slc25a-24

Overview
Nameslc25a-24 (AKN21592.1)
Smed IDSMED30033672
Length (bp)1202
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-24 (SMED30033672) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-24 (SMED30033672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-24 (SMED30033672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-24 (SMED30033672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033672SMESG000016412.1 dd_Smed_v4_8945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033672SMESG000016412.1 dd_Smed_v4_8945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033672SMESG000016412.1 dd_Smed_v4_8945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033672SMESG000016412.1 dd_Smed_v4_8945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033672SMESG000057720.1 Contig4655GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033672SMESG000016412.1 Contig4655GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-24 vs. Ensembl Human
Match: SLC25A30 (solute carrier family 25 member 30 [Source:HGNC Symbol;Acc:HGNC:27371])

HSP 1 Score: 286.574 bits (732), Expect = 1.702e-94
Identity = 145/290 (50.00%), Postives = 194/290 (66.90%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQIQG+    N  K F+  RY GM+HA   I ++EG+ ALY G++ A++RQASYGT+K+G Y  LKR+  +    E++  N+ C +++GV SSTIANPTDV+KIR+Q++SN  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF SS      G   S PV+V+RTR+MNQ  +     +  Y   LDCL +T +NE  FAL+KGF P W R+GPWNIIFF+T+E++KK++L
Sbjct:    8 PFVYGGLASITAECGTFPIDLTKTRLQIQGQ---TNDAK-FKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQ-GGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCS-GYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL 291          
BLAST of slc25a-24 vs. Ensembl Human
Match: SLC25A14 (solute carrier family 25 member 14 [Source:HGNC Symbol;Acc:HGNC:10984])

HSP 1 Score: 283.878 bits (725), Expect = 1.540e-93
Identity = 138/290 (47.59%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EG+ ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   ++ D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  +D + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:    8 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSID----ARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 290          
BLAST of slc25a-24 vs. Ensembl Human
Match: SLC25A14 (solute carrier family 25 member 14 [Source:HGNC Symbol;Acc:HGNC:10984])

HSP 1 Score: 284.263 bits (726), Expect = 3.626e-93
Identity = 138/290 (47.59%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EG+ ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   ++ D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  +D + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   40 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSID----ARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 322          
BLAST of slc25a-24 vs. Ensembl Human
Match: SLC25A14 (solute carrier family 25 member 14 [Source:HGNC Symbol;Acc:HGNC:10984])

HSP 1 Score: 283.878 bits (725), Expect = 4.548e-93
Identity = 138/290 (47.59%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EG+ ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   ++ D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  +D + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   43 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSID----ARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 325          
BLAST of slc25a-24 vs. Ensembl Human
Match: SLC25A14 (solute carrier family 25 member 14 [Source:HGNC Symbol;Acc:HGNC:10984])

HSP 1 Score: 283.878 bits (725), Expect = 4.548e-93
Identity = 138/290 (47.59%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EG+ ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   ++ D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  +D + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   43 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSID----ARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 325          
BLAST of slc25a-24 vs. Ensembl Celegans
Match: misc-1 (Mitochondrial 2-oxoglutarate/malate carrier protein [Source:UniProtKB/Swiss-Prot;Acc:P90992])

HSP 1 Score: 157.147 bits (396), Expect = 1.282e-44
Identity = 90/292 (30.82%), Postives = 145/292 (49.66%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRL--------QSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKI 987
            F  GG A + A +   P+D  K R+Q+ G   K           Y   +HA   I+K EG+ A+Y GLSA ++RQA+Y T ++G Y  L    ++  +  S        + AG   S +  P ++  IR+        + + NYT     +   T+   +EG   L++   PT  R+ ++    L TY   K  L+    + D ++CHF +S+++    T  S PV++ +TR+ +   ID      +YK+A D   K I+NE IFALWKGF P + R+GP  ++ F+  E++
Sbjct:   13 FAFGGTAGMGATLVVQPLDLVKNRMQLSGTTGKKE---------YRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKDKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYT---GVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKP---EYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQM 289          
BLAST of slc25a-24 vs. Ensembl Celegans
Match: misc-1 (Mitochondrial 2-oxoglutarate/malate carrier protein [Source:UniProtKB/Swiss-Prot;Acc:P90992])

HSP 1 Score: 157.147 bits (396), Expect = 1.282e-44
Identity = 90/292 (30.82%), Postives = 145/292 (49.66%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRL--------QSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKI 987
            F  GG A + A +   P+D  K R+Q+ G   K           Y   +HA   I+K EG+ A+Y GLSA ++RQA+Y T ++G Y  L    ++  +  S        + AG   S +  P ++  IR+        + + NYT     +   T+   +EG   L++   PT  R+ ++    L TY   K  L+    + D ++CHF +S+++    T  S PV++ +TR+ +   ID      +YK+A D   K I+NE IFALWKGF P + R+GP  ++ F+  E++
Sbjct:   13 FAFGGTAGMGATLVVQPLDLVKNRMQLSGTTGKKE---------YRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKDKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYT---GVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKP---EYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQM 289          
BLAST of slc25a-24 vs. Ensembl Celegans
Match: ucp-4 (UnCoupling Protein (Mitochondrial substrate carrier) [Source:UniProtKB/TrEMBL;Acc:O01883])

HSP 1 Score: 157.147 bits (396), Expect = 1.676e-44
Identity = 95/305 (31.15%), Postives = 166/305 (54.43%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGES--ISNNIACAVVAGVTSSTIANPTDVIKIRLQSKS---------NYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQ--SNIDSNSVNYK------YKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            +F    A+++AE  T+P+D TKTRLQI     +N   K        GM+   + II++EG  AL+ G++ A+ R   Y  ++MG Y++++ ++      +S  +  ++ C   +G+ +   A+PTD++K+++Q +           YT  +   +   +T   +GF GL+   +P   R+ALL    + TYD  K  LI    L DN   H  +S  A      VS P +V++TR+M+Q    +D+  ++ K      YK  +DC  K I+NE  F+L+KGF+P++ R+ PW++ F++++E+I+K
Sbjct:   27 YFLSCTAALVAETVTYPLDITKTRLQIA----RNKFTK-------GGMVQVTYDIIRREGAMALWTGVAPAITRHYIYTGIRMGAYEQIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLRYTGATDCFRSLYRT---QGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFELKDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIRK 317          

HSP 2 Score: 59.6918 bits (143), Expect = 1.125e-9
Identity = 40/189 (21.16%), Postives = 79/189 (41.80%), Query Frame = 1
Query:  433 ESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTC---VSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            + I+     +  A + + T+  P D+ K RLQ   N       ++     I +EG   L+  V P   R  +  G+ +  Y+  + +L+T    ++  +  + S L  A  G      + P ++++ ++  +          +Y  A DC +   R +  F LW G++P   R    N+    T++ +K
Sbjct:   21 KKIATKYFLSCTAALVAETVTYPLDITKTRLQIARNKFTKGGMVQVTYDIIRREGAMALWTGVAPAITRHYIYTGIRMGAYE--QIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVK 207          
BLAST of slc25a-24 vs. Ensembl Celegans
Match: slc-25A10 (Oxoglutarate/malate carrier protein; SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:G5EE96])

HSP 1 Score: 121.709 bits (304), Expect = 1.555e-31
Identity = 86/290 (29.66%), Postives = 143/290 (49.31%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQ--SKSNYTQNSSF---LKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            ++ GG A  +A  CT P+D  K +LQ Q            QG    G +     I K +GI A Y G+SA+V+RQ +Y T + G+Y+ +K+   Q+ +          A  AG     +  P D++ +R+Q  SK    Q  ++   L    +   +EGF  ++       +R+ L+    L  YD  K  LI+  +  DN+  HFASS+ AA+  T ++ P++V++TR+M       N+   ++K  LDC   T +   +   +KGFIP W R+ P  ++ F+  E+++
Sbjct:   12 WYFGGVAGAMAACCTHPLDLLKVQLQTQQ-----------QGKLTIGQLS--LKIYKNDGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQLPQD-QPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMM-------NAAPGEFKGILDCFMFTAKLGPM-GFFKGFIPAWARLAPHTVLTFIFFEQLR 279          
BLAST of slc25a-24 vs. Ensembl Celegans
Match: slc-25A10 (Oxoglutarate/malate carrier protein; SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:G5EE96])

HSP 1 Score: 121.709 bits (304), Expect = 1.555e-31
Identity = 86/290 (29.66%), Postives = 143/290 (49.31%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQ--SKSNYTQNSSF---LKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            ++ GG A  +A  CT P+D  K +LQ Q            QG    G +     I K +GI A Y G+SA+V+RQ +Y T + G+Y+ +K+   Q+ +          A  AG     +  P D++ +R+Q  SK    Q  ++   L    +   +EGF  ++       +R+ L+    L  YD  K  LI+  +  DN+  HFASS+ AA+  T ++ P++V++TR+M       N+   ++K  LDC   T +   +   +KGFIP W R+ P  ++ F+  E+++
Sbjct:   12 WYFGGVAGAMAACCTHPLDLLKVQLQTQQ-----------QGKLTIGQLS--LKIYKNDGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQLPQD-QPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMM-------NAAPGEFKGILDCFMFTAKLGPM-GFFKGFIPAWARLAPHTVLTFIFFEQLR 279          
BLAST of slc25a-24 vs. Ensembl Fly
Match: Bmcp (gene:FBgn0036199 transcript:FBtr0076114)

HSP 1 Score: 246.128 bits (627), Expect = 6.521e-79
Identity = 143/306 (46.73%), Postives = 189/306 (61.76%), Query Frame = 1
Query:  124 DLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRG--------ESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNID--------SNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            D  PF +GG ASI AE  TFPIDTTKTRLQIQG+ +  +    F   RY GM  AF  I ++EG+ ALY G+  AV+RQA+YGT+K G Y  LK+++  N RG        E + +NI CA  AG  SS IANPTDV+K+R+Q      Q+   L  F +    EG +GL++ V PTA R+ ++  V LP YDF K +L+      D+V  HF SS +A+      S P++VIRTRLMNQ  +         + +    Y  +LDC  +TIRNE + AL+KGFIPTW R+GPWNIIFF+T+E++KK
Sbjct:    6 DWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQS----FSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLA--NERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQVHGK-GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302          
BLAST of slc25a-24 vs. Ensembl Fly
Match: Bmcp (gene:FBgn0036199 transcript:FBtr0076115)

HSP 1 Score: 246.128 bits (627), Expect = 6.521e-79
Identity = 143/306 (46.73%), Postives = 189/306 (61.76%), Query Frame = 1
Query:  124 DLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRG--------ESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNID--------SNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            D  PF +GG ASI AE  TFPIDTTKTRLQIQG+ +  +    F   RY GM  AF  I ++EG+ ALY G+  AV+RQA+YGT+K G Y  LK+++  N RG        E + +NI CA  AG  SS IANPTDV+K+R+Q      Q+   L  F +    EG +GL++ V PTA R+ ++  V LP YDF K +L+      D+V  HF SS +A+      S P++VIRTRLMNQ  +         + +    Y  +LDC  +TIRNE + AL+KGFIPTW R+GPWNIIFF+T+E++KK
Sbjct:    6 DWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQS----FSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLA--NERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQVHGK-GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302          
BLAST of slc25a-24 vs. Ensembl Fly
Match: Ucp4B (gene:FBgn0031758 transcript:FBtr0079173)

