unconventional myosin-Id

Overview
Nameunconventional myosin-Id
Smed IDSMED30033662
Length (bp)3402
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of unconventional myosin-Id (SMED30033662) t-SNE clustered cells

Violin plots show distribution of expression levels for unconventional myosin-Id (SMED30033662) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of unconventional myosin-Id (SMED30033662) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for unconventional myosin-Id (SMED30033662) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033662

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033662SMESG000051401.1 dd_Smed_v4_3957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033662SMESG000051401.1 dd_Smed_v4_3957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033662SMESG000051401.1 dd_Smed_v4_3957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033662SMESG000051401.1 dd_Smed_v4_3957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033662SMESG000051401.1 dd_Smed_v4_3957_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of unconventional myosin-Id vs. Ensembl Human
Match: MYO1D (myosin ID [Source:HGNC Symbol;Acc:HGNC:7598])

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 508/1004 (50.60%), Postives = 675/1004 (67.23%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    + +YKGRELYE PPH+FAIADAA+K +KR+++DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L+   LQ     Y YI+ G   K  SIND A ++ V +A+  IGF   E +T++ ++AAILHLG ++F ++             ++  I +  + SI  +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD+MFLE L+S L K + + SRKL  ++K +E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G TKIFIR+ +++F LE+ R   +  IV+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K   K+ L V+V  N + C L  KKC + +
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLK-SSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVD------------GDTPLIENGKVVSI--IAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPS--PPKVLRRFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVE-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSE-KRHLQVNVT-NPVQCSLHGKKCTVSV 981          
BLAST of unconventional myosin-Id vs. Ensembl Human
Match: MYO1D (myosin ID [Source:HGNC Symbol;Acc:HGNC:7598])

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 498/975 (51.08%), Postives = 660/975 (67.69%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCK 2981
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    + +YKGRELYE PPH+FAIADAA+K +KR+++DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L+   LQ     Y YI+ G   K  SIND A ++ V +A+  IGF   E +T++ ++AAILHLG ++F ++             ++  I +  + SI  +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD+MFLE L+S L K + + SRKL  ++K +E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G TKIFIR+ +++F LE+ R   +  IV+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLK-SSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVD------------GDTPLIENGKVVSI--IAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPS--PPKVLRRFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVE-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFK 954          
BLAST of unconventional myosin-Id vs. Ensembl Human
Match: MYO1G (myosin IG [Source:HGNC Symbol;Acc:HGNC:13880])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 466/981 (47.50%), Postives = 652/981 (66.46%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGN--NSKVPSI--NDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQF-ELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARG-DVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIR---GDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG---EDRIPELVAKLFLHCK 2981
            EGPE+G PDF+L+D + ++ F+ NL+ RF K RIYTYIGEVLV+VNPY+EL +Y  + +  Y+GRELYE PPH++A+A+AA+K +K +++DTCIVISGESG+GKTEASK I++YIA VTN S + E+ERVK++LLKS C+LE FGNA+TNRN NSSRFGKYMDI+FDFKGDP+GG +++YLLEKSRV+ Q VGER+FH+FYQLL G+   +L E  L+ +P  Y + +QG   N  V S   +D+  +Q V EA+  IGF+  E +++  ++AAILHLG ++F E  E   Q   +  A E++         + H+AEL       + ++L  R VA+ G ++I KGHT   A+YARDA AKA+Y RLF W+  +IN  ++   +D R +      K +VIGVLDIYGFE+F  NSFEQFCINYCNEKLQQLFIQL+LKQEQEEY REGI W ++EYFNN  I D+VE P  GI A+LD+ C   G +TD++FL+ LD + +    Y SR+L PT+KT+E  RDFRI HYAG VTY+V GF++KN+D  F+DFKRLLYNS + T+++MW DG + ++E T+RP++ G  FK S+  LVENLA K P YVRCIKPN  K  G+LD    +HQ  YLGL+ENVRVRRAGFA+R  Y+RFL R+KM  + TWP+    + K    A+++  G+  DV +GH+K+FIRS +++  LEQ+R   +  IV++LQK WRG LAR   +R+RA   I+  +R +K+R+++ +    F + +    YG++L WP    P      +     +F RWRA +++   P +  P+I+ K+      LQ  R  +   R W  DYL  A+DNPT S  +      ++   G   VLFS    K+N+  K   RA+++TD ++++L   + ++   + V LE +  ++V+ G DQ+++LH    + DLV          ++R+ ELV  L  HC+
Sbjct:    5 EGPEYGKPDFVLLDQVTMEDFMRNLQLRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIARYQGRELYERPPHLYAVANAAYKAMKHRSRDTCIVISGESGAGKTEASKHIMQYIAAVTNPSQRAEVERVKDVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPIGGHIHSYLLEKSRVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEAL---------VDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRD-----GKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQQLFIQLILKQEQEEYEREGITWQSVEYFNNATIVDLVERPHRGILAVLDEACSSAGTITDRIFLQTLDMHHRHHLHYTSRQLCPTDKTMEFGRDFRIKHYAGDVTYSVEGFIDKNRDFLFQDFKRLLYNSTDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVRCIKPNEDKVAGKLDENHCRHQVAYLGLLENVRVRRAGFASRQPYSRFLLRYKMTCEYTWPNHLLGSDKAAVSALLEQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQKAWRGTLARWRCRRLRAIYTIMRWFRRHKVRAHLAELQRRFQAARQPPLYGRDLVWPL--PPAVLQPFQDTCHALFCRWRARQLVKNIPPSDMPQIKAKVAAMGA-LQGLRQDWGCRRAWARDYLSSATDNPTASSLFAQRLKTLQDKDGFGAVLFSSHVRKVNRFHKIRNRALLLTDQHLYKLDPDRQYRVMRA-VPLEAVTGLSVTSGGDQLVVLH-ARGQDDLVVCLHRSRPPLDNRVGELVGVLAAHCQ 966          
BLAST of unconventional myosin-Id vs. Ensembl Human
Match: MYO1G (myosin IG [Source:HGNC Symbol;Acc:HGNC:13880])

