UniProt/SwissProt
Match: sp|O74113|CDC45_SCHPO (Cell division control protein 45 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sna41 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.188e-20
Identity = 135/617 (21.88%), Postives = 263/617 (42.63%), Query Frame = 1
Query:   97 GKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQT---TFLKYGK-ISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLD----------AAYLEEKIRRR---EWKSKRAEIM--------------DIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHT-----SQLLLNFINRESYCNMLD----LLQSYLCKLVSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLY-RISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHEN-------------PEI-KEEFCDKFLRAVK----------FLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWL-SAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP----------LKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIF 1719
            G  + +  A   D++C  K+++ + K   +S+    ++   +L+    T L+  + I  ++L+NCG+  D+  +L   E  +  IY++DS RP ++NN Y  + + +    +    + + HD +      + S+ ++    + +  +++          ++  + + RRR   E   +RAEI               + YE+ +++G S + I++++ +++ +E  ++LW AI+G T      Q    + NR SY  + D    L  S L   +  R   K  +   I L+  DE    L RHWSL  ++  +    +   ++     KRL + L  MG+   E +  +  +  DL+  + S  K     + +  +D+   SF    GF+  LSA D ++ I+A L+  N             P++ +EE+ +KF  A            + +++D  +++  L+LA      I +   ++LE   +    +F    + +   L +   PL    +  +I EA   Q  + GK R    LPL++ A        ++ G                    N FG  F++      + +Q D F+   I+  + D L +F
Sbjct:   23 GCTVQLFVALDPDALCACKLLSTLLKGDFISHKIRPVSGYRDLEQANKTLLEQNEDIKFIILLNCGTMVDLNNYLVSME--DVSIYVIDSHRPHNLNNIYIENNIFVFDDGDIEEDMNKIHDAWYAFNSHELSDEENSDSSNEREEEVEDDNRSVESYSSSDYQARSRRRFSEETTQRRAEIKEKRKKRKEFASILSEYYEKGSWYGESITNILFAVASMLGREDNDMLWLAIVGLTCLEIHCQSSKKYFNR-SYSLLKDEVNRLNPSPLENQIVGRAHGKTPHDQSIRLE--DEFRFMLVRHWSLYDSMLHSAYVGSRLHIWSEEGRKRLHKLLAKMGLSLVECKQTYIHMNMDLKKTLKSSLKRFAPFYGL--DDVIFHSFTRTYGFKCTLSASDVSYAISALLEMGNTGVLLQSKTVARSPDMTEEEYLEKFENAQNQEWLHNFYDAYDALDDVDSLERALKLAMHLQRAIVRTGITLLEKRAIKTLRSFRFGLINEGPDLKIFMHPLALTKMSLWIAEAINEQEREFGKLRH---LPLVLAAFVEEKNRYLIVGTSTSAFTSNEDDDDDDGHGHNRFGVAFQEVANMTSATLQMDCFEASVIECQKSD-LGVF 628          
BLAST of Cell division control protein 45-related vs. UniProt/SwissProt
Match: sp|Q55GA4|CDC45_DICDI (Cell division control protein 45 homolog OS=Dictyostelium discoideum OX=44689 GN=cdc45 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 8.173e-17
Identity = 86/406 (21.18%), Postives = 178/406 (43.84%), Query Frame = 1
Query:  613 AFHGTSSSLIIYSLCTLIYQESLE-LLWCAIIGHTSQLLLNFINRESYCNMLD-----LLQSYLCKLVSERKESKKNNLSEINLQS--------------------TDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISDK-RLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCD----KFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSL-WLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPPLKS-DKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIR 1731
             ++G S+++ +YSL T + +++L+ LLW A++G T Q +   I  +SY          +L +Y      +++E  +    E +                       +D+    LYRHW+L ++++ +       ++++   + +L      MGIP  + + K++ +    + ++  L   N  +F +   +L+  SF+ K     E+SA D  + + A ++ +N E  +   D     F  A   +S  +   +  GL+ +    + I +   S++E   V + G F    + + + L +   PL    L  ++++A  S    +GK+++    P +I A +    S ++ GI    S D   N FG+ F  S     +  +   FDT  +++++ D  K  + + 
Sbjct:  239 TYYGKSAAVSMYSLSTFLNKQNLDDLLWYAVLGLTDQFIHEKITLDSYEQQYKNFKELILNNYPTDGDDDQEERYRPGNDEDDYDENGDLKRHPSSMFLHGDKIIPSDDFRFMLYRHWNLYESLFNSRYVACKLRVWKAKGRFQLESLFAMMGIPLDQVKQKYNSMNVHYKKQLKQLLAINGPKFGLV--NLYFNSFLKKYSNNSEISASDTVYAVTALMESDNLESDQSDQDIWEQNFWEAYDSISNKNIDLLKIGLKQSIQLQKEITRQVTSMIEKRSVILSGPFRYAFITESSDLKYFIHPLALTKLGLFMMDAFIS----MGKAKR----PFLIGALNENKNSYLIVGISGSHSTDIQSNTFGEYFRKSAEYTDATFKYQSFDTSIVEVSKTDLHKFVEHLH 634          

HSP 2 Score: 72.4034 bits (176), Expect = 5.754e-12
