SMED30033682
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30033682 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 3
Alignments
SMED30033682 aligns in the following genomic locations:
Homology
BLAST of SMED30033682 vs. Planmine SMEST
Match: SMESG000003594.1 (SMESG000003594.1) HSP 1 Score: 59.3066 bits (142), Expect = 4.005e-13 Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 2 Query: 284 KIIIAVQGTGLFQTFTKVELQRQMPGGDVARKLNVIPEHHVNESASQSTPKIKPTTHKHHATKNRWLRERRRA*NVKLLANAACLLE 544 +I+I Q L +F + EL++++ G D+A KLN+IP HV E+A+ P++ T+ KH+ +KNR RERRRA V L NAA LE Sbjct: 82 RIVINNQSAVLTASFNETELKKRLAGRDLAIKLNIIPAEHVPETATTGPPQMPKTSKKHNPSKNRRRRERRRAEGVSQLKNAAQTLE 168 HSP 2 Score: 33.4982 bits (75), Expect = 4.005e-13 Identity = 16/40 (40.00%), Postives = 28/40 (70.00%), Query Frame = 3 Query: 156 KLRVKCDRIKMTWFFHKKVKDLKQPMNRLSRSQDDLISES 275 +L V+ +R TWF + VK L + ++RL+R ++DLI+E+ Sbjct: 39 QLVVEHERTLSTWFAPEAVKALHKQIHRLTRCREDLIAEN 78
BLAST of SMED30033682 vs. Planmine SMEST
Match: SMESG000036778.1 (SMESG000036778.1) HSP 1 Score: 58.5362 bits (140), Expect = 4.140e-13 Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 2 Query: 284 KIIIAVQGTGLFQTFTKVELQRQMPGGDVARKLNVIPEHHVNESASQSTPKIKPTTHKHHATKNRWLRERRRA*NVKLLANAACLLE 544 +I+I Q L +F + EL++++ G D+A KLN+IP HV E+A+ P++ + KH+ +KNR RERRRA V LL NAA LE Sbjct: 645 RIVINNQSAVLTASFNETELKKRLAGRDLAIKLNIIPAEHVPETATTGPPQMPKISKKHNPSKNRRRRERRRAEGVTLLKNAAQTLE 731 HSP 2 Score: 34.2686 bits (77), Expect = 4.140e-13 Identity = 16/41 (39.02%), Postives = 29/41 (70.73%), Query Frame = 3 Query: 153 QKLRVKCDRIKMTWFFHKKVKDLKQPMNRLSRSQDDLISES 275 ++L V+ +R TWF + VK L + ++RL+R ++DLI+E+ Sbjct: 601 EQLVVEHERTLGTWFAPEAVKALHKQIHRLTRCREDLIAEN 641
BLAST of SMED30033682 vs. Planmine SMEST
Match: SMESG000072638.1 (SMESG000072638.1) HSP 1 Score: 58.151 bits (139), Expect = 8.077e-13 Identity = 40/87 (45.98%), Postives = 56/87 (64.37%), Query Frame = 2 Query: 284 KIIIAVQGTGLFQTFTKVELQRQMPGGDVARKLNVIPEHHVNESASQSTPKIKPTTHKHHATKNRWLRERRRA*NVKLLANAACLLE 544 +III Q L +FT+ EL +++ G D+A KLN+IP +H+ E A +I T+ KHH +KNR RERRRA + +L NAA +LE Sbjct: 264 RIIINDQSAVLVASFTEAELVKRLAGRDLALKLNLIPANHLPEIAQAGPAQIPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLE 350 HSP 2 Score: 33.8834 bits (76), Expect = 8.077e-13 Identity = 17/40 (42.50%), Postives = 27/40 (67.50%), Query Frame = 3 Query: 156 KLRVKCDRIKMTWFFHKKVKDLKQPMNRLSRSQDDLISES 275 KL + +R TWF + VK L+ ++RLSR ++DLI+E+ Sbjct: 221 KLLAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAEN 260
BLAST of SMED30033682 vs. Planmine SMEST
Match: SMESG000028417.1 (SMESG000028417.1) HSP 1 Score: 58.151 bits (139), Expect = 1.167e-12 Identity = 41/88 (46.59%), Postives = 58/88 (65.91%), Query Frame = 2 Query: 284 KIIIAVQGTGLFQTFTKVELQRQMPGGDVARKLNVIPEHHVNESASQSTPKIKP-TTHKHHATKNRWLRERRRA*NVKLLANAACLLE 544 +III Q L +FT+VEL +++ G D+ KLN+IP +H+ E +Q+ P P T+ KHH +KN RERRRA + LL+NAA +LE Sbjct: 75 RIIINDQSADLVASFTEVELTKRLAGRDLVVKLNLIPVNHLPEE-TQAGPAQTPRTSKKHHPSKNCRRRERRRAEGLTLLSNAAQVLE 161 HSP 2 Score: 33.113 bits (74), Expect = 1.167e-12 Identity = 17/40 (42.50%), Postives = 27/40 (67.50%), Query Frame = 3 Query: 156 KLRVKCDRIKMTWFFHKKVKDLKQPMNRLSRSQDDLISES 275 KL + +R TWF + VK L+ ++RLSR ++DLI+E+ Sbjct: 32 KLFAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAEN 71
BLAST of SMED30033682 vs. Planmine SMEST
Match: SMESG000077490.1 (SMESG000077490.1) HSP 1 Score: 58.9214 bits (141), Expect = 1.245e-12 Identity = 37/86 (43.02%), Postives = 52/86 (60.47%), Query Frame = 2 Query: 284 KIIIAVQGTGLFQTFTKVELQRQMPGGDVARKLNVIPEHHV---NESASQSTPKIKPTTHKHHATKNRWLRERRRA*NVKLLANAA 532 +I+I Q L +FT+ EL +++ D+A KLN+IP + + N+ TPK T+ KH+ +KNR RERRRA V LL NAA Sbjct: 82 RIVINDQSAVLIASFTETELTKRLASRDLAVKLNLIPANDLPERNQIGPAQTPK---TSKKHNPSKNRSGRERRRAEGVTLLNNAA 164 HSP 2 Score: 32.3426 bits (72), Expect = 1.245e-12 Identity = 16/40 (40.00%), Postives = 27/40 (67.50%), Query Frame = 3 Query: 156 KLRVKCDRIKMTWFFHKKVKDLKQPMNRLSRSQDDLISES 275 KL + +R TWF + VK L + ++RL+R ++DLI+E+ Sbjct: 39 KLLAEHERTLGTWFAPEVVKALHKQIHRLTRCREDLIAEN 78 The following BLAST results are available for this feature:
BLAST of SMED30033682 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30033682 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30033682 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30033682 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30033682 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30033682 ID=SMED30033682|Name=SMED30033682|organism=Schmidtea mediterranea sexual|type=transcript|length=929bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|