HSP 1 Score: 178.718 bits (452), Expect = 1.847e-52
Identity = 97/291 (33.33%), Postives = 160/291 (54.98%), Query Frame = 1
Query:  151 AASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKR---ISSQNMRGE-SISNNIACAVVAGVTSSTIANPTDVIKIRLQS------KSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            A++  AEI  +P D  KTR+QIQGE+      K     +Y G++     I+++EG+  LY G+SA + R + +  +KM  YD ++    +  ++ R + S   +    V+AG T+S + NPT++IKI++Q       +    +  + L+  T      G  GL+K  +P   RSAL+    +  YDF K  LI E  L+DN    F +++ A      +S P +V+++R+MNQ   D       YK +LDCL + +R E   A++KGFIP W R+GP +++F++T E+I++
Sbjct:   45 ASACSAEIVGYPFDMCKTRMQIQGEIASRVGQK----AKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPT-DEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330          
BLAST of slc25a-24 vs. Ensembl Fly
Match: Ucp4A (gene:FBgn0030872 transcript:FBtr0074464)

HSP 1 Score: 177.948 bits (450), Expect = 4.415e-52
Identity = 95/288 (32.99%), Postives = 161/288 (55.90%), Query Frame = 1
Query:  154 ASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQN-MRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNY------TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            A+ IAE+ T+P+D TKTRLQIQGE   ++  K     +Y GM+   F I ++EG   L++G++ A+ R   Y  +++  YD +++  +QN  +   +  +  C V AG  +  +A+P D++K+++Q +          +  S    F Q + + G KGL+K  IP   R+AL+    L TYD  K  ++    + D    H  +S+ A      +  P +V++TR+MNQ   D N     Y+ ++DCL++T+  E   AL+KGF+P W R+ PW++ F+L+ E+I+K+
Sbjct:   50 AASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNM--QYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPT-DENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334          
BLAST of slc25a-24 vs. Ensembl Fly
Match: Ucp4A (gene:FBgn0030872 transcript:FBtr0303572)

HSP 1 Score: 177.948 bits (450), Expect = 4.415e-52
Identity = 95/288 (32.99%), Postives = 161/288 (55.90%), Query Frame = 1
Query:  154 ASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQN-MRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNY------TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            A+ IAE+ T+P+D TKTRLQIQGE   ++  K     +Y GM+   F I ++EG   L++G++ A+ R   Y  +++  YD +++  +QN  +   +  +  C V AG  +  +A+P D++K+++Q +          +  S    F Q + + G KGL+K  IP   R+AL+    L TYD  K  ++    + D    H  +S+ A      +  P +V++TR+MNQ   D N     Y+ ++DCL++T+  E   AL+KGF+P W R+ PW++ F+L+ E+I+K+
Sbjct:   50 AASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNM--QYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPT-DENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334          
BLAST of slc25a-24 vs. Ensembl Zebrafish
Match: slc25a14 (solute carrier family 25 member 14 [Source:ZFIN;Acc:ZDB-GENE-040426-749])

HSP 1 Score: 286.96 bits (733), Expect = 4.999e-95
Identity = 143/294 (48.64%), Postives = 193/294 (65.65%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            ++  PF +GG ASI+AE  TFPID TKTRLQ+QG+        H    RY GM HA   I ++EG+ ALY G+S A++RQASYGT+K+G Y+ LK++   +   E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  LI   ++ D V  HF SS      G   S PV+V+RTR+MNQ  +  N +   YK  LD L +T RNE  FAL+KGF P W R+GPWNIIFF+T E++KK+ L
Sbjct:    4 LNWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ-------THCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQ-GSMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPL---YKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKKLPL 286          
BLAST of slc25a-24 vs. Ensembl Zebrafish
Match: slc25a14 (solute carrier family 25 member 14 [Source:ZFIN;Acc:ZDB-GENE-040426-749])

HSP 1 Score: 286.96 bits (733), Expect = 4.999e-95
Identity = 143/294 (48.64%), Postives = 193/294 (65.65%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            ++  PF +GG ASI+AE  TFPID TKTRLQ+QG+        H    RY GM HA   I ++EG+ ALY G+S A++RQASYGT+K+G Y+ LK++   +   E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  LI   ++ D V  HF SS      G   S PV+V+RTR+MNQ  +  N +   YK  LD L +T RNE  FAL+KGF P W R+GPWNIIFF+T E++KK+ L
Sbjct:    4 LNWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ-------THCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQ-GSMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPL---YKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKKLPL 286          
BLAST of slc25a-24 vs. Ensembl Zebrafish
Match: slc25a14 (solute carrier family 25 member 14 [Source:ZFIN;Acc:ZDB-GENE-040426-749])

HSP 1 Score: 271.166 bits (692), Expect = 1.669e-88
Identity = 136/281 (48.40%), Postives = 182/281 (64.77%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNII 963
            ++  PF +GG ASI+AE  TFPID TKTRLQ+QG+        H    RY GM HA   I ++EG+ ALY G+S A++RQASYGT+K+G Y+ LK++   +   E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  LI   ++ D V  HF SS      G   S PV+V+RTR+MNQ  +  N +   YK  LD L +T RNE  FAL+KGF P W R+GPWNII
Sbjct:    4 LNWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ-------THCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQ-GSMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPL---YKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNII 273          
BLAST of slc25a-24 vs. Ensembl Zebrafish
Match: ucp3 (uncoupling protein 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1317])

HSP 1 Score: 188.734 bits (478), Expect = 1.767e-56
Identity = 100/299 (33.44%), Postives = 162/299 (54.18%), Query Frame = 1
Query:  124 DLYP-----FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQN----SSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            DL P     FF  G A+  A++ TFP+DT K RLQIQGE   + T       +Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K+  ++     SI   +      G  +   A PTDV+K+R Q++  +T      +  +  +      EG +GL+K  +P   R+A++    L TYD  K  ++   ++ DN+ CHF ++  A    T V+ PV+V++TR MN S         +Y SAL+C    +  E   A +KGF+P++ R+G WNI+ F+++E+IK+
Sbjct:    8 DLPPTAAVKFFGAGTAACFADLVTFPLDTAKVRLQIQGE---SGTAPGSAVLKYRGVFGTITTMVRTEGARSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGSENASIVTRLLAGCTTGAMAVAFAQPTDVVKVRFQAQVRHTDGGKRYNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELVTYDIIKDLILKYDLMTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSS-------AGQYGSALNCALMMLTKEGPAAFYKGFMPSFLRLGSWNIVMFVSYEQIKR 296          
BLAST of slc25a-24 vs. Ensembl Zebrafish
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:555812])

HSP 1 Score: 187.963 bits (476), Expect = 3.555e-56
Identity = 97/292 (33.22%), Postives = 161/292 (55.14%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQ---SKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            F   G A+ IA++ TFP+DT K RLQIQGE   +  M      +Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K+  ++      I + +      G  +  +A PTDV+K+R Q   S  +  +  S +  +     +EGF+GL+K   P   R+A++    L TYD  K  L+   ++ D++ CHF S+  A    T ++ PV+V++TR M       NS   +Y SAL+C    +  E   A +KGF+P++ R+G WN++ F+T+E++K+  +
Sbjct:   17 FIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPV-KYRGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSRLMAGCTTGAMAVAVAQPTDVVKVRFQAQVSAGSSKRYHSTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVKTRYM-------NSAQGQYSSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM 300          
BLAST of slc25a-24 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:NCBI gene;Acc:394840])

HSP 1 Score: 287.345 bits (734), Expect = 7.295e-95
Identity = 146/290 (50.34%), Postives = 194/290 (66.90%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQ+QG+    N  K ++  RY GM+HA   I K+EG+ ALY G++ A++RQASYGT+K+G Y  LKR+       E++  N+ C V++GV SS IANPTDV+KIR+Q++ +  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF +S      G   S PV+V+RTR+MNQ +I  N  N  YK  LDCL +T +NE  FAL+KGF P W R+GPWNIIFF+T+E++KK+NL
Sbjct:    8 PFIYGGLASITAECGTFPIDLTKTRLQVQGQ---ANDAK-YKEIRYRGMLHAIVRIWKEEGVKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQGSLIQ-GGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSI-RNVSNSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKLNL 291          
BLAST of slc25a-24 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:NCBI gene;Acc:394840])

HSP 1 Score: 268.855 bits (686), Expect = 2.487e-87
Identity = 139/288 (48.26%), Postives = 185/288 (64.24%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEK 984
            ++  PF +GG ASI AE  TFPID TKTRLQ+QG+    N  K ++  RY GM+HA   I K+EG+ ALY G++ A++RQASYGT+K+G Y  LKR+       E++  N+ C V++GV SS IANPTDV+KIR+Q++ +  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF +S      G   S PV+V+RTR+MNQ +I  N  N  YK  LDCL +T +NE  FAL+KGF P W R+GPWNII   +  K
Sbjct:   17 LNWKPFIYGGLASITAECGTFPIDLTKTRLQVQGQA---NDAK-YKEIRYRGMLHAIVRIWKEEGVKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQGSLIQ-GGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSI-RNVSNSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIVSFSKSK 298          
BLAST of slc25a-24 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:NCBI gene;Acc:394840])

HSP 1 Score: 225.328 bits (573), Expect = 4.413e-65
Identity = 120/248 (48.39%), Postives = 159/248 (64.11%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCL 876
            PF +GG ASI AE  TFPID TKTRLQ+QG+    N  K ++  RY GM+HA   I K+EG+ ALY G++ A++RQASYGT+K+G Y  LKR+       E++  N+ C V++GV SS IANPTDV+KIR+Q++ +  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF +S      G   S PV+V+RTR+MNQ +I  N  N  YK  LDCL
Sbjct:    8 PFIYGGLASITAECGTFPIDLTKTRLQVQGQ---ANDAK-YKEIRYRGMLHAIVRIWKEEGVKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQGSLIQG-GMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSI-RNVSNSSYKGTLDCL 249          
BLAST of slc25a-24 vs. Ensembl Xenopus
Match: ucp2 (uncoupling protein 2 (mitochondrial, proton carrier) [Source:NCBI gene;Acc:394786])

HSP 1 Score: 201.445 bits (511), Expect = 2.799e-61
Identity = 100/292 (34.25%), Postives = 166/292 (56.85%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSF---LKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            F   G A+ IA++ TFP+DT K RLQIQGE    N + + +  +Y G+      ++K EG  +LY GL A + RQ S+ ++++GLYD +K+  ++      I + +A     G  +  +A PTDV+K+R Q+++N + N  +   +  +     +EG +GL+K   P   R+A++    L TYD  K  L+   I+ DN+ CHF S+  A    T ++ PV+V++TR M       NS   +Y SA++C     R E   A +KGF+P++ R+G WN++ F+T+E++K+  +
Sbjct:   17 FVGAGTAACIADLFTFPLDTAKVRLQIQGE----NKVVNVKAAQYKGVFGTISTMVKTEGPKSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLAAGCTTGAMAVAVAQPTDVVKVRFQAQANSSANRRYKGTMHAYRTIAREEGMRGLWKGTAPNITRNAIVNCTELVTYDIIKDSLLKANIMTDNLPCHFTSAFGAGFCTTVIASPVDVVKTRYM-------NSAKGQYASAINCAITMFRKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM 297          

HSP 2 Score: 71.2478 bits (173), Expect = 3.295e-13
Identity = 55/202 (27.23%), Postives = 89/202 (44.06%), Query Frame = 1
Query:  142 HGGAASIIAEICTF---------PIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIAC----AVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQ 708
            H G  S +A  CT          P D  K R Q Q     N         RY G +HA+  I ++EG+  L++G +  + R A     ++  YD +K      ++   +++N+ C    A  AG  ++ IA+P DV+K R  + +   Q +S +        KEG K  YK  +P+  R      V+  TY+  K  +++ Q
Sbjct:  111 HVGIGSRLAAGCTTGAMAVAVAQPTDVVKVRFQAQANSSANR--------RYKGTMHAYRTIAREEGMRGLWKGTAPNITRNAIVNCTELVTYDIIK---DSLLKANIMTDNLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAK-GQYASAINCAITMFRKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMMSAQ 300          
BLAST of slc25a-24 vs. Ensembl Xenopus
Match: ctps1 (CTP synthase 1 [Source:Xenbase;Acc:XB-GENE-957432])