Identity = 45/130 (34.62%), Postives = 75/130 (57.69%), Query Frame = 1
Query:   49 MVITTELKY-EFFD-----KIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQ---TTFLKYGKISNVLLINCGSQFDVIE-FLNIKESDNRVIYILDSQRPIHVNNFYNASQVKIL 408
            MV+TT+ K+ E +D      + G+ +LIL A   DS+   KI+T I K   ++Y+   ++   +L+   +T L+  +I ++++INCG   D+   F N+  +D +V YI+DS RP  +NN  N S V I+
Sbjct:    1 MVLTTDTKFSEIYDIIKGDSVQGESVLILVARDCDSIAACKILTEILKSDLIAYNIKAVSGYEDLENVNSTLLENEEIKSIIMINCGGNIDITNVFTNL--NDQQVAYIIDSHRPYSINNITNESSVLII 128          
BLAST of Cell division control protein 45-related vs. TrEMBL
Match: A0A4S2LGK5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007429 PE=4 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 2.700e-113
Identity = 205/581 (35.28%), Postives = 339/581 (58.35%), Query Frame = 1
Query:   49 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKI-SNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQST--------DELALWLYRHWSLKQAVYCTPVTLTNFQLY-RISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLD---HENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN--SLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTD-KSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            MVI  + + EF+ +++GK++L+     +D +C ++I+  +F   EV Y+  +++ K EL   + K      ++ L+NCG+ FDV+E L    +   + YI DS RPIH+NNFYN  Q+K++ L E    VP+F DVF      +ES  D +  +  KR +  A  +E++I RR+W  +R +I+  YE +++H  SS+++++ L   + QE+  LLW AI+G TSQLL N INRE Y + LD LQS++ +L      ++ N  S +  +          DELALWLY+HWSLK+ +  + VT + F+L+     K+++EFLV++G+P  E   ++S +   +R  + SLF    E++ +S+ DLFLPSF  + G+R  +SAIDA F+  + L+     +P +       F RA+  LS     ++D  +  A+ +++++    R++++T ++   G FL   ++K +  S+ L   L   IL +Y+L A  + RPKLG+ R+   +PLI   +SR D +++ L GIPPL  D  +N FGQ FE ++   K+R +  +FDT  I+++  D LK+F+A+   LS
Sbjct:    1 MVIVRDARSEFYHEVVGKRVLVFVLPDIDGLCAWRILKELFVSREVLYTLLVVSDKRELCNLYTKNKDAYHDIFLLNCGANFDVLEVLGPDTTT--IFYICDSHRPIHINNFYNQRQIKLICLNEDTSDVPKFEDVFQQFSTDEESAGDSEE-EEGKRRRAGAEAIEKRIERRKWARRRQDILLDYESFSYHTVSSAVVLFDLTWRLSQETNCLLWYAIVGQTSQLLTNLINREHYVDQLDYLQSHVSRL--GHAGNRANTASSVTEEGKAKVEIVLEDELALWLYKHWSLKETLETSMVTASKFKLFTEGGQKKMQEFLVHIGLPRRECLQRYSTMTSTVRESLNSLFLQYGEKYGLSRRDLFLPSFTVQLGYRTPVSAIDAVFLTLSALECHGDGDPSV------NFQRALDTLSCWSLPSLDNEITRAQAHLQSLASQVRNLIDTDEIVAFGPFLYAYLRKSSLLSIALRNTLSLSILSKYVLMAKAALRPKLGRDRRVVQMPLIFCIDSRADEENITLIGIPPLHGDDDRNLFGQAFEAAVRRTKARAEFRYFDTNCIELHREDMLKLFEALASLLS 570          
BLAST of Cell division control protein 45-related vs. TrEMBL
Match: G4VBH0 (Cell division control protein 45-related OS=Schistosoma mansoni OX=6183 GN=Smp_047610 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 7.888e-109
Identity = 202/580 (34.83%), Postives = 336/580 (57.93%), Query Frame = 1
Query:   49 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNV-LLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKL-----VSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLY-RISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFL---DHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQ----NSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLI-LYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            MVI  +++ EF+ +++G ++L+     VD +CT++++  +FK   V Y+  I+  K +L+ T+ K      V + INCG+ FDV+   N+   +  + Y+ DS RPIH+NNFYN  Q+K+L L E    VP+F DVF     S +   +D   Q  +R + D   +E++I +R+W  KR E++  YE +++H  +SS++++ L   + QE+  LLW AI+G TSQL+ + INRE Y + LD LQS++ +L     +     +   N + + +   DELALWLYRHWSLK+A+  + VT + F+L+     +R+ EFLV +G+P  E    +S +   LR  +   F    E++ +S+ DLFLPSF+   G+R  +SA+DA F+  + L   ++ NP       + F  A+  ++  +S ++D  ++  + +++++    R++L+T DV   G FL V ++K     ++L  S  L   IL +YIL A  S R KLG  R+   +PLI+  +S++D + I L GIPP+  D  +N FGQ FE ++   K+R +  +F T  I+++  D LK+F+A+   L+