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 466/981 (47.50%), Postives = 652/981 (66.46%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGN--NSKVPSI--NDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQF-ELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARG-DVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIR---GDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG---EDRIPELVAKLFLHCK 2981
            EGPE+G PDF+L+D + ++ F+ NL+ RF K RIYTYIGEVLV+VNPY+EL +Y  + +  Y+GRELYE PPH++A+A+AA+K +K +++DTCIVISGESG+GKTEASK I++YIA VTN S + E+ERVK++LLKS C+LE FGNA+TNRN NSSRFGKYMDI+FDFKGDP+GG +++YLLEKSRV+ Q VGER+FH+FYQLL G+   +L E  L+ +P  Y + +QG   N  V S   +D+  +Q V EA+  IGF+  E +++  ++AAILHLG ++F E  E   Q   +  A E++         + H+AEL       + ++L  R VA+ G ++I KGHT   A+YARDA AKA+Y RLF W+  +IN  ++   +D R +      K +VIGVLDIYGFE+F  NSFEQFCINYCNEKLQQLFIQL+LKQEQEEY REGI W ++EYFNN  I D+VE P  GI A+LD+ C   G +TD++FL+ LD + +    Y SR+L PT+KT+E  RDFRI HYAG VTY+V GF++KN+D  F+DFKRLLYNS + T+++MW DG + ++E T+RP++ G  FK S+  LVENLA K P YVRCIKPN  K  G+LD    +HQ  YLGL+ENVRVRRAGFA+R  Y+RFL R+KM  + TWP+    + K    A+++  G+  DV +GH+K+FIRS +++  LEQ+R   +  IV++LQK WRG LAR   +R+RA   I+  +R +K+R+++ +    F + +    YG++L WP    P      +     +F RWRA +++   P +  P+I+ K+      LQ  R  +   R W  DYL  A+DNPT S  +      ++   G   VLFS    K+N+  K   RA+++TD ++++L   + ++   + V LE +  ++V+ G DQ+++LH    + DLV          ++R+ ELV  L  HC+
Sbjct:    5 EGPEYGKPDFVLLDQVTMEDFMRNLQLRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIARYQGRELYERPPHLYAVANAAYKAMKHRSRDTCIVISGESGAGKTEASKHIMQYIAAVTNPSQRAEVERVKDVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPIGGHIHSYLLEKSRVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEAL---------VDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRD-----GKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQQLFIQLILKQEQEEYEREGITWQSVEYFNNATIVDLVERPHRGILAVLDEACSSAGTITDRIFLQTLDMHHRHHLHYTSRQLCPTDKTMEFGRDFRIKHYAGDVTYSVEGFIDKNRDFLFQDFKRLLYNSTDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVRCIKPNEDKVAGKLDENHCRHQVAYLGLLENVRVRRAGFASRQPYSRFLLRYKMTCEYTWPNHLLGSDKAAVSALLEQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQKAWRGTLARWRCRRLRAIYTIMRWFRRHKVRAHLAELQRRFQAARQPPLYGRDLVWPL--PPAVLQPFQDTCHALFCRWRARQLVKNIPPSDMPQIKAKVAAMGA-LQGLRQDWGCRRAWARDYLSSATDNPTASSLFAQRLKTLQDKDGFGAVLFSSHVRKVNRFHKIRNRALLLTDQHLYKLDPDRQYRVMRA-VPLEAVTGLSVTSGGDQLVVLH-ARGQDDLVVCLHRSRPPLDNRVGELVGVLAAHCQ 966          
BLAST of unconventional myosin-Id vs. Ensembl Human
Match: MYO1D (myosin ID [Source:HGNC Symbol;Acc:HGNC:7598])

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 457/919 (49.73%), Postives = 612/919 (66.59%), Query Frame = 3
Query:  330 VKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            +KR+++DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L+   LQ     Y YI+ G   K  SIND A ++ V +A+  IGF   E +T++ ++AAILHLG ++F ++             ++  I +  + SI  +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD+MFLE L+S L K + + SRKL  ++K +E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G TKIFIR+ +++F LE+ R   +  IV+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K   K+ L V+V  N + C L  KKC + +
Sbjct:    1 MKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLK-SSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVD------------GDTPLIENGKVVSI--IAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPS--PPKVLRRFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVE-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSE-KRHLQVNVT-NPVQCSLHGKKCTVSV 893          
BLAST of unconventional myosin-Id vs. Ensembl Celegans
Match: hum-5 (Heavy chain, Unconventional Myosin; Myosin IA [Source:UniProtKB/TrEMBL;Acc:G5ECZ0])