HSP 1 Score: 197.593 bits (501), Expect = 8.242e-60
Identity = 103/294 (35.03%), Postives = 164/294 (55.78%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYT----QNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 1005
            F   G A+ IA++ TFP+DT K RLQIQGE   +       G RY G+      I+K EG  +LY GL A + RQ S+ ++++GLYD +K   +       I + I      G  + T+A PTDV+K+R Q+++N      + +  +  +     KEG +GL+K   P   R+A++    L TYD  K  L+  +++ DN+ CHF S+  A    T ++ PV+V++TR M       NS   +YKSAL+C    I  E   A +KGF+P++ R+G WN++ F+++E++K+  ++
Sbjct:   17 FIAAGTAACIADLFTFPLDTAKVRLQIQGETTGSGAA---NGIRYKGVFGTISTIVKTEGPKSLYNGLVAGLQRQMSFASIRIGLYDTVKLFYTNGKEKAGIGSRILAGCTTGALAVTVAQPTDVVKVRFQAQANLQGVKRRYNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCTELVTYDVIKENLLHYKLMTDNLPCHFVSAFGAGFCTTVIASPVDVVKTRYM-------NSPPGQYKSALNCAWTMITKEGPTAFYKGFVPSFLRLGSWNVVMFVSYEQLKRAMMM 300          
BLAST of slc25a-24 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 286.574 bits (732), Expect = 9.401e-95
Identity = 141/290 (48.62%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EGI ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   +L D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  LD + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:    8 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSID----VRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 290          
BLAST of slc25a-24 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 287.345 bits (734), Expect = 1.500e-94
Identity = 141/290 (48.62%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EGI ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   +L D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  LD + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   43 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVR----FKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 325          
BLAST of slc25a-24 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 287.345 bits (734), Expect = 1.500e-94
Identity = 141/290 (48.62%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EGI ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   +L D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  LD + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   43 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVR----FKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 325          
BLAST of slc25a-24 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 286.96 bits (733), Expect = 1.845e-94
Identity = 141/290 (48.62%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EGI ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   +L D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  LD + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   40 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVR----FKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 322          
BLAST of slc25a-24 vs. Ensembl Mouse
Match: Slc25a30 (solute carrier family 25, member 30 [Source:MGI Symbol;Acc:MGI:1914804])

HSP 1 Score: 285.804 bits (730), Expect = 1.925e-94
Identity = 142/290 (48.97%), Postives = 192/290 (66.21%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQIQG+    N    F+  RY GM+HA   I ++EG+ ALY G++ A++RQASYGT+K+G Y  LKR++ +    E++  N+ C +++GV SS IANPTDV+KIR+Q++++  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D V  HF SS      G   S PV+V+RTR+MNQ  +        YK  LDCL +T +NE  FAL+KGF P W R+GPWNIIFFLT+E++KK++L
Sbjct:    8 PFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAN----FREIRYRGMLHALMRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQAQNSAVQG-GMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCA-GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL 291          
BLAST of slc25a-24 vs. UniProt/SwissProt
Match: sp|Q5XGI1|KMCP1_XENTR (Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis OX=8364 GN=slc25a30 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 3.865e-94
Identity = 146/290 (50.34%), Postives = 194/290 (66.90%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQ+QG+    N  K ++  RY GM+HA   I K+EG+ ALY G++ A++RQASYGT+K+G Y  LKR+       E++  N+ C V++GV SS IANPTDV+KIR+Q++ +  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF +S      G   S PV+V+RTR+MNQ +I  N  N  YK  LDCL +T +NE  FAL+KGF P W R+GPWNIIFF+T+E++KK+NL
Sbjct:    8 PFIYGGLASITAECGTFPIDLTKTRLQVQGQ---ANDAK-YKEIRYRGMLHAIVRIWKEEGVKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQGSLIQ-GGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSI-RNVSNSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKLNL 291          
BLAST of slc25a-24 vs. UniProt/SwissProt
Match: sp|Q6GQ22|KMCP1_XENLA (Kidney mitochondrial carrier protein 1 OS=Xenopus laevis OX=8355 GN=slc25a30 PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.402e-94
Identity = 147/290 (50.69%), Postives = 193/290 (66.55%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQ+QG+    N  K ++  RY GM+HA   I ++EG+ ALY G++ A++RQASYGT+K+G Y  LKR+       E++  N  C V++GV SS IANPTDV+KIR+Q++ N  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF SS      G   S PV+V+RTR+MNQ +I   S N  YK  LDCL +T +NE  FAL+KGF P W R+GPWNIIFF+T+E++KK+NL
Sbjct:    8 PFIYGGLASITAECGTFPIDLTKTRLQVQGQ---PNDAK-YKEIRYRGMMHAIVRIWREEGVKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVLNAFCGVLSGVVSSCIANPTDVLKIRMQAQGNVMQ-GGMIVNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRSIRDAS-NSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKLNL 291          
BLAST of slc25a-24 vs. UniProt/SwissProt
Match: sp|Q5PQM9|KMCP1_RAT (Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus OX=10116 GN=Slc25a30 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 7.998e-94
Identity = 143/290 (49.31%), Postives = 195/290 (67.24%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQIQG+    N  K F+  RY GM+HA   I ++EG+ ALY G++ A++RQASYGT+K+G Y  LKR++ +    E++  N+ C +++GV SS IANPTDV+KIR+Q++++  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D V  HF SS      G   S PV+V+RTR+MNQ ++     +  YK  LDCL +T +NE  FAL+KGF P W R+GPWNIIFFLT+E++KK++L
Sbjct:    8 PFVYGGLASITAECGTFPIDLTKTRLQIQGQ---TNDAK-FREIRYRGMLHALMRIGREEGLRALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLINVVCGILSGVISSAIANPTDVLKIRMQAQNSAVQG-GMIGNFISIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCS-GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL 291          
BLAST of slc25a-24 vs. UniProt/SwissProt
Match: sp|Q5SVS4|KMCP1_HUMAN (Kidney mitochondrial carrier protein 1 OS=Homo sapiens OX=9606 GN=SLC25A30 PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 8.173e-94
Identity = 145/290 (50.00%), Postives = 194/290 (66.90%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQIQG+    N  K F+  RY GM+HA   I ++EG+ ALY G++ A++RQASYGT+K+G Y  LKR+  +    E++  N+ C +++GV SSTIANPTDV+KIR+Q++SN  Q    +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI   ++ D VY HF SS      G   S PV+V+RTR+MNQ  +     +  Y   LDCL +T +NE  FAL+KGF P W R+GPWNIIFF+T+E++KK++L
Sbjct:    8 PFVYGGLASITAECGTFPIDLTKTRLQIQGQ---TNDAK-FKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQ-GGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCS-GYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL 291          
BLAST of slc25a-24 vs. UniProt/SwissProt
Match: sp|Q9Z2B2|UCP5_MOUSE (Brain mitochondrial carrier protein 1 OS=Mus musculus OX=10090 GN=Slc25a14 PE=1 SV=2)

HSP 1 Score: 287.345 bits (734), Expect = 1.050e-93
Identity = 141/290 (48.62%), Postives = 197/290 (67.93%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFP+D TKTRLQ+QG+ +       F+  +Y GM HA F I K+EGI ALY G++ A++RQASYGT+K+G+Y  LKR+  + +  E++  N+ C VV+GV SSTIANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ V+PTA R+A++VGV LP YD TK  LI   +L D +  HF SS      G   S PV+V+RTR+MNQ  I  + V+  YK  LD + K  ++E  FAL+KGF P W R+GPWNIIFF+T+E++K++ +
Sbjct:   43 PFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVR----FKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQG-SMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGH-VDL-YKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 325          
BLAST of slc25a-24 vs. TrEMBL
Match: A0A0H3YFF7 (Slc25a-24 OS=Schmidtea mediterranea OX=79327 GN=slc25a-24 PE=2 SV=1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 1
Query:  118 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 1005
            MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI
Sbjct:    1 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 296          
BLAST of slc25a-24 vs. TrEMBL
Match: A0A0L8GC09 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035980mg PE=3 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 4.864e-95
Identity = 138/295 (46.78%), Postives = 201/295 (68.14%), Query Frame = 1
Query:  118 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDS--NSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            M D  PF +GG AS+ AE  TFPIDTTKTRLQ+QG+++ +   +     +Y GM HAF  I ++EG+ A Y G+  A++RQA+YGT+K+G+Y  +KR+   N   E+++ N+ C VVAG+ SS+IANPTDV+K+R+Q+K+   Q S F + F Q   KEG +GL++ V+PTA R+A++ GV LP YD TK  ++  + + D+   HF +S  A   G   S P++V++TRLMNQ  + +   + +  Y S+LDC+ +T R E + A ++GFIPTW R+GPWNIIFFLT EK+KK+
Sbjct:    1 MSDWRPFVYGGLASVTAECGTFPIDTTKTRLQVQGQVIDSRLTEC----KYRGMFHAFVRIFREEGLVAFYSGIGPAILRQATYGTIKIGIYQSMKRMFVSNPMDETLATNVFCGVVAGIVSSSIANPTDVLKVRMQAKTESLQTSMF-ESFIQIYKKEGVRGLWRGVVPTAQRAAIVAGVELPVYDITKKHILKSESMEDHAGTHFIASFTAGLAGAITSNPIDVVKTRLMNQRVLKTTNGTASAIYTSSLDCIVQTARTEGLMAFYRGFIPTWIRLGPWNIIFFLTFEKLKKI 290          
BLAST of slc25a-24 vs. TrEMBL
Match: W5NCP3 (Solute carrier family 25 member 14 OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 5.408e-94
Identity = 144/290 (49.66%), Postives = 192/290 (66.21%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFPID TKTRLQ+QG+        H+   RY GM HA   I ++EG+  LY G+S A++RQASYGT+K+G Y  LKR+       E++  N+ C V+AGV SS+IANPTDV+KIR+Q++ +  Q  S +  F     +EG +GL++ VIPTA R+A++VGV LP YD TK  LI   ++ D +Y HF SS      G   S PV+V+RTR+MNQ  +  N +   YK  LD L +T RNE  FAL+KGF P W R+GPWNIIFF+T+E++KK+ L
Sbjct:    8 PFIYGGLASIVAEFGTFPIDLTKTRLQVQGQ-------SHYPEVRYRGMFHALLRIGREEGVRTLYSGISPALLRQASYGTIKIGTYQTLKRLFVTRPEDETMVINVFCGVIAGVISSSIANPTDVLKIRMQAQGSLLQ-GSMMANFIDIYQQEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLILSGLMGDTIYTHFVSSFSCGLAGALASNPVDVVRTRMMNQRVLAGNHL---YKGTLDGLLQTWRNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKLPL 286          
BLAST of slc25a-24 vs. TrEMBL
Match: F1NXC0 (Solute carrier family 25 member 30 OS=Gallus gallus OX=9031 GN=SLC25A30 PE=3 SV=2)