Sbjct:    1 MVILRDIRSEFYGEVVGNRVLVCVYPDVDGLCTWRVLKELFKHRNVLYTLVIVKDKGDLKDTYSKNRDFFQVAVFINCGANFDVVG--NLDPQEECIFYVCDSHRPIHINNFYNQRQIKLLCLNEDTTLVPKFEDVF--REFSSDESDEDSEEQQNRRLQPDD--IEKRIEKRKWNRKRQELLMDYESFSYHSVASSVVMFDLAWKLSQENNCLLWYAIVGQTSQLITHAINREHYIDQLDYLQSHMSRLSHIGQIHSGTSTSDENKARVEILFEDELALWLYRHWSLKEAMETSMVTASKFKLFTEGGQRRMYEFLVQLGLPRRECAQLYSSMNSSLRDSLNEQFLQYGEKYGLSRTDLFLPSFIVHLGYRTPMSAVDAVFLTISALECYNNGNP------VENFQVALDTVACWNSPSLDQEIKQTEIHLQSLASQVRNLLDTDDVVAFGPFLYVYIRKSSLVTHALRNSQSLA--ILSKYILMAKASMRAKLGHGRRVIQMPLIVCVDSKSDDNYISLLGIPPIHGDDDRNLFGQAFEAAISRTKARAEFKYFSTNCIELHREDMLKLFEALSSLLT 566          
BLAST of Cell division control protein 45-related vs. TrEMBL
Match: A0A183QMG0 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 4.239e-108
Identity = 202/580 (34.83%), Postives = 336/580 (57.93%), Query Frame = 1
Query:   49 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNV-LLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKL-----VSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLY-RISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFL---DHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQ----NSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLI-LYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            MVI  +++ EF+ +++G ++L+     VD +CT++++  +FK   V Y+  I+  K +L+ T+ K      V + INCG+ FDV+   N+   +  + Y+ DS RPIH+NNFYN  Q+K+L L E    VP+F DVF     S +   +D   Q  +R + D   +E++I +R+W  KR E++  YE +++H  +SS++++ L   + QE+  LLW AI+G TSQL+ + INRE Y + LD LQS++ +L     +     +   N + + +   DELALWLYRHWSLK+A+  + VT + F+L+     +R+ EFLV +G+P  E    +S +   LR  +   F    E++ +S+ DLFLPSF+   G+R  +SA+DA F+  + L   ++ NP       + F  A+  ++  +S ++D  ++  + +++++    R++L+T DV   G FL V ++K     ++L  S  L   IL +YIL A  S R KLG  R+   +PLI+  +S++D + I L GIPP+  D  +N FGQ FE ++   K+R +  +F T  I+++  D LK+F+A+   L+
Sbjct:    1 MVILRDIRSEFYGEVVGNRVLVCVYPDVDGLCTWRVLKELFKHRNVLYTLVIVKDKGDLKDTYSKNRDFFQVAVFINCGANFDVVG--NLDPQEECIFYVCDSHRPIHINNFYNQRQIKLLCLNEDTTLVPKFEDVF--REFSSDESDEDSEEQQNRRLQPDD--IEKRIEKRKWNRKRQELLMDYESFSYHSVASSVVMFDLAWKLSQENNCLLWYAIVGQTSQLITHAINREHYIDQLDYLQSHMSRLSHIGQIHSGTSTSDENKARVEILFEDELALWLYRHWSLKEAMETSMVTASKFKLFTEGGQRRMYEFLVQLGLPRRECVQLYSSMNSSLRDSLNEQFLQYGEKYGLSRTDLFLPSFIVHLGYRTPMSAVDAVFLTISALECYNNGNP------VENFQMALDTVACWNSPSLDQEIKQTEIHLQSLASQVRNLLDTDDVVAFGPFLYVYIRKSSLVTHALRNSQSLA--ILSKYILMAKASIRAKLGHGRRVIQMPLIVCVDSKSDDNYISLLGIPPIHGDDDRNLFGQAFEAAISRTKARAEFKYFSTNCIELHREDMLKLFEALSSLLT 566          
BLAST of Cell division control protein 45-related vs. TrEMBL
Match: A0A504YTH7 (Cell division control protein 45 OS=Fasciola gigantica OX=46835 GN=FGIG_05609 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 2.991e-106
Identity = 191/576 (33.16%), Postives = 334/576 (57.99%), Query Frame = 1
Query:   49 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKY-GKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKL-DAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSE-----INLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISD-KRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN--SLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDK-SLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            MV+  +++ EF+  ++GK++L+   + +D +C ++I+  +F   E+ Y+  ++  K EL  ++  +     +V+LINCG+ FDVIE L   +S   + YI DS RPIH+NNFYN  QVK+L L E    VP+F DVF                +S    KL +   +E+++++R+W   R +I+  YE +++   SSS++++ L   + QE+  LLW AI+G TSQLL   INRE Y + LD LQS++ +L    +     ++ E     + +   D+LALWLY+HWSLK+ +  + +T + F+L+  S  KRL EFLV++G+P  E+  ++S +   ++  +  L   + E++ +++ DLF+PSF  + G+R  +SA+DA  +  + L++    +     + F  A+  LS     ++D  +  A+ ++  +    R++L+T ++   G FL   +++ +  ++ L  PL   IL RY+L A  + RPK+G+ R+   +PLI+  +SRT++ ++ L GIPPL  D  +N FGQ FE ++   K+R +  +F++  I+++  D LK+F+A+   LS