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 473/1007 (46.97%), Postives = 654/1007 (64.95%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAI-GFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS--WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQAS--DNPTNSLAYVNARDKIRGDR---KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFL-TFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            H+   +G+ D +L+  IDLKS V NL+ RF K RIYTYIGEVLVAVNPY++L IY    V++YKGRE+YE  PH+FAIADAA++ +KR  +D+CIVISGESG+GKTE SKII++Y+A +TN+  Q EIERVKN+LL+SNCILE FG AKT RNDNSSRFGKYM I+FD+ GDPVGG ++NYLLEKSRVV QQ GER+FH FYQL+ G     L++FGL  D  +Y ++NQG + KV SIND   + EV  A+ +I  F   + +++W+++A ++HLG V+F           I G   S  +  +   ++++ A   +V+   L K+LS + VAA GD++ K H +  A Y RDA AKA+Y+RLFSW+ +K+NE I + +        S ++K  VIGVLDIYGFEIF  NSFEQ CINYCNEKLQQLFI+LVLKQEQEEY REGIKW  IEYFNN+ ICD+VE+PR GI +ILD+ C   G VTD++FL +LD  L+    Y SR L  ++K++  E +F+I HYAG VTY+V GF++KNKD  F+D KRLLY+S N  VKS++ DG+KS++E  +RP + G  FK S+ +LV+ LA+K PHY+RCIKPN  K+    D+E V+HQ RYLGL+ENVRVRRAGFA RM Y RF+ R+K++   TWP+      LK+    I++  G+++D   G TKIFIRS Q++F+LE+ RT  +  ++  LQK  RGV  R   +R+ A  KII AYR YK++SYI + +  F  ++   D GK + WP    P       + L+ +  RWRA  +L   P      +  K+   ++L  K +  +   R WRGDYL Q    + PT    Y +    +R      KVLFS +  K NK  K+ +R +I+TD ++ +L + K FK    P+ L+ I+ I+V   ++ + ++H     +D+V     T  E+R+ E++  L  H  D      +  ++++ + C L  K   +R+
Sbjct:    6 HDPNGYGVEDLVLLSTIDLKSVVQNLQLRFQKGRIYTYIGEVLVAVNPYRQLGIYEKSTVDQYKGREIYERAPHVFAIADAAYRSMKRFGRDSCIVISGESGAGKTETSKIIMKYLAAITNVRQQGEIERVKNVLLRSNCILEAFGCAKTTRNDNSSRFGKYMHINFDYDGDPVGGNISNYLLEKSRVVRQQEGERNFHVFYQLVNGGDDGLLRQFGLTKDAKQYYFLNQGQSHKVASINDSRDFAEVQTALRSIHTFDKQDVESMWSVIAGLIHLGNVRF-----------IDGENSSGAVHIAEKAALQNAARCLNVTPDELAKSLSSQVVAAHGDIVKKQHDVNAAYYTRDALAKALYERLFSWMVSKVNEAISVQNS-------SRYSKSHVIGVLDIYGFEIFGTNSFEQLCINYCNEKLQQLFIELVLKQEQEEYEREGIKWVKIEYFNNKVICDLVEIPRTGILSILDEACASIGNVTDKVFLGELDKKLKSHKHYTSRNLKQSDKSMGFE-EFKITHYAGDVTYSVMGFMDKNKDTLFQDLKRLLYHSKNRLVKSLFPDGSKSMAEVNRRPPTAGFLFKNSMSELVKQLAQKEPHYIRCIKPNEEKNSNVFDLERVEHQVRYLGLLENVRVRRAGFAHRMPYDRFVNRYKLICASTWPNPRRGQQLKDSCMQILESAGLAQDCVQGRTKIFIRSPQTVFRLEELRTEQLPNVITFLQKMVRGVQQRERYRRMLAVRKIIGAYRRYKLKSYIWQLINAFRDVRRMRDLGKSIRWPA--PPLVLAQFVSRLRVMHQRWRAATILARMPPHLRASLPQKIAAFEVLNNK-KENWGYTRMWRGDYLSQQEELELPTTVSTYHDGIQALRQSHPFGKVLFSTYVQKFNKFNKSSLRVLIVTDRFVAKL-ENKKFKLLKEPIPLQSISRISVCAESNGLFVIHV--GDNDIVGCAKNTKNEERVGEMIGTLLAHY-DKITMRRSPVLIQSAVVCTLGGKTRTIRV 986          
BLAST of unconventional myosin-Id vs. Ensembl Celegans
Match: hum-5 (Heavy chain, Unconventional Myosin; Myosin IA [Source:UniProtKB/TrEMBL;Acc:G5ECZ0])

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 473/1007 (46.97%), Postives = 654/1007 (64.95%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAI-GFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS--WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQAS--DNPTNSLAYVNARDKIRGDR---KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFL-TFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            H+   +G+ D +L+  IDLKS V NL+ RF K RIYTYIGEVLVAVNPY++L IY    V++YKGRE+YE  PH+FAIADAA++ +KR  +D+CIVISGESG+GKTE SKII++Y+A +TN+  Q EIERVKN+LL+SNCILE FG AKT RNDNSSRFGKYM I+FD+ GDPVGG ++NYLLEKSRVV QQ GER+FH FYQL+ G     L++FGL  D  +Y ++NQG + KV SIND   + EV  A+ +I  F   + +++W+++A ++HLG V+F           I G   S  +  +   ++++ A   +V+   L K+LS + VAA GD++ K H +  A Y RDA AKA+Y+RLFSW+ +K+NE I + +        S ++K  VIGVLDIYGFEIF  NSFEQ CINYCNEKLQQLFI+LVLKQEQEEY REGIKW  IEYFNN+ ICD+VE+PR GI +ILD+ C   G VTD++FL +LD  L+    Y SR L  ++K++  E +F+I HYAG VTY+V GF++KNKD  F+D KRLLY+S N  VKS++ DG+KS++E  +RP + G  FK S+ +LV+ LA+K PHY+RCIKPN  K+    D+E V+HQ RYLGL+ENVRVRRAGFA RM Y RF+ R+K++   TWP+      LK+    I++  G+++D   G TKIFIRS Q++F+LE+ RT  +  ++  LQK  RGV  R   +R+ A  KII AYR YK++SYI + +  F  ++   D GK + WP    P       + L+ +  RWRA  +L   P      +  K+   ++L  K +  +   R WRGDYL Q    + PT    Y +    +R      KVLFS +  K NK  K+ +R +I+TD ++ +L + K FK    P+ L+ I+ I+V   ++ + ++H     +D+V     T  E+R+ E++  L  H  D      +  ++++ + C L  K   +R+
Sbjct:    6 HDPNGYGVEDLVLLSTIDLKSVVQNLQLRFQKGRIYTYIGEVLVAVNPYRQLGIYEKSTVDQYKGREIYERAPHVFAIADAAYRSMKRFGRDSCIVISGESGAGKTETSKIIMKYLAAITNVRQQGEIERVKNVLLRSNCILEAFGCAKTTRNDNSSRFGKYMHINFDYDGDPVGGNISNYLLEKSRVVRQQEGERNFHVFYQLVNGGDDGLLRQFGLTKDAKQYYFLNQGQSHKVASINDSRDFAEVQTALRSIHTFDKQDVESMWSVIAGLIHLGNVRF-----------IDGENSSGAVHIAEKAALQNAARCLNVTPDELAKSLSSQVVAAHGDIVKKQHDVNAAYYTRDALAKALYERLFSWMVSKVNEAISVQNS-------SRYSKSHVIGVLDIYGFEIFGTNSFEQLCINYCNEKLQQLFIELVLKQEQEEYEREGIKWVKIEYFNNKVICDLVEIPRTGILSILDEACASIGNVTDKVFLGELDKKLKSHKHYTSRNLKQSDKSMGFE-EFKITHYAGDVTYSVMGFMDKNKDTLFQDLKRLLYHSKNRLVKSLFPDGSKSMAEVNRRPPTAGFLFKNSMSELVKQLAQKEPHYIRCIKPNEEKNSNVFDLERVEHQVRYLGLLENVRVRRAGFAHRMPYDRFVNRYKLICASTWPNPRRGQQLKDSCMQILESAGLAQDCVQGRTKIFIRSPQTVFRLEELRTEQLPNVITFLQKMVRGVQQRERYRRMLAVRKIIGAYRRYKLKSYIWQLINAFRDVRRMRDLGKSIRWPA--PPLVLAQFVSRLRVMHQRWRAATILARMPPHLRASLPQKIAAFEVLNNK-KENWGYTRMWRGDYLSQQEELELPTTVSTYHDGIQALRQSHPFGKVLFSTYVQKFNKFNKSSLRVLIVTDRFVAKL-ENKKFKLLKEPIPLQSISRISVCAESNGLFVIHV--GDNDIVGCAKNTKNEERVGEMIGTLLAHY-DKITMRRSPVLIQSAVVCTLGGKTRTIRV 986          
BLAST of unconventional myosin-Id vs. Ensembl Celegans
Match: hum-1 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q19901])