HSP 1 Score: 293.123 bits (749), Expect = 5.915e-94
Identity = 145/290 (50.00%), Postives = 199/290 (68.62%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI AE  TFPID TKTRLQ+QG++   N  K ++  RY GM+HA   I ++EG+ ALY G++ A++RQASYGT+K+G Y  LKR+  ++   E++  N+ C +++GV SS+IANPTDV+KIR+Q++ +  Q    +  F Q    EG KGL+K V  TA R+AL+VGV LP YDFTK ++I    + D VY HF SS      G   S P++V+RTR+MNQ++   N  +  YK  LDCL +T +NE  FAL+KGF P W R+GPWNIIFFLT+E++KK++L
Sbjct:    8 PFLYGGLASITAECGTFPIDLTKTRLQVQGQV---NDAK-YKEIRYRGMMHALVRIFREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRMFVEHPEDETLMINVLCGILSGVISSSIANPTDVLKIRMQAQGSVIQG-GMMCNFIQIYQNEGTKGLWKGVSLTAQRAALVVGVELPVYDFTKKQIIVSGYMGDTVYTHFLSSFTCGLAGALASNPIDVVRTRMMNQAS-QPNGGHSNYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL 291          
BLAST of slc25a-24 vs. TrEMBL
Match: A0A1S3LQK7 (brain mitochondrial carrier protein 1-like isoform X2 OS=Salmo salar OX=8030 GN=LOC106567890 PE=3 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 1.275e-93
Identity = 144/290 (49.66%), Postives = 193/290 (66.55%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFPID TKTRLQ+QG+         +   RY GM HA F I K+EGI ALY G+S A++RQASYGT+K+G Y+ LKR+   +   E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  LI    + D +  HF SS +    G   S PV+V+RTR+MNQ  +  N +   YK  LD + +T +NE  FAL+KGF P W R+GPWNIIFF+T E++KK+NL
Sbjct:    8 PFIYGGMASIVAEFGTFPIDLTKTRLQVQGQ-------SQYMEVRYRGMFHALFKIGKEEGIKALYSGISPALLRQASYGTIKIGTYNTLKRLFVTHPEDETMVINVFCGVVSGVLSSSLANPTDVVKIRMQAQGSLLQ-GSMMSNFISIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIKSGTMGDTILTHFISSFMCGLAGALASNPVDVVRTRMMNQRVLSGNPM---YKGTLDGVMQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITFEQLKKLNL 286          
BLAST of slc25a-24 vs. Ensembl Cavefish
Match: slc25a14 (brain mitochondrial carrier protein 1 [Source:NCBI gene;Acc:103031802])

HSP 1 Score: 284.648 bits (727), Expect = 3.297e-94
Identity = 144/290 (49.66%), Postives = 192/290 (66.21%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            PF +GG ASI+AE  TFPID TKTRLQ+QG+   +  M+     RY GM HA   I ++EGI ALY G+S A++RQASYGT+K+G Y+ LK++       E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  LI    + D V  HF SS      G   S PV+V+RTR+MNQ  +  N +   YK  LD L +T RNE  FAL+KGF P W R+GPWNIIFF+T+E++KK+ L
Sbjct:    8 PFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ---SQCMEV----RYRGMFHALLRIGREEGIRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSRPEDETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQ-GSMMANFINIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGTMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRVLSGNLL---YKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTYEQLKKLPL 286          
BLAST of slc25a-24 vs. Ensembl Cavefish
Match: slc25a14 (brain mitochondrial carrier protein 1 [Source:NCBI gene;Acc:103031802])

HSP 1 Score: 267.314 bits (682), Expect = 4.729e-87
Identity = 138/284 (48.59%), Postives = 183/284 (64.44%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFL 972
            ++  PF +GG ASI+AE  TFPID TKTRLQ+QG+   +  M+     RY GM HA   I ++EGI ALY G+S A++RQASYGT+K+G Y+ LK++       E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  LI    + D V  HF SS      G   S PV+V+RTR+MNQ  +  N +   YK  LD L +T RNE  FAL+KGF P W R+GPWNII  L
Sbjct:    4 LNWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ---SQCMEV----RYRGMFHALLRIGREEGIRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSRPEDETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQ-GSMMANFINIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGTMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRVLSGNLL---YKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIVSL 276          
BLAST of slc25a-24 vs. Ensembl Cavefish
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:103027476])

HSP 1 Score: 198.749 bits (504), Expect = 2.062e-60
Identity = 100/293 (34.13%), Postives = 162/293 (55.29%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSK-SNYTQNSSF---LKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            F   G A+ IA++ TFP+DT K RLQIQGE        H Q  +Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K+  ++      I + +      G  +  +A PTDV+K+R Q++ S  T N  +   +  +     +EGF+GL+K   P  AR+A++    L TYD  K  LI    + D++ CHF S+  A    T ++ PV+V++TR M       NS   +Y  AL+C    +  E   A +KGF+P++ R+G WN++ F+T+E++K+  +
Sbjct:   17 FIGAGTAACIADLFTFPLDTAKVRLQIQGESSGTAKASHGQAAKYRGVFGTITTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLLAGCTTGAMAVAVAQPTDVVKVRFQAQVSGCTTNKRYQGTMDAYRTIAREEGFRGLWKGTGPNIARNAIVNCTELVTYDLIKDALIRSTPMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYM-------NSAQGQYSGALNCAVAMLTKEGPMAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM 302          
BLAST of slc25a-24 vs. Ensembl Cavefish
Match: ucp1 (uncoupling protein 1 [Source:NCBI gene;Acc:103037750])

HSP 1 Score: 192.971 bits (489), Expect = 3.524e-58
Identity = 95/290 (32.76%), Postives = 167/290 (57.59%), Query Frame = 1
Query:  148 GAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYT----QNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 1005
            G A+ IA++ TFP+DT K RLQIQGE      ++  +G RY G+      +++ EG  +LY GL A + RQ ++ ++++GLYD +K   ++     ++   I      G  + ++A PTDV+K+R Q++ N      + +  ++ + Q   +EG +GL+K  +P   R+AL+    L +YD  K  ++  ++L DN+ CHF S+  A    T ++ PV+V++TR M       NS   +YKSA++C    +  E   A +KGF+P++ R+G WN++ F++ E++K+  ++
Sbjct:   21 GTAACIADLVTFPLDTAKVRLQIQGE----KAVEAAKGIRYRGVFGTISTMVRTEGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKSFYTRGKDNPNVGIRILAGCTTGAMAVSMAQPTDVVKVRFQAQMNLQGVARRYNGTMQAYRQIFHQEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHKLLSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYM-------NSPPGQYKSAINCAWTMMTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLKRAMMV 299          
BLAST of slc25a-24 vs. Ensembl Cavefish
Match: ucp3 (mitochondrial uncoupling protein 2-like [Source:NCBI gene;Acc:103026990])

HSP 1 Score: 192.586 bits (488), Expect = 5.436e-58
Identity = 101/299 (33.78%), Postives = 164/299 (54.85%), Query Frame = 1
Query:  124 DLYP-----FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNS----SFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            DL P     FF  G A+ IA++ TFP+DT K RLQIQGE   +   +   G +Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K+  ++     SI + +      G  +   A PTDV+K+R Q++      +    S +  +      EG KGL+K  +P   R+A++    L TYD  K  ++   ++ DN+ CHF ++  A    T V+ PV+V++TR MN S         +Y SA++C    +  E   A +KGF+P++ R+G WNI+ F+++E+IK+
Sbjct:    8 DLAPTAAVKFFGAGTAACIADLVTFPLDTAKVRLQIQGE---SKPAEGVAGTKYRGVFGTINTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGSEEASIVSRLMAGCTTGAMAVAFAQPTDVVKVRFQAQVRVADGAKRYNSTMDAYRTIARNEGIKGLWKGCLPNITRNAIVNCAELVTYDIIKELILKYNLMTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSS-------PGQYSSAINCAITMLTKEGPTAFYKGFMPSFLRLGSWNIVMFVSYEQIKR 296          

HSP 2 Score: 62.003 bits (149), Expect = 2.270e-10
Identity = 47/176 (26.70%), Postives = 77/176 (43.75%), Query Frame = 1
Query:  184 PIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKR-ISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQ 708
            P D  K R Q Q  +            RYN  + A+  I + EGI  L++G    + R A     ++  YD +K  I   N+  +++  +   A  AG  ++ +A+P DV+K R  + S   Q SS +      ++KEG    YK  +P+  R      V+  +Y+  K  +   Q
Sbjct:  135 PTDVVKVRFQAQVRVADG-------AKRYNSTMDAYRTIARNEGIKGLWKGCLPNITRNAIVNCAELVTYDIIKELILKYNLMTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSSP-GQYSSAINCAITMLTKEGPTAFYKGFMPSFLRLGSWNIVMFVSYEQIKRAMTRAQ 302          

HSP 3 Score: 50.447 bits (119), Expect = 1.373e-6
Identity = 45/192 (23.44%), Postives = 77/192 (40.10%), Query Frame = 1
Query:  478 TSSTIAN----PTDVIKIRLQSKSNY--------TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYD-----FTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            T++ IA+    P D  K+RLQ +           T+           +  EG + LY  ++    R      V +  YD     +T+G    E  ++  +     +  +A  F      P +V++ R   Q  +   +   +Y S +D  +   RNE I  LWKG +P   R    N    +T++ IK++ L
Sbjct:   22 TAACIADLVTFPLDTAKVRLQIQGESKPAEGVAGTKYRGVFGTINTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGS--EEASIVSRLMAGCTTGAMAVAFAQ----PTDVVKVRFQAQVRVADGA--KRYNSTMDAYRTIARNEGIKGLWKGCLPNITRNAIVNCAELVTYDIIKELIL 205          
BLAST of slc25a-24 vs. Ensembl Sea Lamprey
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:555812])

HSP 1 Score: 193.356 bits (490), Expect = 5.056e-59
Identity = 97/290 (33.45%), Postives = 158/290 (54.48%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNY----TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            F   G A+ IA++ TFP+DT K RLQ+QGE  +        G +Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K   +       I   +      G  + T A PTDV+K+R Q++ N      + S  +  +     +EG +GL+K   P   R+A++    L TYD  K  ++  ++L DN+ CHF S+  A    T V+ PV+V++TR M       NS   +Y+SA +C    +  E   A +KGF+P++ R+G WN++ F+T+E++K+
Sbjct:   17 FIGAGTAACIADLITFPLDTAKVRLQVQGECQRGEGAARSAGVQYRGVFGTIAAMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKNFYTNGAEHAGIGCRLLAGCTTGAMAVTFAQPTDVVKVRFQAQVNMLGTSKRYSGTMNAYKTIAREEGVRGLWKGTGPNITRNAIVNCAELVTYDIIKDTILKYKLLTDNLPCHFVSAFGAGFCTTVVASPVDVVKTRYM-------NSAPGQYRSAFNCAYLMLTKEGAMAFYKGFVPSFLRLGSWNVVMFVTYEQLKR 299          
BLAST of slc25a-24 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 94.3597 bits (233), Expect = 2.278e-21
Identity = 73/293 (24.91%), Postives = 129/293 (44.03%), Query Frame = 1
Query:  127 LYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLIT---EQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            L     GGAA  ++   T P+D  K  +Q+ G   K+N +    G         F  +IK+ GI++L+RG    VI+ A    +K   Y+++K+    N     I        +AG T+ TI  P +V+K RL  +    Q S  +    +   KEG    YK  +P         G+ L  Y+  K   +T   +      +    A   V+++ G   S P+ +IRTR+  Q++++         S +   +  ++N+    L++G  P + ++ P   I ++ +E +K+V
Sbjct:  211 LRQLMAGGAAGAVSRTGTAPLDRMKVFMQVHGS--KSNNISILTG---------FKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKFIGSNNVSLGIHERFMAGSLAGATAQTIIYPMEVMKTRLTLRKT-GQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADPGILVLLACGTVSSSCGQVASYPLALIRTRMQAQASMEGGP----QLSMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRV 487          
BLAST of slc25a-24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 2.745e-20
Identity = 62/288 (21.53%), Postives = 131/288 (45.49%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITE---QILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
               GG A +++  CT P+D  K  +Q++    ++NT+     G   G+ H    +I++ G+ +L+RG    VI+ A    +K   Y+++K++         +   +    +AG T+ T+  P +V+K RL +     Q SS +    +   +EG +  +K  +P         G+ L TY+  K   + +   +     +      +  ++T G   S P+ ++RTR+   ++I     +      L  ++  ++ + +  L++G  P + ++ P   I ++ +E +K
Sbjct:   28 LVAGGGAGVVSRTCTAPLDRLKVIMQVKAS--RHNTI-----GVVGGLAH----MIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKKLIGMRQEQIGVQERLVAGSLAGATAQTVIYPMEVVKTRL-ALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANPGIAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQPGMVGL--MRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLK 301          