Sbjct:    1 MVVLADIRSEFYHDLLGKRVLVYVVSDIDGICAWRILKELFIYKEILYTLLVVPDKKELLVSYNTHKDSFEDVVLINCGANFDVIEALEPPQSS--IFYICDSHRPIHINNFYNQRQVKLLCLNEDTSDVPKFEDVFQQFSVR----------ESENEEKLSNPGAIEKRVKKRKWLRHRQDILMDYESFSYFTVSSSIVLFDLAWRLSQENNCLLWYAIVGQTSQLLTYSINREHYIDQLDYLQSHVSRLGHAVQTHSATSVVEESKAKVEIAFEDDLALWLYKHWSLKETMETSMLTASRFKLFTESGQKRLLEFLVHIGLPRREYLQRYSTMSSAVKENLNGLLIQHGEKYGLNRRDLFIPSFTVQLGYRTPISAMDAVLLTISALEY---YMDASPGENFQHALDTLSCWSCDSLDSEITRAQLHLTGLANQVRNLLDTDEIVAFGPFLYCYIRRTSLVTVALCNPLSLSILARYVLMAKAALRPKMGRERRVAQMPLILCVDSRTEENNITLVGIPPLHGDDDRNLFGQAFEAAVRKTKARAEFRYFNSNCIELHREDMLKVFEALSALLS 561          
BLAST of Cell division control protein 45-related vs. TrEMBL
Match: A0A5J4P0Z3 (Cell division control protein 45 OS=Paragonimus westermani OX=34504 GN=DEA37_0001464 PE=4 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.123e-99
Identity = 192/591 (32.49%), Postives = 328/591 (55.50%), Query Frame = 1
Query:   49 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKY-GKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKL------VSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLY-RISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN--SLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTD-KSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFD-TCKIKINEG--------------DTLKIFQAIRRFLS 1743
            MV+  + + EF+ ++IGK++L+     +D +C ++I+  +F   ++ Y+  ++N+K ELQ  F K    +  V+L+NCG+ FD+I   +++ +   + Y+ DS+RPIH+NNFYN  Q+K++ L E    VP+F DVF      +ES  +       ++ + +A  +E++I +R W  +R +I+  YE ++F+  S+S++++ L   + QE+  LLW AI+G TSQLL N INRE Y + LD LQS++ +L      +S      + + ++I +   +ELALWLY+HWSLK+ +  + VT + F+L+     K+++EFLV++G                                 +S+ D+FLPSF  + G++  +SAIDA F+  + L     +   E    F RA++ LS     +++  L L + +++ +    R++++T +V   G FL V ++K +  S  L  PL   +L +Y+L A  + RPKLG+ R+   +PLI+  +SR D ++++L GIPPL  D  +N FGQ FE  +   K++ Q  +FD  CK ++N                D LK+F+A+   LS
Sbjct:    1 MVLVNDARTEFYGELIGKRVLVFVLPDIDGLCAWRILKELFVCRQIMYTLLVVNNKHELQDFFAKNKDSVREVVLVNCGANFDIIG--SLEPNTETIFYVCDSRRPIHINNFYNQRQIKLVCLNEDTSDVPKFEDVFQQFSSDEESAGES---DDDEKRRTNANAVEKRIEKRRWLRRRQDILMDYESFSFYTVSTSVVLFDLAWRLSQENTCLLWFAIVGQTSQLLTNCINREHYVDQLDYLQSHVSRLGHMGSHLSRHSGMAEEHKAKIEIMFEEELALWLYKHWSLKETLETSMVTASKFKLFTEGGQKKMQEFLVHVG---------------------------------LSRRDIFLPSFTVQLGYKTPISAIDAVFLAMSALGCHGEDGPGE---NFQRALETLSCWSLPSLESELGLTQAHLQNLASQVRNLIDTDEVVAFGPFLYVYIRKTSLVSPSLRNPLSLSVLAKYMLMAKAALRPKLGRDRRIAQMPLILCIDSRADEENIVLMGIPPLHGDDDRNLFGQAFEAGVRRTKAKAQFCYFDNNCKFEVNRSFVTKKFSGIELRREDMLKLFEALAALLS 550          
BLAST of Cell division control protein 45-related vs. Ensembl Cavefish
Match: cdc45 (CDC45 cell division cycle 45 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040426-2710])

HSP 1 Score: 129.798 bits (325), Expect = 8.704e-32
Identity = 134/577 (23.22%), Postives = 261/577 (45.23%), Query Frame = 1
Query:   52 VITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVF--------AXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDV--KKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDK-SLILYGIPPLK--SDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            +  T+++ EF+D ++ +++ +L +  +D++C  KI+  +F    V Y+   +    +L T FL++ +                                               Q+K+L  Q+    VP + D+F          +     +ESD  S  S KR ++     E +  +REW+++R EI+  YE+Y +HGTS+S++++ L  ++ +++ ++LW +IIG T Q + + I    Y   +  LQ ++ +  + R E ++N+LS       D + +     + ++    C+  +   ++  R   + L++    + +P  +   KF+ +   ++  +  + +++  +F +  +D+ + +F    GF+    A D     AA L  E+ E  E   D F++A+  LS ++   +  G++L             S + T+ +   G FL   +     +    S PL   +L +Y+L+A         ++++ + LPLI+ A    +K ++I+ GIPP    SDK KN FG+ FE +     SR   D FDT  I++   D  K   A+   LS