HSP 1 Score: 525.398 bits (1352), Expect = 8.281e-168
Identity = 283/730 (38.77%), Postives = 436/730 (59.73%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAAR-----GDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPR-LGIFAILDDNCIK---PGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISED-VQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            G+ D +L+  +  +S V+NL+KR   N I+TYIG VL++VNP+K++  ++ KE+  Y+G   YE+ PHI+A+AD  ++ +   N+  C++ISGESG+GKT  +K I+ YI++++   G  +++ +K+++L+SN +LE FGN+ T RN NSSRFGKY++I F   G+P+GG ++N+LLEKSRVV Q  G+R+FH FYQL  GA  +    FG+  +   Y Y+N     K    +D   ++  + A+  +G  + +   +  +VA +LH+G + F                E+     S    +++ A L  ++ A +   L+ R + ++      ++ MK   +E A+Y RDA+ KAIY RLF ++  K+N+ + I+ + + +N       FSV G+LDIYGFEIF NN FEQFCIN+ NEKLQQ+FI+L LK EQEEY+REGIKWT I+YF+N+ +CD++E  R  GI ++LDD C +        D+  L  L      KSF       P   +      F I HYAG VTYNV+GF ++N+D  + D   L+  S+   +++++ +     +   +RP +     +T    LVE+L K  PHYVRCIKPN  K P   +   V+HQ  YLGL EN+RVRRAGFA R  + +F QR+ ++S +TWP +  + +   + I D + + ++  Q G TKIF+++ +S+F LE+ R    D    ++QK WR
Sbjct:   15 GVDDMVLLPKLTEQSIVENLKKRLQANSIFTYIGPVLISVNPFKQMPYFTEKEMLLYQGAAQYENAPHIYALADNMYRNMLIDNESQCVIISGESGAGKTVNAKFIMNYISRIS--GGGQKVQHIKDVILQSNPLLEAFGNSATVRNWNSSRFGKYVEIVFSRGGEPIGGKLSNFLLEKSRVVHQNEGDRNFHVFYQLCAGADKNLRSTFGI-GELQYYNYLNMSGVFKADDTDDGKEFESTLHAMKVVGVNDQDQLEVLRIVATVLHIGNITF--------------TEENNFAAVSGKDYLEYPAFLLGLTSADIEAKLTGRKMESKWGTQKEEIDMK-LNVEQASYTRDAWVKAIYARLFDYLVKKVNDAMNITSQSTSDN-------FSV-GILDIYGFEIFNNNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVREGIKWTEIDYFDNKIVCDLIETKRPPGIMSLLDDTCAQNHGQREGVDRQLLTTLS-----KSFAGHPHFGPGSDS------FVIKHYAGDVTYNVDGFCDRNRDVLYPDLILLMQKSSRPFIQALFPENV--AASAGKRPTTFSTKIRTQANTLVESLMKCSPHYVRCIKPNETKRPNDWEESRVKHQVEYLGLRENIRVRRAGFAYRRAFDKFAQRYAIVSPQTWPCFQGDQQRACEIICDSVHMEKNQYQMGKTKIFVKNPESLFLLEETRERKFDGYARVIQKAWR 705          
BLAST of unconventional myosin-Id vs. Ensembl Celegans
Match: hum-6 (Unconventional myosin heavy chain 6 [Source:UniProtKB/Swiss-Prot;Acc:P91443])