HSP 2 Score: 57.3806 bits (137), Expect = 1.773e-9
Identity = 44/195 (22.56%), Postives = 79/195 (40.51%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIAN----PTDVIKIRLQSKSNY----TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKL 696
               G  A   A+   +P++  KTRL +             + G+Y+ M+     I K+EG+ A ++G    V+    Y  + +  Y+ LK    Q    E  +  IA  +    TSST       P  +++ R+Q+ ++           +      + ++G  GLY+ + P   +    VG+    Y+  KG L
Sbjct:  122 LVAGSLAGATAQTVIYPMEVVKTRLALG------------KTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANPGIAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQPGMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLKGAL 304          
BLAST of slc25a-24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 5.280e-20
Identity = 69/284 (24.30%), Postives = 117/284 (41.20%), Query Frame = 1
Query:  163 IAEICTFPIDTTKTRLQIQ-------GELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            +     +PID  KTR+Q Q       GEL+  N+   F+             +++ EG+  LYRGL   ++  A    +K+ + D ++   ++  +   +   I     AG +     NP +++KIRLQ     T            +   GF GLYK       R      +  P Y  TK     E+  +  ++   A ++      + V+ P +VI+TRL     + + +    Y   +DC +K +  E   ALWKG      R  P   +  LT+E +++
Sbjct:    2 VGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFK------------KVVRYEGVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDKSIPLIGEIIAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRV--SALNVLRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLLTAGAIAGMPAASLVT-PADVIKTRL----QVAARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYELLQQ 266          

HSP 2 Score: 63.5438 bits (153), Expect = 2.048e-11
Identity = 45/181 (24.86%), Postives = 78/181 (43.09%), Query Frame = 1
Query:  145 GGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQ--SKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDF 681
            GG A     I T P++  K RLQ+ GE+     +                 +++  G   LY+G  A  +R   +  +   +Y   K   +         + +    +AG+ ++++  P DVIK RLQ  +++  T  S  +  F + +S+EG + L+K       RS+   GV L TY+ 
Sbjct:   96 GGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALN-------------VLRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYEL 263          
BLAST of slc25a-24 vs. Ensembl Sea Lamprey
Match: SLC25A40 (solute carrier family 25 member 40 [Source:HGNC Symbol;Acc:HGNC:29680])

HSP 1 Score: 82.8037 bits (203), Expect = 6.155e-18
Identity = 63/291 (21.65%), Postives = 125/291 (42.96%), Query Frame = 1
Query:  184 PIDTTKTRLQIQGE--------LLKNNTMKHF--------------QGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKS-NYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYC-HFASSLVAATFGTCVSCPVEVIRTRL-MNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHE 981
            P+D  K RLQ Q          +  N  M H                 G  NG + AF  I++ EG+++L+ GL   ++       +    YD L+   +++   +  S       VA + + T+ +P ++I+ ++QS+   Y + S  ++    +++++G++ L++   PT  R     G+    Y+  K  L+    +    +  HF S  V+ TF    + P +V++TR  +    ++     ++  S    +K+      +  L+ GF+P   ++ P   I   T+E
Sbjct:    3 PLDVVKIRLQAQQTPFYKGKCFVYCNGLMDHLCVCMNGNSKAWYKPAPGYVNGTLDAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSLARHFNSQHPSIPFVAGAVARLGAVTVISPLELIRTKMQSRQLTYKELSECVR---HSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGLMGSAGVNQATFLIHFTSGAVSGTFAGIATLPFDVVKTRRQIELGEMEITKGAFRDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYE 290          

HSP 2 Score: 55.8398 bits (133), Expect = 4.797e-9
Identity = 46/197 (23.35%), Postives = 78/197 (39.59%), Query Frame = 1
Query:  499 PTDVIKIRLQ-----------------------------SKSNYTQNSSF----LKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            P DV+KIRLQ                             SK+ Y     +    L  F Q +  EG   L+  + PT   +     +   +YD  +  L        +    F +  VA      V  P+E+IRT++         S    YK   +C++ ++  +   +LW+G+ PT +R  P++ +++L +E IK
Sbjct:    3 PLDVVKIRLQAQQTPFYKGKCFVYCNGLMDHLCVCMNGNSKAWYKPAPGYVNGTLDAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSL-ARHFNSQHPSIPFVAGAVARLGAVTVISPLELIRTKM--------QSRQLTYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIK 190          
BLAST of slc25a-24 vs. Ensembl Yeast
Match: DIC1 (Mitochondrial dicarboxylate carrier; integral membrane protein, catalyzes a dicarboxylate-phosphate exchange across the inner mitochondrial membrane, transports cytoplasmic dicarboxylates into the mitochondrial matrix [Source:SGD;Acc:S000004340])

HSP 1 Score: 134.035 bits (336), Expect = 8.838e-37
Identity = 86/297 (28.96%), Postives = 143/297 (48.15%), Query Frame = 1
Query:  130 YPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTIS--------KEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITE-QILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            YP+++GGAA I A + T P+D  K RLQ    + K    +  +             I+  EG+  LY GLSAAV+RQ +Y T++ G YD LK       +  +++  + C++ +G       N  DV+ IR+Q+ S     ++  + +   I         + G K L+    P   R  L+    + TYD  K  L+T+        Y H  +SL+A    T V  P +V++TR+MN S          ++ AL  L   +R E    +++G++P++ R+GP+ ++ F   E++KK
Sbjct:   15 YPWWYGGAAGIFATMVTHPLDLAKVRLQ-AAPMPKPTLFRMLES------------ILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDS--ALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSG--------DHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKK 288          
BLAST of slc25a-24 vs. Ensembl Yeast
Match: OAC1 (Mitochondrial inner membrane transporter; transports oxaloacetate, sulfate, thiosulfate, and isopropylmalate; member of the mitochondrial carrier family [Source:SGD;Acc:S000001603])

HSP 1 Score: 128.257 bits (321), Expect = 2.007e-34
Identity = 89/300 (29.67%), Postives = 134/300 (44.67%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQ-------NMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNY------TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            F  GG A+ IA   T PI+  K R+Q+QGE      M       Y   I    VI K EGI  L +GL+AA I Q      ++G Y+ ++   +Q         + +S+  N+     +G+  + I +P  ++K RLQS S +      T  +            EG KGL++ +     R+     V LP Y+  K  L+   ++ D    H  +S ++      V  P +VI TR+ NQ           YK  +DCL KT+R E + AL+KGF    +RI P  I+     E+  K+
Sbjct:   26 FVAGGLAACIAVTVTNPIELIKIRMQLQGE------MSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK-------GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312          
BLAST of slc25a-24 vs. Ensembl Yeast
Match: ODC2 (Mitochondrial inner membrane transporter; 2-oxodicarboxylate transporter, exports 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol for use in lysine and glutamate biosynthesis and in lysine catabolism; ODC2 has a paralog, ODC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005748])

HSP 1 Score: 110.923 bits (276), Expect = 3.819e-28
Identity = 84/278 (30.22%), Postives = 129/278 (46.40%), Query Frame = 1
Query:  127 LYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQ--NMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQS-KSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGP 951
            +Y F  G  A I      +P+D  KTR Q++        +   Q  RYNG+I     I+K+EG S LYRG+S+ ++ +A     K    D+ ++I     N    +   +IA    AG+T + +  P ++IKIR+Q  KS+Y      LK   +TI  EG  GLYK +  T  R+AL  G         +  +   +           +  +  T GT ++ P +V+++R+  QS    +S   KY   L  L    R E   AL+KGF+P   R+ P
Sbjct:   13 IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGK-QVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLK---KTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI--QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284          

HSP 2 Score: 57.3806 bits (137), Expect = 9.160e-10
Identity = 49/181 (27.07%), Postives = 75/181 (41.44%), Query Frame = 1
Query:  466 VAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKE----------FTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFG---TCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFF 969
            VAG++  T+  P DV+K R Q +      ++  K+            + + KEGF  LY+ +       A          D  + + I + +   N      S    A+ G     V  P E+I+ R+ +        V   Y   +DCLKKTI+NE I  L+KG   T +R   WN  +F
Sbjct:   21 VAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACND--QYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQD--------VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191          
BLAST of slc25a-24 vs. Ensembl Yeast
Match: YEA6 (Putative mitochondrial NAD+ transporter; member of the mitochondrial carrier subfamily (see also YIA6); has putative human ortholog; YEA6 has a paralog, YIA6, that arose from the whole genome duplication [Source:SGD;Acc:S000000732])

HSP 1 Score: 100.523 bits (249), Expect = 2.686e-24
Identity = 79/294 (26.87%), Postives = 132/294 (44.90%), Query Frame = 1
Query:  145 GGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLK----EFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYD-------FTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            G  +  ++ +   P D  KTRLQ QG  L+N  M H Q   Y G    F  I K EG + LY+GL   V+       +   +YD  ++ S          +N + A+ AG  S+   NP  V+K RL  ++   + S+  K     F + I +EG K LY  ++P A    L V +  P Y+       +++   ++  +   N      +S+++    + V+ P E++RTR+  +S++  N+V    +  L  +K T R E     + GF     R  P  ++  ++ E  KK
Sbjct:   45 GALSGALSAMLVCPFDVAKTRLQAQG--LQN--MTH-QSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVP-ALLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDL-PNTVQ---RHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKK 328          

HSP 2 Score: 69.3218 bits (168), Expect = 1.445e-13
Identity = 65/235 (27.66%), Postives = 110/235 (46.81%), Query Frame = 1
Query:   49 LEIDFDNFNFFKYYSF*QVS*FIMIDLYP---FFHGGAASI----IAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLK----RISSQNMRGESISNN----IACAVVAGVTSSTIANPTDVIKIRLQSKSNY--TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLIT 702
            L I F  ++F + YS         +D++P   F    +++I    I+ + T PI   KTRL +Q  + K +T        Y G I  F  II+QEG  ALY GL  A++   +   ++  LY+ LK       S ++  +  S+N    I  ++++ + +ST+  P ++++ R+Q KS+   T     L     T  +EGF G Y        R+     V L +++++K  L T
Sbjct:  115 LMIYFSVYDFCRKYS---------VDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYST-------HYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVA-IQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYLTT 332          
BLAST of slc25a-24 vs. Ensembl Yeast
Match: AAC3 (Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Aac1p; has roles in maintenance of viability and in respiration; AAC3 has a paralog, PET9, that arose from the whole genome duplication [Source:SGD;Acc:S000000289])