Sbjct:    1 MFVTDIRKEFYDVVVNQRVALLVSADIDALCACKILQALFHCDHVQYTLVPVTGWQDLGTAFLEHKE-----------------------------------------------QIKLLIKQDDDLGVPSYDDIFRDDEDEDEDGDGGDSGNESDGGSEPSGKRRRI-----ERQRAKREWEARRREILFDYEQYEYHGTSASMVMFELAWVMTKDTKDMLWWSIIGLTDQWVHDKITHMKYVTDIATLQRHVSRH-NHRNEDEENSLS------IDCMRISFEYEYPVQYCEKCSHESW--WECTRAIQEILQDGAASI-LPLKQVRQKFNSMDLSIKENLREVIEESSNKFGM--KDIRVQTFSVHFGFKNRFLASDVVHAAAALL--ESVEKDEGATDNFIKALDCLSRSNIEKLHLGIDLT----------IASCICTNLILSQGPFLYCHLLEGTPDVKLFSKPLALTLLCKYLLKAFVCST----RNKRCKVLPLIMAAPMDVEKGTVIVLGIPPESETSDK-KNFFGRAFEKAAESTSSRTLHDHFDTSIIELKMEDRGKFLDALITLLS 496          
BLAST of Cell division control protein 45-related vs. Ensembl Yeast
Match: CDC45 (DNA replication initiation factor; recruited to MCM pre-RC complexes at replication origins; promotes release of MCM from Mcm10p, recruits elongation machinery; binds tightly to ssDNA, which disrupts interaction with the MCM helicase and stalls it during replication stress; mutants in human homolog may cause velocardiofacial and DiGeorge syndromes [Source:SGD;Acc:S000004093])

HSP 1 Score: 82.0333 bits (201), Expect = 7.238e-17
Identity = 133/616 (21.59%), Postives = 250/616 (40.58%), Query Frame = 1
Query:  130 VDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNI--------------KESDNRVIYILDSQRPIHVNNFYNASQV---------------------KILTLQEQFG--------YVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKR-AEIMDIYERYAFHGT----SSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLV-SERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISD-KRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENP------------------------------EIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWL-SAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPP-----LKSDKSKNP----FGQIFEDSLICAKSRIQQDFFDTCKIKINEGD 1704
            +D++C  K+++ +FKK  V      I   SEL+  + +    I+++LL+  G   D+  FL I              ++S  R IY+LD+ RP +++N +  SQ+                     K+L L E+ G              D  A + +    E ++D  ++    + +++     + +R+ + K+  E   + E Y   GT    S S  IYSL + I + +L  LW  I+G TS   L+    + Y  +  LLQ  + +L  S R   K  +   +N+Q   +  L+L RH SL  + Y +        L+  +  KRL +    MGIP S  +  +  + + ++ E+  +F  N +R+ +  +D+    FV   G+R  +SA +    + A L+  N                                +++ +   F  +   L       ++ G++LA+D    I+    +ILE   +     +    ++    L L   PL    L  +++E          +S   Q LP+++ +      + ++ G+ P     L +  +K P    F   F+       ++++ D F++  I+I   D
Sbjct:   36 IDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIF-GSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDENDNNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEYYSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTS---LDIAYAQVYNRLYPLLQDEVKRLTPSSRNSVKTPDTLTLNIQP--DYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGL--QDIIRDGFVRTLGYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLSWDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYRNPLTLLRLGNWLIECC-------AESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKPILNNFSMAFQQITAETDAKVRIDNFESSIIEIRRED 636          
BLAST of Cell division control protein 45-related vs. Ensembl Nematostella
Match: EDO50060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF94])

HSP 1 Score: 219.935 bits (559), Expect = 4.893e-64
Identity = 167/579 (28.84%), Postives = 286/579 (49.40%), Query Frame = 1
Query:   67 LKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQ-SAKRTKLD---AAYLEEKI----RRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTD---ELALWLYRHWSLKQAVYCTPVTLTNFQLYRISDK-RLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEI-----KEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNS--LWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDK-SLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFL 1740
            LK E +D I  ++IL+L A  VD++C  KI+  +FK   + Y+    + K +L   +L++  +I ++ L+NCG   +++E L   E  +   YI DS RP+ ++N YN  QVKIL  + +   VP+F D++A           D+  + S KR K +    A +  KI     R      R EI+  Y  +AF+GTS S+++Y L   + ++  +LLW A +G T Q +   I+ E Y +  + L  +    V         N   IN        EL L LYRHWSL  +++ +  T   F+++ +  K +L EFL  MG+P  +    FS +   LR+ +    + + ++F +  E++   SF  + GFR +L + D    + A L  E+P +      E   +KFL A+  LS ++S+ +  G+E+AK  +  +    RS+++   V   G FL   +++        S P++   L R++L A       + K+++  +LP ++ A    +K + ++ G+PP+  +  KN  G+ FE +    K+R   D FD   +++   D  K F A+   L