HSP 1 Score: 444.121 bits (1141), Expect = 7.050e-132
Identity = 261/735 (35.51%), Postives = 413/735 (56.19%), Query Frame = 3
Query:   60 RMAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKML-SKKTWPSWNSNLKEGSKAIIDD-MGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQK---RW 2249
            R+   H     G+ D   + +    + + NL  R+ +  IY Y G +L+AVNPY ++ IY+  E+  YK + + E PPHIFAIAD A+  ++R+ ++  ++ISGESG+GKTE++K++L+++A    ISGQ     ++  +L++N +LE FGNAKT RNDNSSRFGKY+D+HF+  G   G  +  YLLEKSR+V Q   ER++H FY LL G   +   E  L    D Y Y+ QG        +D A   E+  A+  +     E  +I+ L+A++LH+G ++F  N + +         ESV + D S  ++  +A+L  + E  L  A++ +++  R + ++     + A  ARDA AKAIY +LF  I  ++N+ I    +  R          + IG+LDI+GFE FE+NSFEQ CIN+ NE LQQ F+  V K EQ+EY  E I W +I++ +NQ   D++    L I +++D+  I P + TD+  L  L S   +   Y   K        E +R F + H+AG V YN  GFLEKN+D+F  D   L+ +S    +  ++ D     S  +++ ++VG  F+ S+++L+  L +  P ++RCIKPN +K    +D +LV  Q RY G++E +++RR+G+  R +Y  F+ R+++L S    P    +L + +K I    +G + D Q G TK+F++    +  LEQ     +    +++QK   RW
Sbjct:   52 RVRLMHPTSVQGVEDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYKRKRIGELPPHIFAIADNAYTNMRREKKNQSVIISGESGAGKTESTKLVLQFLA---TISGQHSW--IEQQVLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIVTQSENERNYHIFYCLLAGLSREEKSELELGTAAD-YYYLIQGKTLTAEGRDDAADLAEIRSAMRVLMINEQEIGSIFKLLASLLHIGNIRFRQNTNDNM--------ESVDVADPS--TLVRIAKLLQLHEQNLLDAITTKSLVTREERVISRLNGQQAVDARDALAKAIYGKLFIHIVRRVNDAIYKPSQSRR----------TSIGILDIFGFENFESNSFEQLCINFANETLQQFFVHHVFKMEQKEYDEEHINWRHIKFVDNQATVDLIAQRPLNILSLIDEESIFP-KGTDKTMLLKLHSTHGRNELYLQPK-------SELQRAFGVTHFAGNVFYNTRGFLEKNRDSFSADLSVLISSSKMPFLARLFDDIEYDTS--SRKKVTVGNQFRRSLEQLMSQLTQTHPFFIRCIKPNEMKRALVMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIQGPVNRIDLHDAAKKICHMILGTNADYQLGKTKVFLKDKHDLV-LEQEYYRILKDKAIVIQKNVRRW 749          
BLAST of unconventional myosin-Id vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 415.616 bits (1067), Expect = 1.592e-122
Identity = 271/755 (35.89%), Postives = 408/755 (54.04%), Query Frame = 3
Query:   72 FHEGPEF--GIPDFILVDNIDLKSFVDNLEKRFIK-NRIYTYIGEVLVAVNPYKEL-NIYSNKEVNEYKG--RELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQV----TNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDP-VGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMA-ELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSM---------------WLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            F   P F  G  D  L+  +   + + NL+ RF+K + IYTY G VLVA+NPY +  +IY  + +  Y+G  +   E  PHIFA+A+ AH  +    +   I++SGESG+GKT ++K ++RY+A V    T   G   IE     +L SN I+E  GNAKT RNDNSSRFGK++ I+F  +G   VG  M  YLLEKSR+V Q  GER++H FYQL        LK+  L    + Y Y+ QG +S++P ++DKA ++ +++A+  +GF   +   ++ L+A +L LG V FE  E SS             ++ SS   I  +  E + +SE+ L   L+ R + A  +++ K  T   A  +RDA  K +Y  LF W+  KINE +   DK    N     ++F  IGVLDIYGFE F+ NSFEQF INY NEKLQQ F Q V K EQEEY+RE I+W  +++ +NQ   D++E P +G+  +LD+ C K    +D  +L  L ++ + K     +  FP  ++     DF + H+A  VTY+ +GF+EKN+DA  E    ++  S    ++++                  G +++ +T      V + F+ S+++L+  L    PHYVRCIKPN  K     + +    Q R  G++E VR+  AGF +R  Y  F +R++++  K    W    K+ ++              G TKIF+R+ Q +  LE+ R   +     ++QK W+G
Sbjct:   71 FLRNPAFLVGKDDLTLLSYLHEPAVLHNLQVRFVKGSSIYTYCGIVLVAINPYADCSHIYGEEIIQVYRGAGKSAREMDPHIFAVAEEAHFDMGAFGKSQSIIVSGESGAGKTVSAKFVMRYLASVAASKTRNGGTTSIE---ARVLASNPIMESIGNAKTIRNDNSSRFGKFIQINFCERGRRIVGAEMKTYLLEKSRLVFQAPGERNYHIFYQLCAARNHQVLKDLHL-GPCESYSYLTQGGDSRIPGVDDKADFEALLKALQLLGFDEKQMSDVFRLLAGLLLLGNVHFENGEGSS------------AVSASSCQEISRLCREFWKISESDLRIWLTRREIRAVNEIVTKPLTKNEAVRSRDALTKMLYSHLFGWLVDKINEALNEKDKLDGTNQKKRPDRF--IGVLDIYGFETFDVNSFEQFSINYANEKLQQQFNQHVFKLEQEEYIREEIEWVRVDFHDNQPAIDLIEGP-VGMINLLDEQC-KRLNGSDADWLSQLQNSTELKR--NPQLAFPKVRS----NDFIVRHFAADVTYSTDGFVEKNRDAIGEQLLDVVVASKFPFIRTVIGSTAPTSVSSSSSSSTPGKRTIKKT------VASQFRDSLKELMSVLCSTRPHYVRCIKPNDSKISFDFEPKRAIQQLRACGVLETVRISAAGFPSRYPYEEFARRYRVIYTKEAALWRDKPKQFAELACQQCLEEGKYAVGKTKIFLRTGQ-VAVLERVRLDTLAAAATVIQKMWKG 792          
BLAST of unconventional myosin-Id vs. Ensembl Fly
Match: Myo31DF (gene:FBgn0086347 transcript:FBtr0304138)