HSP 1 Score: 99.7525 bits (247), Expect = 3.341e-24
Identity = 73/272 (26.84%), Postives = 123/272 (45.22%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRI---SSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQS------KSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVY-CHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKG 921
            F  GG ++ IA+    PI+  K  +Q Q E++K  T+      +Y+G++  F    KQEG+ + +RG +A VIR      +     DK+K +     +   G+  + N+A    AG  S       D  + RL +      K    Q +     + +T+  +G  GLY+  +P+     +  G+    +D  K  ++T    LD  +   F    V  T  +  S P++ +R R+M  S         KY  A+DCLKK + +E + +L+KG
Sbjct:   16 FLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDK----KYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGS--LDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSG-----QAVKYNGAIDCLKKIVASEGVGSLFKG 276          

HSP 2 Score: 55.4546 bits (132), Expect = 4.397e-9
Identity = 43/179 (24.02%), Postives = 76/179 (42.46%), Query Frame = 1
Query:  145 GGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYT-QNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYD 678
            GGAA  ++ +  + +D  +TRL    +  K    + F     NG+   +   +K +GI+ LYRG   +V+    Y  +  G++D LK +        S   +     V    +ST + P D ++ R+   S    + +  +    + ++ EG   L+K       RS    GV +  YD
Sbjct:  123 GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQF-----NGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV-ISMYD 295          

HSP 3 Score: 46.9802 bits (110), Expect = 2.293e-6
Identity = 27/95 (28.42%), Postives = 46/95 (48.42%), Query Frame = 1
Query:  127 LYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRI 411
            L  F  G   +  A  C++P+DT + R+           M   Q  +YNG I     I+  EG+ +L++G  A ++R  + G   + +YD+L+ I
Sbjct:  217 LASFLLGWVVTTGASTCSYPLDTVRRRMM----------MTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVA-GAGVISMYDQLQMI 300          

HSP 4 Score: 46.9802 bits (110), Expect = 2.623e-6
Identity = 24/91 (26.37%), Postives = 42/91 (46.15%), Query Frame = 1
Query:  721 NVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSN-IDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            N   +F    V+A      + P+E ++  + NQ   I   +++ KY   +DC K+T + E + + W+G      R  P   + F   +KIK
Sbjct:   11 NFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIK 101          
BLAST of slc25a-24 vs. Ensembl Nematostella
Match: EDO39987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H5])

HSP 1 Score: 259.996 bits (663), Expect = 9.224e-85
Identity = 130/295 (44.07%), Postives = 191/295 (64.75%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNY---TQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSN--IDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            +D  PF +GG AS+ AE+CTFPIDTTKTRLQ+QG++         +  RY GM HAFF I K+EGI AL+ G+S A++RQA+YG++K+G+Y  LKRI  ++ + E++  N  C VVAG   S + NPTDV+KIR+Q++      +  +S L  F     +EG +GLY+ V PT+ R+A++ GV LP YD  K  ++ ++++ D+   HF +S +A   G   S P++V +TR+MNQ N  + +      Y+SA  CL  T R E  FAL++GFIP + R+ PWNI+FF+ +E+ K
Sbjct:    1 MDYKPFLYGGLASMTAELCTFPIDTTKTRLQLQGQVTDTKQ----KAIRYRGMFHAFFRITKEEGIRALFNGVSPALLRQATYGSLKLGIYHSLKRILVKDPKDETLFVNGFCGVVAGALGSAVCNPTDVLKIRMQAEYRAGAGSSKTSMLVAFGDMYRQEGIRGLYRGVGPTSQRAAVIAGVELPVYDSAKRFILDKKLMGDHPGTHFVASAIAGLAGAIASNPIDVAKTRMMNQRNLKVKTEGGPVLYRSASHCLVVTFRTEGFFALYRGFIPNFARLCPWNIVFFMAYEQYK 291          
BLAST of slc25a-24 vs. Ensembl Nematostella
Match: EDO34326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPL4])

HSP 1 Score: 197.208 bits (500), Expect = 3.410e-60
Identity = 105/291 (36.08%), Postives = 163/291 (56.01%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGEL-LKNNTMKHFQGGRYNGMIH-AFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRI-SSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSK--SNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            F  GG + + A   T PI+  K R+Q+  EL  K+N+   F+   Y G+I      + ++EG+  LYRG+  A++RQA Y + ++G Y+ +K +  + +    ++   I   V +GV  S IA PTD++KIR Q+          +    F +   KEGF GL+  + PT  R+A + G  +PTYD TK  L+  +++ + V  H AS+LVA    TCV+ PV+++RTR M Q   D+      Y+  LDC+ KT+R+E I AL+KGF P W R G   II F  +E++++
Sbjct:   12 FVLGGLSCMTATTVTNPIEVVKIRMQLDNELGSKHNSKDIFRERYYKGLIRTGLSRVYREEGVRGLYRGIFPALLRQAIYSSTRLGAYEPIKNLLGATDSTSAALWKKIVAGVSSGVIGSAIATPTDLVKIRFQAVKIGETIPYKNMFHAFYKIAKKEGFLGLWTGMKPTVKRAACISGTQIPTYDHTKHLLLNAELMREGVALHLASALVAGFVATCVASPVDIVRTRFMTQPK-DTKGRPLVYQGTLDCIYKTVRHEGILALYKGFFPNWTRTGLDTIIIFFVYERLRR 301          
BLAST of slc25a-24 vs. Ensembl Nematostella
Match: EDO50034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF50])

HSP 1 Score: 189.889 bits (481), Expect = 2.551e-57
Identity = 106/298 (35.57%), Postives = 165/298 (55.37%), Query Frame = 1
Query:  127 LYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGR------YNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRI-SSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSN-YTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            L  F   G A+ IAE  T PIDT K RLQIQGE     ++   QG R      Y GM+     + K EG+  +Y+GL   + RQ  + ++++GLYD++K +    +++   I   IA ++  G+ + ++A PT+V+KIR Q+ +  YT  S  +  + +    EG KGL+K V P  AR   +    L  YD  KG  + +Q + D    HF S+  A    TCV+ PV+V++TR M       NS    YKS +DC  +  ++  IFA +KGF+P + R+G WNI+ F+++E++K++
Sbjct:   15 LVKFCSAGIAASIAEAATIPIDTAKVRLQIQGESAVMASIA--QGVRTTHDAHYRGMLGTMVTLFKTEGMKTMYKGLIPGIHRQLCFASIRIGLYDQVKAMYGDTDVQNPKILKKIAASITTGIMAVSVAQPTEVVKIRFQADAGRYT--SGTMGTYAEIARNEGMKGLWKGVFPNMARLCTVNVTELVVYDSIKGLFLRKQWMADEFPLHFVSAFGAGFVTTCVASPVDVVKTRYM-------NSPANTYKSGIDCAVQLFKHNGIFAYYKGFMPNFVRLGSWNIVMFVSYEQLKRL 301          
BLAST of slc25a-24 vs. Ensembl Nematostella
Match: EDO32885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS5])

HSP 1 Score: 170.244 bits (430), Expect = 6.025e-50
Identity = 94/299 (31.44%), Postives = 159/299 (53.18%), Query Frame = 1
Query:  127 LYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLK-RISSQNMRGE-SISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYT-------QNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            L  F    AA+ +AE  TFP+D TKTRLQIQGE          Q   Y GMI     I+++EG+  L++G++ A++R   Y   +M +Y+ L+  +  ++  G   +  ++   + AG     I++PTD++K+++Q +           +       F   + K GF+GL+K  +P   R+AL+    L TYD  K  L+    L DN   H  SS+ +      +S P +VI+TR+MN  +         Y+ A++C    +  E + +L+KG++PTW R+ PW++ F+L++E+I+K+
Sbjct:    9 LRKFGFSSAAATVAETVTFPLDITKTRLQIQGERASMVASSSTQPVAYRGMIKTATGIVEEEGLKNLWKGVTPAIMRHVVYTGSRMTVYEFLRNNVLKRDPDGRFPLWKSVISGMSAGALGQFISSPTDLVKVQMQMEGRRVLIEKRPPRVRGTFHAFRNIVDKYGFRGLWKGWLPNVQRAALVNMGDLTTYDTVKHNLLKHTRLEDNWIVHSMSSVCSGLVAATISTPADVIKTRIMNNPS--------GYQGAVECFMLAVHREGLLSLYKGWLPTWTRMAPWSLTFWLSYEEIRKL 299          
BLAST of slc25a-24 vs. Ensembl Nematostella
Match: EDO25509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWA0])

HSP 1 Score: 165.236 bits (417), Expect = 8.954e-49
Identity = 86/233 (36.91%), Postives = 140/233 (60.09%), Query Frame = 1
Query:  307 QEGISALY-RGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSK----SNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            +EG+  L+ RGL+A+++R+ SY +++MGLYD ++ I   + +  +++N I    V+G   S + NP DV+KIR+Q +       T+  +    F Q    EG +GLYK V  T  R+A+L    L +YD +K  L+  +   D+   HF S+L++    T  + PV+VI+TRLMN  +   +++   YK++LDCL KTIRNE I AL++GF+P + R+GP  I     +E+++
Sbjct:    2 KEGVLTLWKRGLAASMLREGSYSSIRMGLYDPVRTILVGDAKEVTLTNKILAGFVSGGLGSCLINPADVVKIRIQGEIRVPGQPTRYKNTFHAFYQIWKDEGIRGLYKGVGATTLRAAILTSAQLSSYDHSKHMLLKTKYFNDDFKTHFTSALISGFVTTTATSPVDVIKTRLMNDKSTAKDAL---YKNSLDCLVKTIRNEGILALYRGFLPNYLRLGPHFIFSLPLYEQLR 231          

HSP 2 Score: 73.9442 bits (180), Expect = 3.574e-15
Identity = 54/185 (29.19%), Postives = 83/185 (44.86%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMR-GESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSF---LKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYD 678
            F  GG  S +      P D  K R  IQGE+         Q  RY    HAF+ I K EGI  LY+G+ A  +R A   + ++  YD  K +  +     +    +   A+++G  ++T  +P DVIK RL +  +  +++ +   L    +TI  EG   LY+  +P   R        LP Y+
Sbjct:   55 FVSGGLGSCLIN----PADVVKIR--IQGEIRVPG-----QPTRYKNTFHAFYQIWKDEGIRGLYKGVGATTLRAAILTSAQLSSYDHSKHMLLKTKYFNDDFKTHFTSALISGFVTTTATSPVDVIKTRLMNDKSTAKDALYKNSLDCLVKTIRNEGILALYRGFLPNYLRLGPHFIFSLPLYE 228          
BLAST of slc25a-24 vs. Ensembl Medaka
Match: slc25a14 (solute carrier family 25 member 14 [Source:NCBI gene;Acc:101158716])

HSP 1 Score: 283.108 bits (723), Expect = 1.272e-93
Identity = 141/288 (48.96%), Postives = 188/288 (65.28%), Query Frame = 1
Query:  133 PFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKV 996
            PF +GG ASI+AE  TFPID TKTRLQ+QG+         +   RY GM HA F I K+EGI ALY G+S A++RQASYGT+K+G Y+ LKR+       E++  N+ C VV+GV SS++ANPTDV+KIR+Q++ +  Q  S +  F      EG +GL++ VIPTA R+A++VGV LP YD TK  L+   ++ D V  HF SS      G   S PV+V+RTR+MNQ  +  +     YK  L  + +T RNE  FAL+KGF P W R+GPWNIIFF+T E++KK+
Sbjct:    8 PFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ-------SQYMEVRYRGMFHALFRIGKEEGIRALYSGISPALLRQASYGTIKIGTYNSLKRLFVSRPEDETMVLNVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQG-SMMSNFINIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLLGSGVMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRVLSGSPT---YKGTLHGVMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFITFEQLKKL 284          
BLAST of slc25a-24 vs. Ensembl Medaka
Match: SLC25A30 (kidney mitochondrial carrier protein 1 [Source:NCBI gene;Acc:101158137])