Sbjct:    6 LKEEVYDVIFEQRILVLVAMDVDALCACKILKWLFKCDNIQYTLVPASGKEDLARAYLEHAEQIKHIFLVNCGGNINLLETLEPDE--DVTFYIADSHRPLDLDNIYNQDQVKILMKEGETLEVPDFDDIYAQSEVQLMGNESDEGSEPSNKRRKTEDGIIAIIGMKIMIKNNRDILSHCRQEILYRYHEFAFYGTSCSVLMYELAWKMSKDCNDLLWWAAVGLTDQYINERIDSEKYVSDAESLHEH----VMRHNHGADENGVSINCMKITFDYELRLALYRHWSLFDSIWHSHYTACRFRVWTMKGKQKLHEFLADMGVPLVQSRQTFSNMDVQLRNNLKEWVETSAQKFGM--EEMSYGSFNVQYGFRNKLCSSDVVHAVNALL--ESPSLLALQSDESKSEKFLDALDALSRSNSKLLLDGIEMAKKQLIALVTQVRSLIDMHQVVCAGPFLYAFLREGTPDLKMFSKPVVLGALARFVLSAYVV----MSKNKRAAALPFVLAAPLDAEKGTCLVVGVPPIADESRKNFLGRAFELAAEKTKARSTHDCFDPAVMEMKSEDKEKFFDALSALL 570          
BLAST of Cell division control protein 45-related vs. Ensembl Medaka
Match: cdc45 (cell division cycle 45 [Source:NCBI gene;Acc:101173790])

HSP 1 Score: 228.024 bits (580), Expect = 1.384e-66
Identity = 174/584 (29.79%), Postives = 321/584 (54.97%), Query Frame = 1
Query:   61 TELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYG-KISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQ----SAKRTKLDAAYLEEKIRRRE----WKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDE--LALWLYRHWSLKQAVYCTPVTLTNFQLYRISD-KRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFL-------QVDVKKQNSLWLSAPLMQYILPRYILEA-TYSQRPKLGKSRKTQSLPLIINAESRTDK-SLILYGIPPLK--SDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            T++K +F++ +  +++ +L A  +D++C  KI+  +F    + Y+   +    EL T FL++  +    +LINCG+  D++E L  +  D+ + +I D+ RP+ V N YN +Q+K+L  Q+    VP + ++F DE E +E +S ++S +    S KR + D   +E +I R+     W+++R EI+  YE+Y +HGTS++++++ L  ++ +++ ++LW AI+G T Q + + I    Y   +  +Q ++ +  S R E ++N+LS   ++ + E  L L LY+HWSL +++  +  T  +F+L+ ++  K+L+E+L  MG+P  + + KF+ +   ++  +  + +++  ++ I  +D+ + +F A+ GF+    A D     AA L  E+ E  E   D F++A+  LS ++   +  G++LAK  +  I +   S + T+ +   G FL         DVK       S P+   +L +Y+L+A  +S R K     + + LPL++ A    +K ++I+ GIPP    SDK KN FG+ FE +     SR   D FDT  I++   D +K   A+   LS
Sbjct:    4 TDIKKDFYEVVANQRVALLVAGDIDALCACKILQALFHCDHIQYTLVPVTGWQELGTAFLEHKEQFRYFVLINCGANVDLLEML--QPDDDSIFFICDTHRPVDVVNVYNDTQIKLLIKQDDDLAVPSYDEIFRDEDEENEDDSGNESDEGSEPSGKRRRFDEGAVERRIERQRVRREWEARRKEILFDYEQYEYHGTSAAMMVFELAWVLTKDTKDMLWWAIVGLTDQWVHDKITHMKYVTDVATMQRHVSRH-SHRNEDEENSLSIDCMRISFEYDLRLTLYQHWSLYESICNSCYTCCHFKLWTLNGQKKLQEYLADMGLPLKQVKQKFNSMDMSIKENLREVIEESSNKYGI--KDIRIQTFGAQFGFKNRFLASDMVHAAAALL--ESTEKDESDTDNFIKALDSLSRSNLNRLLSGIDLAKKKLIAIQQTVASCICTNLILSQGPFLYCYLMEGTPDVK-----LFSKPMALSLLCKYLLKAFVHSTRNK-----RCKLLPLVMAAPKDVEKGTIIVVGIPPESETSDK-KNFFGRAFEKAAESTGSRTLHDHFDTSVIELKTEDRIKFLDALITLLS 569          
BLAST of Cell division control protein 45-related vs. Planmine SMEST
Match: SMESG000045786.1 (SMESG000045786.1)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 564/565 (99.82%), Postives = 564/565 (99.82%), Query Frame = 1
Query:   49 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFAXXXXXXXXXXXXXXYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 1743
            MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFADEVESDESESDDDSYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQN LWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS
Sbjct:    1 MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSYSIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYILDSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFADEVESDESESDDDSYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIYSLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLVSERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYRISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISKEDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAVKFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVKKQNPLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRTDKSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINEGDTLKIFQAIRRFLS 565          