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 499/1011 (49.36%), Postives = 682/1011 (67.46%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI--KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIG--LEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD-------RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCK-AFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFN----FLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            E G+ DF+L+D + ++ F+DNL KRF    IYTYIGEV V++NPY+++NIY  + + +YKGREL+E+ PH+FAIAD+A++++K++ QDTCI+ISGESG+GKTEASKII++YIA VTN  GQ+EIERVKN+L++SN ILE FGNAKTNRNDNSSRFGKYMDI FD+K DPVGGI+ NYLLEKSRVV QQ GER+FHSFYQLL GA  + L+++ LQ +  KY Y+NQG+   +  + +K+ Y+    A   +GF+  E +TIW  +AA+LHLG V+F+  E               ++  S+   +K  A+L  V+E  L+ AL++R +AA G+V+ K H    A Y +DA AKAIYDRLF+WI ++IN  I  + S   +R N        SVIGVLDIYGFEIF++NSFEQFCINYCNEKLQQLFI+LVLKQEQEEY REGI+WTNIEYFNN+ ICD+VE P  GI AI+D+ C+  G+VTD   L  +D NL K   Y SR+L PT+K ++H  DFRI HYAG V YN+NGF+EKNKD  ++DFKRLL+NS +  +  MW +GA+ + +TT+RP++ G  F+ S+  LV  L KK P YVRCIKPN +KS    D E V+HQ RYLGL+EN+RVRRAGF  R  Y +FL R+KM+S+ TWP++ +   ++G + +I++   ++DV++GHTKIFIRS +++F LE  R   +  IV +LQKR RG + RR  K+++AA  I+ AY+ YK+RSY+ +        K   DYGK + WPQ     P  G  +EA+L R+F+ WRAN +L  YP+++WP++RL+++    L  + R  +   R W GDYL  + +N +   AY  +   IR         ++VLFS F  K N   K   RA I++D  IH+L   K  FK     + + ++ SI+VS G DQ+I+ H  ++K DLVF+    +    EDRI E+V  +     D    EL V+V  N ++C+L  K  I+ +
Sbjct:    6 EAGVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFENAPHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAVTNAQGQNEIERVKNVLIQSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYELQKETGKYHYLNQGS---MDILTEKSDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEFQTIED--------------ELVISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNVMQKDHNATQAEYGKDALAKAIYDRLFTWIISRINRAILFRGSKTQARFN--------SVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELVLKQEQEEYQREGIEWTNIEYFNNKIICDLVEQPHKGIIAIMDEACLSVGKVTDDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLSEMWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLKSSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRVLIEEKKFAQDVKYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQKRVRGWIVRRNFKKMKAAITIVRAYKAYKLRSYVQELANRLRKAKQMRDYGKSIQWPQ----PPLAGRKVEAKLHRMFDFWRANMILHKYPRSEWPQLRLQIIAATALAGR-RPYWGQARRWVGDYLANSQEN-SGYEAYNGSIKNIRNHPADGETFQQVLFSSFVKKFNHFNKQANRAFIVSDSTIHKLDGIKNKFKDMKRTIKIRELTSISVSPGRDQLIVFHSSKNK-DLVFSLESEYTPLKEDRIGEVVGIVCKKYHDLTGTELRVNVTTN-ISCRLDGKARIITV 983          
BLAST of unconventional myosin-Id vs. Ensembl Fly
Match: Myo31DF (gene:FBgn0086347 transcript:FBtr0080036)

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 499/1011 (49.36%), Postives = 682/1011 (67.46%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI--KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIG--LEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD-------RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCK-AFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFN----FLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            E G+ DF+L+D + ++ F+DNL KRF    IYTYIGEV V++NPY+++NIY  + + +YKGREL+E+ PH+FAIAD+A++++K++ QDTCI+ISGESG+GKTEASKII++YIA VTN  GQ+EIERVKN+L++SN ILE FGNAKTNRNDNSSRFGKYMDI FD+K DPVGGI+ NYLLEKSRVV QQ GER+FHSFYQLL GA  + L+++ LQ +  KY Y+NQG+   +  + +K+ Y+    A   +GF+  E +TIW  +AA+LHLG V+F+  E               ++  S+   +K  A+L  V+E  L+ AL++R +AA G+V+ K H    A Y +DA AKAIYDRLF+WI ++IN  I  + S   +R N        SVIGVLDIYGFEIF++NSFEQFCINYCNEKLQQLFI+LVLKQEQEEY REGI+WTNIEYFNN+ ICD+VE P  GI AI+D+ C+  G+VTD   L  +D NL K   Y SR+L PT+K ++H  DFRI HYAG V YN+NGF+EKNKD  ++DFKRLL+NS +  +  MW +GA+ + +TT+RP++ G  F+ S+  LV  L KK P YVRCIKPN +KS    D E V+HQ RYLGL+EN+RVRRAGF  R  Y +FL R+KM+S+ TWP++ +   ++G + +I++   ++DV++GHTKIFIRS +++F LE  R   +  IV +LQKR RG + RR  K+++AA  I+ AY+ YK+RSY+ +        K   DYGK + WPQ     P  G  +EA+L R+F+ WRAN +L  YP+++WP++RL+++    L  + R  +   R W GDYL  + +N +   AY  +   IR         ++VLFS F  K N   K   RA I++D  IH+L   K  FK     + + ++ SI+VS G DQ+I+ H  ++K DLVF+    +    EDRI E+V  +     D    EL V+V  N ++C+L  K  I+ +
Sbjct:    6 EAGVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFENAPHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAVTNAQGQNEIERVKNVLIQSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYELQKETGKYHYLNQGS---MDILTEKSDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEFQTIED--------------ELVISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNVMQKDHNATQAEYGKDALAKAIYDRLFTWIISRINRAILFRGSKTQARFN--------SVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELVLKQEQEEYQREGIEWTNIEYFNNKIICDLVEQPHKGIIAIMDEACLSVGKVTDDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLSEMWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLKSSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRVLIEEKKFAQDVKYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQKRVRGWIVRRNFKKMKAAITIVRAYKAYKLRSYVQELANRLRKAKQMRDYGKSIQWPQ----PPLAGRKVEAKLHRMFDFWRANMILHKYPRSEWPQLRLQIIAATALAGR-RPYWGQARRWVGDYLANSQEN-SGYEAYNGSIKNIRNHPADGETFQQVLFSSFVKKFNHFNKQANRAFIVSDSTIHKLDGIKNKFKDMKRTIKIRELTSISVSPGRDQLIVFHSSKNK-DLVFSLESEYTPLKEDRIGEVVGIVCKKYHDLTGTELRVNVTTN-ISCRLDGKARIITV 983          
BLAST of unconventional myosin-Id vs. Ensembl Fly
Match: Myo31DF (gene:FBgn0086347 transcript:FBtr0080035)