HSP 1 Score: 281.182 bits (718), Expect = 7.222e-93
Identity = 140/294 (47.62%), Postives = 191/294 (64.97%), Query Frame = 1
Query:  121 IDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            ++  PF  GG AS+ AE  TFPID TKTRLQ+QG++      + ++  RY GM+HA   I K+EG  ALY G++ A++RQASYGT+K+G Y   KR+       E++  N+AC +++GV SS+IANPTDV+KIR+Q++ N  Q  S +  F     +EG +GL+K V  TA R+A++VGV LP YD TK  LI    + D VY HF SS V    G   S PV+V+RTR+MNQ           Y+  LDCL +T R+E   AL+KGF P W R+GPWNIIFFLT+E++KK+++
Sbjct:    4 VNWKPFVFGGLASVTAECGTFPIDLTKTRLQVQGQVGD----RRYREIRYRGMLHAIMRIGKEEGPRALYSGIAPAMLRQASYGTIKIGTYQSFKRLLVDRPEDETLLTNVACGILSGVISSSIANPTDVLKIRMQAQGNVIQ-GSMMGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGYMGDTVYTHFLSSFVCGLAGALASNPVDVVRTRMMNQRG------GALYQGTLDCLLQTWRSEGFMALYKGFFPNWLRLGPWNIIFFLTYEQLKKIDV 286          
BLAST of slc25a-24 vs. Ensembl Medaka
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:101160682])

HSP 1 Score: 199.904 bits (507), Expect = 6.963e-61
Identity = 104/296 (35.14%), Postives = 165/296 (55.74%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTIS-------KEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            F   G A+ IA++ TFP+DT K RLQIQGE   + ++       Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K+  ++     SI   +      G  +  +A PTDV+KIR Q++   T+++   K +  TI        +EG +GL+K   P  ARSA++    L TYDF K  L+    L DN+ CHF S+  A    T ++ PV+V++TR M       NS   +Y S L+C    +  E  FA +KGF+P++ R+G WN++ F+T+E++K+  +
Sbjct:   17 FVGAGTAACIADLLTFPLDTAKVRLQIQGEAAASASIGRVPASMYRGVFGTIITMVRTEGPLSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTRGSDHVSIGTRLLAGSTTGAMAVALAQPTDVVKIRFQAQ---TRSNEHTKRYCGTIDAYKTIAKEEGVRGLWKGTGPNIARSAIVNCTELVTYDFIKDMLLKSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYM-------NSAPGQYGSVLNCAAVMMTKEGPFAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM 302          
BLAST of slc25a-24 vs. Ensembl Medaka
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:101160682])

HSP 1 Score: 199.904 bits (507), Expect = 8.994e-61
Identity = 104/296 (35.14%), Postives = 165/296 (55.74%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTIS-------KEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            F   G A+ IA++ TFP+DT K RLQIQGE   + ++       Y G+      +++ EG  +LY GL A + RQ S+ ++++GLYD +K+  ++     SI   +      G  +  +A PTDV+KIR Q++   T+++   K +  TI        +EG +GL+K   P  ARSA++    L TYDF K  L+    L DN+ CHF S+  A    T ++ PV+V++TR M       NS   +Y S L+C    +  E  FA +KGF+P++ R+G WN++ F+T+E++K+  +
Sbjct:   17 FVGAGTAACIADLLTFPLDTAKVRLQIQGEAAASASIGRVPASMYRGVFGTIITMVRTEGPLSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTRGSDHVSIGTRLLAGSTTGAMAVALAQPTDVVKIRFQAQ---TRSNEHTKRYCGTIDAYKTIAKEEGVRGLWKGTGPNIARSAIVNCTELVTYDFIKDMLLKSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYM-------NSAPGQYGSVLNCAAVMMTKEGPFAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM 302          
BLAST of slc25a-24 vs. Ensembl Medaka
Match: ucp1 (mitochondrial uncoupling protein 2 [Source:NCBI gene;Acc:101167272])

HSP 1 Score: 198.749 bits (504), Expect = 2.232e-60
Identity = 102/290 (35.17%), Postives = 163/290 (56.21%), Query Frame = 1
Query:  148 GAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYT----QNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 1005
            GAA+ +A+I TFP+DT K RLQIQGE       K  +G RY G+      +I+ EG  +LY GL A + RQ  + ++++GLYD +K   +      ++   I      G  + + A PTDV+K+R Q++ N      + S  ++ + Q    EG +GL+K  +P   R+AL+    L TYD  K  ++  Q+L DN+ CHF S+  A    T ++ PV+V++TR M       NS   +Y+SA++C    +  E   A +KGF+P++ R+G WN++ F+T E+IK+  ++
Sbjct:   21 GAAACVADIVTFPLDTAKVRLQIQGE------KKAVEGIRYRGVFGTISTMIRTEGPRSLYNGLVAGLQRQVCFASIRIGLYDNVKNFYTGGKDNPNVLIRILAGCTTGAMAVSFAQPTDVVKVRFQAQMNLNGVARRYSGTMQAYRQIFQNEGMRGLWKGTLPNITRNALVNCTELVTYDLIKEAILRHQLLSDNLPCHFVSAFGAGFVTTVIASPVDVVKTRYM-------NSPPGQYRSAINCAWTMLTKEGPTAFYKGFVPSFLRLGSWNVVMFVTFEQIKRAMMV 297          

HSP 2 Score: 63.1586 bits (152), Expect = 1.072e-10
Identity = 48/179 (26.82%), Postives = 82/179 (45.81%), Query Frame = 1
Query:  184 PIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVV----AGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQ 708
            P D  K R Q Q  L  N   +     RY+G + A+  I + EG+  L++G    + R A     ++  YD +K      +R + +S+N+ C  V    AG  ++ IA+P DV+K R  +       S+    +T  ++KEG    YK  +P+  R      V+  T++  K  ++  +
Sbjct:  132 PTDVVKVRFQAQMNL--NGVAR-----RYSGTMQAYRQIFQNEGMRGLWKGTLPNITRNALVNCTELVTYDLIKEAI---LRHQLLSDNLPCHFVSAFGAGFVTTVIASPVDVVKTRYMNSPPGQYRSAINCAWTM-LTKEGPTAFYKGFVPSFLRLGSWNVVMFVTFEQIKRAMMVSR 299          

HSP 3 Score: 51.9878 bits (123), Expect = 5.002e-7
Identity = 45/200 (22.50%), Postives = 75/200 (37.50%), Query Frame = 1
Query:  460 AVVAGVTSSTIANPTDVIKIRLQSKSNYT-----QNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI*QCLHI-IPVHCI 1041
            A  A   +  +  P D  K+RLQ +         +        +  I  EG + LY  ++    R      + +  YD  K    T      NV     +           + P +V++ R   Q N+  N V  +Y   +   ++  +NE +  LWKG +P   R    N    +T++ IK+  L  Q L   +P H +
Sbjct:   20 AGAAACVADIVTFPLDTAKVRLQIQGEKKAVEGIRYRGVFGTISTMIRTEGPRSLYNGLVAGLQRQVCFASIRIGLYDNVK-NFYTGGKDNPNVLIRILAGCTTGAMAVSFAQPTDVVKVRFQAQMNL--NGVARRYSGTMQAYRQIFQNEGMRGLWKGTLPNITRNALVNCTELVTYDLIKEAILRHQLLSDNLPCHFV 216          
BLAST of slc25a-24 vs. Planmine SMEST
Match: SMESG000016412.1 (SMESG000016412.1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 1
Query:  118 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 1005
            MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI
Sbjct:    1 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI 296          
BLAST of slc25a-24 vs. Planmine SMEST
Match: SMESG000016412.1 (SMESG000016412.1)

HSP 1 Score: 157.532 bits (397), Expect = 9.635e-48
Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
Query:  118 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRG 336
            MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRG
Sbjct:    1 MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRG 73          
BLAST of slc25a-24 vs. Planmine SMEST
Match: SMESG000073400.1 (SMESG000073400.1)

HSP 1 Score: 147.902 bits (372), Expect = 3.815e-41
Identity = 92/299 (30.77%), Postives = 155/299 (51.84%), Query Frame = 1
Query:  124 DLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKL-KRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRL--------QSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 993
            D   F  GG++ I+  +   P+D  KTR+QI G+         +Q   Y     A + I   EGI A+Y GLSAA+ RQA+Y T ++G+Y  L +R SS+N    +++  +  A++AG+  S +  P ++  IR+        + K NY    +        I  +GF GL+K V+PT  R  ++  + L +Y   K  LI  + L D +  HF +S+++      +S PV++I+TR+ N   I+      +Y S  +   +  +NE + +LWKGF+P + +IG   +I F+  E++ +
Sbjct:   10 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ-------DGYQKS-YKSSFDAIYRITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHH-PNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNY---RNVFHALGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP---EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 293          
BLAST of slc25a-24 vs. Planmine SMEST
Match: SMESG000019229.1 (SMESG000019229.1)

HSP 1 Score: 144.436 bits (363), Expect = 8.049e-40
Identity = 79/289 (27.34%), Postives = 148/289 (51.21%), Query Frame = 1
Query:  136 FFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNS-----SFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKI 987
            F  GG+A +IA +   P+D  K R+Q+ G+   + + K      Y     A   I + EG+ A+Y GLSA ++RQA+Y T ++G+Y  L    S   +  S        + AG+  S +  PT+V  IR+ S      +      +      + + +EG   L++  +PT  R+A++    L +Y   K  ++  ++  D ++ HF +S+++    T  S PV++++TR+ N + ++  +   +Y  A++   +  ++E + +LWKGF P + R+GP  +I F+  E++
Sbjct:   14 FAFGGSAGMIATLFVQPLDLVKNRMQMSGQ---DGSKKA-----YKSSFDAIKQITRNEGLFAIYSGLSAGLLRQATYTTTRLGVYTALFEKFSSKDKPPSFVTKAGIGMSAGLIGSFVGTPTEVALIRMTSDGRLPMDQRRNYRNVFHALARIVREEGVLALWRGCLPTMGRAAVVNLAQLASYSQAKQMILETELFNDGIFVHFGASMISGFITTVASMPVDIVKTRIQNMTVVNGVA---EYSGAINAFIRITKHEGVLSLWKGFTPYFLRLGPHTVITFVVLEQM 291          

HSP 2 Score: 51.9878 bits (123), Expect = 3.158e-7
Identity = 50/206 (24.27%), Postives = 86/206 (41.75%), Query Frame = 1
Query:  409 ISSQNMRGESISNNIACAV--VAGVTSSTIANPTDVIKIRLQ------SKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNL 1002
            +SSQN+   SI N +  A    AG+ ++    P D++K R+Q      SK  Y  +   +K+ T+    EG   +Y  +     R A      L  Y     K  ++      V       + A   G+ V  P EV   R+ +   +  +     Y++    L + +R E + ALW+G +PT  R    N+    ++ + K++ L
Sbjct:    1 MSSQNI---SIPNYVKFAFGGSAGMIATLFVQPLDLVKNRMQMSGQDGSKKAYKSSFDAIKQITR---NEGLFAIYSGLSAGLLRQATYTTTRLGVYTALFEKFSSKDKPPSFV-TKAGIGMSAGLIGSFVGTPTEVALIRMTSDGRLPMDQ-RRNYRNVFHALARIVREEGVLALWRGCLPTMGRAAVVNLAQLASYSQAKQMIL 198          
BLAST of slc25a-24 vs. Planmine SMEST
Match: SMESG000046675.1 (SMESG000046675.1)