The following BLAST results are available for this feature:
BLAST of Cell division control protein 45-related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC459.875e-7029.09cell division cycle 45 [Source:HGNC Symbol;Acc:HGN... [more]
CDC451.258e-6327.73cell division cycle 45 [Source:HGNC Symbol;Acc:HGN... [more]
CDC451.215e-5126.55cell division cycle 45 [Source:HGNC Symbol;Acc:HGN... [more]
CDC451.401e-4228.99cell division cycle 45 [Source:HGNC Symbol;Acc:HGN... [more]
CDC452.481e-3926.39cell division cycle 45 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
evl-187.959e-1620.80pep chromosome:WBcel235:III:3729493:3735039:-1 gen... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CDC45L1.537e-6226.30gene:FBgn0026143 transcript:FBtr0070182[more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdc458.886e-6029.52CDC45 cell division cycle 45 homolog (S. cerevisia... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC451.858e-5628.94cell division cycle 45 [Source:NCBI gene;Acc:77954... [more]
CDC452.622e-5529.11cell division cycle 45 [Source:NCBI gene;Acc:77954... [more]
CDC451.216e-5028.42cell division cycle 45 [Source:NCBI gene;Acc:77954... [more]
CDC451.249e-5028.52cell division cycle 45 [Source:NCBI gene;Acc:77954... [more]
CDC455.278e-4726.56cell division cycle 45 [Source:NCBI gene;Acc:77954... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cdc451.915e-6928.97cell division cycle 45 [Source:MGI Symbol;Acc:MGI:... [more]
Cdc457.024e-5125.82cell division cycle 45 [Source:MGI Symbol;Acc:MGI:... [more]
Cdc451.053e-1930.88cell division cycle 45 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Cell division control protein 45-related vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75419|CDC45_HUMAN4.742e-6929.09Cell division control protein 45 homolog OS=Homo s... [more]
sp|Q9Z1X9|CDC45_MOUSE1.340e-6828.97Cell division control protein 45 homolog OS=Mus mu... [more]
sp|Q9YHZ6|CDC45_XENLA1.534e-5729.90Cell division control protein 45 homolog OS=Xenopu... [more]
sp|O74113|CDC45_SCHPO2.188e-2021.88Cell division control protein 45 homolog OS=Schizo... [more]
sp|Q55GA4|CDC45_DICDI8.173e-1721.18Cell division control protein 45 homolog OS=Dictyo... [more]
back to top
BLAST of Cell division control protein 45-related vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LGK52.700e-11335.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
G4VBH07.888e-10934.83Cell division control protein 45-related OS=Schist... [more]
A0A183QMG04.239e-10834.83Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A504YTH72.991e-10633.16Cell division control protein 45 OS=Fasciola gigan... [more]
A0A5J4P0Z32.123e-9932.49Cell division control protein 45 OS=Paragonimus we... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdc458.704e-3223.22CDC45 cell division cycle 45 homolog (S. cerevisia... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC457.238e-1721.59DNA replication initiation factor; recruited to MC... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO500604.893e-6428.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell division control protein 45-related vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdc451.384e-6629.79cell division cycle 45 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Cell division control protein 45-related vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000045786.10.000e+099.82SMESG000045786.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033683 ID=SMED30033683|Name=Cell division control protein 45-related|organism=Schmidtea mediterranea sexual|type=transcript|length=1808bp