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 499/1011 (49.36%), Postives = 682/1011 (67.46%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI--KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIG--LEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD-------RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCK-AFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFN----FLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            E G+ DF+L+D + ++ F+DNL KRF    IYTYIGEV V++NPY+++NIY  + + +YKGREL+E+ PH+FAIAD+A++++K++ QDTCI+ISGESG+GKTEASKII++YIA VTN  GQ+EIERVKN+L++SN ILE FGNAKTNRNDNSSRFGKYMDI FD+K DPVGGI+ NYLLEKSRVV QQ GER+FHSFYQLL GA  + L+++ LQ +  KY Y+NQG+   +  + +K+ Y+    A   +GF+  E +TIW  +AA+LHLG V+F+  E               ++  S+   +K  A+L  V+E  L+ AL++R +AA G+V+ K H    A Y +DA AKAIYDRLF+WI ++IN  I  + S   +R N        SVIGVLDIYGFEIF++NSFEQFCINYCNEKLQQLFI+LVLKQEQEEY REGI+WTNIEYFNN+ ICD+VE P  GI AI+D+ C+  G+VTD   L  +D NL K   Y SR+L PT+K ++H  DFRI HYAG V YN+NGF+EKNKD  ++DFKRLL+NS +  +  MW +GA+ + +TT+RP++ G  F+ S+  LV  L KK P YVRCIKPN +KS    D E V+HQ RYLGL+EN+RVRRAGF  R  Y +FL R+KM+S+ TWP++ +   ++G + +I++   ++DV++GHTKIFIRS +++F LE  R   +  IV +LQKR RG + RR  K+++AA  I+ AY+ YK+RSY+ +        K   DYGK + WPQ     P  G  +EA+L R+F+ WRAN +L  YP+++WP++RL+++    L  + R  +   R W GDYL  + +N +   AY  +   IR         ++VLFS F  K N   K   RA I++D  IH+L   K  FK     + + ++ SI+VS G DQ+I+ H  ++K DLVF+    +    EDRI E+V  +     D    EL V+V  N ++C+L  K  I+ +
Sbjct:    6 EAGVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFENAPHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAVTNAQGQNEIERVKNVLIQSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYELQKETGKYHYLNQGS---MDILTEKSDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEFQTIED--------------ELVISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNVMQKDHNATQAEYGKDALAKAIYDRLFTWIISRINRAILFRGSKTQARFN--------SVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELVLKQEQEEYQREGIEWTNIEYFNNKIICDLVEQPHKGIIAIMDEACLSVGKVTDDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLSEMWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLKSSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRVLIEEKKFAQDVKYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQKRVRGWIVRRNFKKMKAAITIVRAYKAYKLRSYVQELANRLRKAKQMRDYGKSIQWPQ----PPLAGRKVEAKLHRMFDFWRANMILHKYPRSEWPQLRLQIIAATALAGR-RPYWGQARRWVGDYLANSQEN-SGYEAYNGSIKNIRNHPADGETFQQVLFSSFVKKFNHFNKQANRAFIVSDSTIHKLDGIKNKFKDMKRTIKIRELTSISVSPGRDQLIVFHSSKNK-DLVFSLESEYTPLKEDRIGEVVGIVCKKYHDLTGTELRVNVTTN-ISCRLDGKARIITV 983          
BLAST of unconventional myosin-Id vs. Ensembl Fly
Match: Myo61F (gene:FBgn0010246 transcript:FBtr0072675)

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 349/747 (46.72%), Postives = 482/747 (64.52%), Query Frame = 3
Query:   36 ILNFLSLLRM-AFFHEGPEFGIPDFILVDNIDLK-SFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTE-KTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN--SNLKEGSKAIIDDMGISED-VQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGV 2258
            + +F S L+M    HE    G+ DF+L++N   + +F+ NL+KRF ++ IYTYIG+VL++VNPYK+L IY++  V  Y+ +  YE PPHIFA+ D A + +  +N+  C++ISGESGSGKTEASK +L++IA  +    Q  +E VK+ LLKSN +LE FGNAKTNRNDNSSRFGKYMDI FDFKG P+GG + NYLLEKSRVV Q  GER+FH FYQLL GA    L+E  L+   D Y Y+  G N  V  IND   +++V +A+  I FT  E + I+ +VA+ILHLG V F         + ++G   + K+    +  +   A L  V+ + L  AL+ R + ARGDV+      ELA YARDA AKA+YDRLFSW+  ++N  I +  K++R    +S N  +V+G+LDIYGFEIF+ NSFEQFCIN+CNEKLQQLFI+L LK EQ+EY REGI+W  +EYF+N+ IC+++E    GI +ILD+ C++PG  TD+ FLE L   L +   Y   +  P   K I    +FR+ HYAG+VTY+VNGFL+KN D  F D K  L  + N  V++ +    +    + +RP +    F+ S+  L++ L  K P Y+RCIKPN +++    + ELV HQ +YLGL+EN+RVRRAGFA R  Y  FL+R+K LSK TWP++      K G + ++ D+G  E+  + G TK+FIR  +++F  E A       I  I+Q  W+G+
Sbjct:    1 MASFNSQLKMETGLHERDRAGVQDFVLLENYQSEEAFIGNLKKRFQEDLIYTYIGQVLISVNPYKQLPIYTDDHVKAYRNKHFYEMPPHIFAVTDNAFRSLIEENRGQCVLISGESGSGKTEASKKVLQFIAACS--GNQTTVEGVKDKLLKSNPVLEAFGNAKTNRNDNSSRFGKYMDIQFDFKGAPIGGNILNYLLEKSRVVAQMGGERNFHIFYQLLAGADEALLQELRLERALDTYSYLTDGLNGTVTRINDADSFKQVQQALTVIDFTKEEQREIFGIVASILHLGNVGF---------TEVEG---NAKVNSRDL--VVTAARLLGVNASELEAALTHRTIDARGDVVTSPLNQELAIYARDALAKAVYDRLFSWLVQRLN--ISLQAKETR----ASRN--NVMGILDIYGFEIFQKNSFEQFCINFCNEKLQQLFIELTLKSEQDEYRREGIEWIPVEYFDNKVICNLIEEKHKGIISILDEECLRPGEPTDKTFLEKLTQKLAQHHHYVCHEKAPAHIKKIMLRDEFRLVHYAGEVTYSVNGFLDKNNDLLFRDLKETLSKAGNGIVRNCF---PEKELRSLKRPETAITQFRASLNNLMDILMCKEPSYIRCIKPNDLQTANVFNDELVLHQVKYLGLMENLRVRRAGFAYRRTYELFLERYKSLSKSTWPNYKGPGGPKAGVQQLVKDLGWDEEKYRVGETKLFIRWPRTLFDTEDAYQEKKHEIAAIIQAHWKGL 720          
BLAST of unconventional myosin-Id vs. Ensembl Fly
Match: Myo61F (gene:FBgn0010246 transcript:FBtr0072674)