HSP 1 Score: 133.65 bits (335), Expect = 6.717e-36
Identity = 88/292 (30.14%), Postives = 140/292 (47.95%), Query Frame = 1
Query:  139 FHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQS--------KSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 990
            + GG AS +A  CT P+D  K  LQ Q +       K F      GM   F  ++K +GI ALY GLSA+++RQ +Y   + G+Y+  K+    N+         A ++VAG     + NP D++ +R+Q+        + NY  N++F   F + + +EG   L+  V  TA R+  +    L  YD  K  L+      DN+  HF +S  AA   T ++ P +V++TRLMN     +    Y   S L      I        +KG +P + R+GP  ++ F+  E+++
Sbjct:   16 YFGGVASAMAAACTHPLDLLKVHLQTQQK-------KEF------GMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETYKKKKGANL---PFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNY--NNAFDGMF-RVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMN-----AKPGAY---SGLAACGADIMKTGPLGFFKGLVPAFIRLGPQTVLTFIFLEQLR 280          
The following BLAST results are available for this feature:
BLAST of slc25a-24 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A301.702e-9450.00solute carrier family 25 member 30 [Source:HGNC Sy... [more]
SLC25A141.540e-9347.59solute carrier family 25 member 14 [Source:HGNC Sy... [more]
SLC25A143.626e-9347.59solute carrier family 25 member 14 [Source:HGNC Sy... [more]
SLC25A144.548e-9347.59solute carrier family 25 member 14 [Source:HGNC Sy... [more]
SLC25A144.548e-9347.59solute carrier family 25 member 14 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
misc-11.282e-4430.82Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
misc-11.282e-4430.82Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
ucp-41.676e-4431.15UnCoupling Protein (Mitochondrial substrate carrie... [more]
slc-25A101.555e-3129.66Oxoglutarate/malate carrier protein; SLC (SoLute C... [more]
slc-25A101.555e-3129.66Oxoglutarate/malate carrier protein; SLC (SoLute C... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bmcp6.521e-7946.73gene:FBgn0036199 transcript:FBtr0076114[more]
Bmcp6.521e-7946.73gene:FBgn0036199 transcript:FBtr0076115[more]
Ucp4B1.847e-5233.33gene:FBgn0031758 transcript:FBtr0079173[more]
Ucp4A4.415e-5232.99gene:FBgn0030872 transcript:FBtr0074464[more]
Ucp4A4.415e-5232.99gene:FBgn0030872 transcript:FBtr0303572[more]
back to top
BLAST of slc25a-24 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a144.999e-9548.64solute carrier family 25 member 14 [Source:ZFIN;Ac... [more]
slc25a144.999e-9548.64solute carrier family 25 member 14 [Source:ZFIN;Ac... [more]
slc25a141.669e-8848.40solute carrier family 25 member 14 [Source:ZFIN;Ac... [more]
ucp31.767e-5633.44uncoupling protein 3 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ucp23.555e-5633.22uncoupling protein 2 [Source:NCBI gene;Acc:555812][more]
back to top
BLAST of slc25a-24 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a307.295e-9550.34solute carrier family 25 member 30 [Source:NCBI ge... [more]
slc25a302.487e-8748.26solute carrier family 25 member 30 [Source:NCBI ge... [more]
slc25a304.413e-6548.39solute carrier family 25 member 30 [Source:NCBI ge... [more]
ucp22.799e-6134.25uncoupling protein 2 (mitochondrial, proton carrie... [more]
ctps18.242e-6035.03CTP synthase 1 [Source:Xenbase;Acc:XB-GENE-957432][more]
back to top
BLAST of slc25a-24 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a149.401e-9548.62solute carrier family 25 (mitochondrial carrier, b... [more]
Slc25a141.500e-9448.62solute carrier family 25 (mitochondrial carrier, b... [more]
Slc25a141.500e-9448.62solute carrier family 25 (mitochondrial carrier, b... [more]
Slc25a141.845e-9448.62solute carrier family 25 (mitochondrial carrier, b... [more]
Slc25a301.925e-9448.97solute carrier family 25, member 30 [Source:MGI Sy... [more]
back to top
BLAST of slc25a-24 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XGI1|KMCP1_XENTR3.865e-9450.34Kidney mitochondrial carrier protein 1 OS=Xenopus ... [more]
sp|Q6GQ22|KMCP1_XENLA4.402e-9450.69Kidney mitochondrial carrier protein 1 OS=Xenopus ... [more]
sp|Q5PQM9|KMCP1_RAT7.998e-9449.31Kidney mitochondrial carrier protein 1 OS=Rattus n... [more]
sp|Q5SVS4|KMCP1_HUMAN8.173e-9450.00Kidney mitochondrial carrier protein 1 OS=Homo sap... [more]
sp|Q9Z2B2|UCP5_MOUSE1.050e-9348.62Brain mitochondrial carrier protein 1 OS=Mus muscu... [more]
back to top
BLAST of slc25a-24 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFF70.000e+0100.00Slc25a-24 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0L8GC094.864e-9546.78Uncharacterized protein OS=Octopus bimaculoides OX... [more]
W5NCP35.408e-9449.66Solute carrier family 25 member 14 OS=Lepisosteus ... [more]
F1NXC05.915e-9450.00Solute carrier family 25 member 30 OS=Gallus gallu... [more]
A0A1S3LQK71.275e-9349.66brain mitochondrial carrier protein 1-like isoform... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a143.297e-9449.66brain mitochondrial carrier protein 1 [Source:NCBI... [more]
slc25a144.729e-8748.59brain mitochondrial carrier protein 1 [Source:NCBI... [more]
ucp22.062e-6034.13uncoupling protein 2 [Source:NCBI gene;Acc:1030274... [more]
ucp13.524e-5832.76uncoupling protein 1 [Source:NCBI gene;Acc:1030377... [more]
ucp35.436e-5833.78mitochondrial uncoupling protein 2-like [Source:NC... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ucp25.056e-5933.45uncoupling protein 2 [Source:NCBI gene;Acc:555812][more]
slc25a23a2.278e-2124.91solute carrier family 25 member 23a [Source:ZFIN;A... [more]
ENSPMAT00000004577.12.745e-2021.53pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
ENSPMAT00000008980.15.280e-2024.30pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
SLC25A406.155e-1821.65solute carrier family 25 member 40 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DIC18.838e-3728.96Mitochondrial dicarboxylate carrier; integral memb... [more]
OAC12.007e-3429.67Mitochondrial inner membrane transporter; transpor... [more]
ODC23.819e-2830.22Mitochondrial inner membrane transporter; 2-oxodic... [more]
YEA62.686e-2426.87Putative mitochondrial NAD+ transporter; member of... [more]
AAC33.341e-2426.84Mitochondrial inner membrane ADP/ATP translocator;... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399879.224e-8544.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343263.410e-6036.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500342.551e-5735.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328856.025e-5031.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255098.954e-4936.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of slc25a-24 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a141.272e-9348.96solute carrier family 25 member 14 [Source:NCBI ge... [more]
SLC25A307.222e-9347.62kidney mitochondrial carrier protein 1 [Source:NCB... [more]
ucp26.963e-6135.14uncoupling protein 2 [Source:NCBI gene;Acc:1011606... [more]
ucp28.994e-6135.14uncoupling protein 2 [Source:NCBI gene;Acc:1011606... [more]
ucp12.232e-6035.17mitochondrial uncoupling protein 2 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-24 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016412.10.000e+0100.00SMESG000016412.1[more]
SMESG000016412.19.635e-48100.00SMESG000016412.1[more]
SMESG000073400.13.815e-4130.77SMESG000073400.1[more]
SMESG000019229.18.049e-4027.34SMESG000019229.1[more]
SMESG000046675.16.717e-3630.14SMESG000046675.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033672
GenBankAKN21592.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033672 ID=SMED30033672|Name=slc25a-24|organism=Schmidtea mediterranea sexual|type=transcript|length=1202bp
TAGTTAAAATTCTAATTTAAATTATTTGATTAATTAAATTATCATAATCT
TGAAATCGATTTCGACAATTTTAATTTCTTCAAATATTATTCTTTTTGAC
AAGTTTCATAATTTATTATGATTGACTTATATCCTTTCTTCCATGGAGGC
GCGGCTTCCATAATCGCAGAGATATGCACATTCCCAATCGATACGACTAA
AACTCGTCTTCAAATTCAAGGTGAGTTACTAAAAAATAACACAATGAAGC
ATTTTCAAGGAGGTCGATATAATGGAATGATTCATGCATTTTTTGTCATC
ATAAAACAGGAGGGCATTTCTGCTCTGTATAGAGGTTTGAGTGCTGCCGT
GATTAGGCAGGCGTCGTACGGCACAATGAAAATGGGATTATATGACAAAC
TGAAACGGATTTCCAGTCAAAACATGCGAGGCGAATCTATTTCTAACAAT
ATTGCTTGCGCCGTCGTGGCTGGGGTGACATCAAGCACTATTGCAAATCC
AACTGATGTCATCAAGATTCGTCTTCAATCAAAATCTAATTATACTCAAA
ATTCTAGCTTTTTAAAAGAATTTACTCAAACAATCTCCAAAGAAGGATTC
AAAGGGTTATATAAGGCGGTAATCCCCACAGCTGCTAGATCAGCTCTTCT
TGTCGGAGTGCTGTTACCAACTTATGACTTCACCAAAGGCAAGTTGATAA
CTGAGCAGATATTATTGGACAATGTCTATTGCCATTTTGCATCCAGTTTA
GTAGCAGCTACATTTGGAACATGTGTATCATGTCCAGTTGAAGTTATTCG
AACCCGATTAATGAACCAATCAAATATCGATTCTAATTCCGTCAATTATA
AATATAAATCCGCACTGGACTGCTTGAAAAAGACTATAAGAAACGAGCGG
ATTTTCGCTCTCTGGAAAGGATTTATTCCCACTTGGTATCGCATTGGTCC
TTGGAATATTATATTTTTCCTAACTCATGAGAAAATCAAAAAAGTCAATC
TCATTTGACAATGTTTGCACATCATCCCGGTTCATTGTATTTTTCTGAAA
TCTTTATGAGATACACGAGTAACCTCCTTTTGAGATCGAGAGATGTTTCT
ATTTTATTGGTTACGTACCGCAATACATTTATTTTGTTTAGATTCATTTT
TATTTATTCACAAATATTGTCAAATATCAGAAAATCAATTATTTAATCAG
TG
back to top

protein sequence of SMED30033672-orf-1

>SMED30033672-orf-1 ID=SMED30033672-orf-1|Name=SMED30033672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=297bp
MIDLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGR
YNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKRISS
QNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLK
EFTQTISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILL
DNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSAL
DCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKKVNLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0031966mitochondrial membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006839mitochondrial transport
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR023395Mt_carrier_dom_sf
IPR018108Mitochondrial_sb/sol_carrier
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 6..19
score: 26.23
coord: 121..139
score: 27.78
coord: 73..93
score: 27.87
coord: 210..232
score: 25.73
coord: 19..33
score: 30.6
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 5..295
e-value: 4.2E-86
score: 290.3
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 5..289
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 203..293
e-value: 5.1E-19
score: 68.0
coord: 107..194
e-value: 7.1E-17
score: 61.1
coord: 7..100
e-value: 2.4E-21
score: 75.5
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 1..98
score: 24.615
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 106..192
score: 18.029
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 201..293
score: 25.044
NoneNo IPR availablePANTHERPTHR45618:SF11KIDNEY MITOCHONDRIAL CARRIER PROTEIN 1coord: 4..293
NoneNo IPR availablePANTHERPTHR45618FAMILY NOT NAMEDcoord: 4..293