CCATCAATTTTTTAATTTATTAAATTTATATTTTAATACAAAGAATCTAT
GGTAATTACGACAGAATTAAAGTATGAATTTTTCGATAAAATTATTGGCA
AACAAATATTAATTTTAGCAGCAAATGGTGTTGACTCTGTTTGTACCTTT
AAAATAGTCACGTGTATTTTTAAAAAGTTTGAAGTGTCATATTCGTATTC
TATAATAAATAGTAAGAGTGAATTGCAAACTACATTTTTGAAATACGGAA
AAATTAGCAACGTCCTTTTGATTAATTGTGGCAGTCAATTCGACGTCATT
GAATTTTTGAACATCAAGGAAAGTGACAACAGAGTCATTTATATTTTGGA
TAGCCAAAGGCCTATCCACGTAAATAACTTCTATAATGCATCACAAGTTA
AAATATTGACTCTACAAGAACAATTCGGATACGTTCCGGAATTCCATGAC
GTTTTTGCTGATGAAGTCGAATCAGATGAATCCGAGTCTGACGACGATAG
CTATCAGTCGGCTAAGCGAACTAAGCTCGATGCAGCTTATTTGGAAGAAA
AGATTCGTCGAAGAGAATGGAAATCGAAAAGGGCTGAAATAATGGATATC
TATGAAAGGTACGCATTCCATGGAACGTCATCAAGCCTAATCATATACAG
TCTGTGCACATTAATCTATCAAGAGTCATTGGAGTTGCTTTGGTGTGCTA
TTATCGGTCATACTAGTCAATTATTATTGAATTTCATCAATCGGGAATCC
TACTGTAATATGTTGGATTTGCTCCAGTCTTATTTGTGTAAACTCGTTTC
CGAAAGAAAGGAATCCAAAAAAAATAATCTCTCAGAAATAAACCTTCAAT
CCACAGATGAATTGGCGCTGTGGCTATATCGACATTGGTCGCTGAAACAG
GCTGTGTATTGCACTCCTGTTACTCTGACTAACTTCCAGTTGTATAGAAT
TAGTGACAAGAGGCTTAGGGAATTCCTTGTCTATATGGGGATTCCCCATT
CTGAGTTCGAAGCTAAATTTTCATGCGTTAGATACGATTTGAGAAGTGAA
ATTGTTTCATTGTTTAAAGATAACTATGAAAGATTTAATATATCAAAAGA
GGATTTATTTCTACCGTCATTTGTAGCGAAATGCGGTTTCCGCGAAGAAT
TATCCGCTATCGACGCCACTTTTATCATAGCTGCGTTTCTTGATCACGAA
AACCCTGAAATTAAAGAGGAATTTTGTGATAAATTTTTAAGGGCTGTAAA
GTTTTTGTCCATCAATGACTCCCGCACGATAGACTATGGGCTGGAGTTGG
CGAAAGATTACATTGAAACAATTTATAAATTCACACGTTCGATTCTAGAA
ACTAGTGATGTGACTGTTTGTGGAACTTTTCTTCAAGTTGATGTGAAAAA
ACAAAATTCTTTGTGGTTATCAGCTCCTTTAATGCAGTATATTTTACCAC
GATATATTTTGGAAGCTACATACTCACAACGTCCGAAATTGGGAAAGTCC
AGGAAAACCCAATCATTACCACTAATTATTAATGCAGAAAGCCGAACTGA
CAAATCTTTAATTTTGTACGGCATCCCTCCATTAAAAAGTGATAAATCGA
AAAATCCCTTCGGTCAGATCTTTGAAGATTCATTAATATGTGCGAAATCA
CGAATTCAGCAAGATTTTTTCGATACCTGCAAAATAAAAATCAACGAAGG
AGATACTTTGAAAATATTTCAAGCGATTCGCAGGTTCCTATCATAATCAA
TGTTTTTAATTCCTGAGCTCCTCAGTCTTTTTCTGTAATAAAGATGTTTT
TTTTTGTC
back to top

protein sequence of SMED30033683-orf-1

>SMED30033683-orf-1 ID=SMED30033683-orf-1|Name=SMED30033683-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=566bp
MVITTELKYEFFDKIIGKQILILAANGVDSVCTFKIVTCIFKKFEVSYSY
SIINSKSELQTTFLKYGKISNVLLINCGSQFDVIEFLNIKESDNRVIYIL
DSQRPIHVNNFYNASQVKILTLQEQFGYVPEFHDVFADEVESDESESDDD
SYQSAKRTKLDAAYLEEKIRRREWKSKRAEIMDIYERYAFHGTSSSLIIY
SLCTLIYQESLELLWCAIIGHTSQLLLNFINRESYCNMLDLLQSYLCKLV
SERKESKKNNLSEINLQSTDELALWLYRHWSLKQAVYCTPVTLTNFQLYR
ISDKRLREFLVYMGIPHSEFEAKFSCVRYDLRSEIVSLFKDNYERFNISK
EDLFLPSFVAKCGFREELSAIDATFIIAAFLDHENPEIKEEFCDKFLRAV
KFLSINDSRTIDYGLELAKDYIETIYKFTRSILETSDVTVCGTFLQVDVK
KQNSLWLSAPLMQYILPRYILEATYSQRPKLGKSRKTQSLPLIINAESRT
DKSLILYGIPPLKSDKSKNPFGQIFEDSLICAKSRIQQDFFDTCKIKINE
GDTLKIFQAIRRFLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR003874CDC45
Vocabulary: biological process
TermDefinition
GO:0006270DNA replication initiation
GO:0000727double-strand break repair via break-induced replication
GO:0006267pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0031938regulation of chromatin silencing at telomere
GO:0032508DNA duplex unwinding
GO:0051301cell division
GO:1900087positive regulation of G1/S transition of mitotic cell cycle
GO:1902977mitotic DNA replication preinitiation complex assembly
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
GO:0003688DNA replication origin binding
GO:0003697single-stranded DNA binding
GO:00431383'-5' DNA helicase activity
Vocabulary: cellular component
TermDefinition
GO:0005656nuclear pre-replicative complex
GO:0031261DNA replication preinitiation complex
GO:0031298replication fork protection complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003874CDC45 familyPFAMPF02724CDC45coord: 142..554
e-value: 9.7E-61
score: 205.9
coord: 20..116
e-value: 2.7E-18
score: 65.7
IPR003874CDC45 familyPANTHERPTHR10507CDC45-RELATED PROTEINcoord: 1..563
NoneNo IPR availablePANTHERPTHR10507:SF0CELL DIVISION CONTROL PROTEIN 45 HOMOLOGcoord: 1..563