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 349/746 (46.78%), Postives = 482/746 (64.61%), Query Frame = 3
Query:   39 LNFLSLLRM-AFFHEGPEFGIPDFILVDNIDLK-SFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTE-KTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN--SNLKEGSKAIIDDMGISED-VQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGV 2258
            ++F S L+M    HE    G+ DF+L++N   + +F+ NL+KRF ++ IYTYIG+VL++VNPYK+L IY++  V  Y+ +  YE PPHIFA+ D A + +  +N+  C++ISGESGSGKTEASK +L++IA  +    Q  +E VK+ LLKSN +LE FGNAKTNRNDNSSRFGKYMDI FDFKG P+GG + NYLLEKSRVV Q  GER+FH FYQLL GA    L+E  L+   D Y Y+  G N  V  IND   +++V +A+  I FT  E + I+ +VA+ILHLG V F         + ++G   + K+    +  +   A L  V+ + L  AL+ R + ARGDV+      ELA YARDA AKA+YDRLFSW+  ++N  I +  K++R    +S N  +V+G+LDIYGFEIF+ NSFEQFCIN+CNEKLQQLFI+L LK EQ+EY REGI+W  +EYF+N+ IC+++E    GI +ILD+ C++PG  TD+ FLE L   L +   Y   +  P   K I    +FR+ HYAG+VTY+VNGFL+KN D  F D K  L  + N  V++ +    +    + +RP +    F+ S+  L++ L  K P Y+RCIKPN +++    + ELV HQ +YLGL+EN+RVRRAGFA R  Y  FL+R+K LSK TWP++      K G + ++ D+G  E+  + G TK+FIR  +++F  E A       I  I+Q  W+G+
Sbjct:   19 IDFNSQLKMETGLHERDRAGVQDFVLLENYQSEEAFIGNLKKRFQEDLIYTYIGQVLISVNPYKQLPIYTDDHVKAYRNKHFYEMPPHIFAVTDNAFRSLIEENRGQCVLISGESGSGKTEASKKVLQFIAACS--GNQTTVEGVKDKLLKSNPVLEAFGNAKTNRNDNSSRFGKYMDIQFDFKGAPIGGNILNYLLEKSRVVAQMGGERNFHIFYQLLAGADEALLQELRLERALDTYSYLTDGLNGTVTRINDADSFKQVQQALTVIDFTKEEQREIFGIVASILHLGNVGF---------TEVEG---NAKVNSRDL--VVTAARLLGVNASELEAALTHRTIDARGDVVTSPLNQELAIYARDALAKAVYDRLFSWLVQRLN--ISLQAKETR----ASRN--NVMGILDIYGFEIFQKNSFEQFCINFCNEKLQQLFIELTLKSEQDEYRREGIEWIPVEYFDNKVICNLIEEKHKGIISILDEECLRPGEPTDKTFLEKLTQKLAQHHHYVCHEKAPAHIKKIMLRDEFRLVHYAGEVTYSVNGFLDKNNDLLFRDLKETLSKAGNGIVRNCF---PEKELRSLKRPETAITQFRASLNNLMDILMCKEPSYIRCIKPNDLQTANVFNDELVLHQVKYLGLMENLRVRRAGFAYRRTYELFLERYKSLSKSTWPNYKGPGGPKAGVQQLVKDLGWDEEKYRVGETKLFIRWPRTLFDTEDAYQEKKHEIAAIIQAHWKGL 737          
BLAST of unconventional myosin-Id vs. Ensembl Zebrafish
Match: MYO1D (myosin 1D [Source:NCBI gene;Acc:559562])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 511/1008 (50.69%), Postives = 686/1008 (68.06%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF--NFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNGVT 3083
            HE  EFG  DF+L+DN+ L+ F+ NL+ RF K RIY+YIGEV+V+VNPY+ +NIY    + +YKGRELYE PPH+FAIADAA+K +KR+N+DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV+ QQ GERSFHSFYQL+ GAP  +L+   +Q DP  Y YI  G   K  SIND A ++ V +A+  IGFT  E +T++ ++A ILHLG ++F  +             +   I +S + S+  + +L    E  + KA+  R VA   DVI K HT + A+Y RDA AKAIY+RLF WI  +IN+ I++ + D+R      H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GIFA+LD+ C+  G+VTD+MFL+ L+  L K + Y SRKL PT+K +E ERDFRI HYAG VTY+V GF++KNKD  F+DFKRLLYNS+N  +K+MW +G  S++E T+RP++    FK S+  LVE LA K P+YVRCIKPN +KSP   + E  +HQ  YLGL+ENVRVRRAGFA R  Y RFLQR+KM+S+ TWP+ + S+ KE  K ++   G   DV +G TK+FIR+ ++IF LE+ R   V  IV+ LQK WRG LAR   +R+RAA  II AYR YK++SYI + +  F +++   D+GK + WP    PK     E  L+ ++NRW A  ++      K  +IR K V T   L+  R+   + R W G+YL + S    +S   V++ D  R D+  +VLFS    K+N+  K E RA++ITD +++++   K +K   S + L  +  +++S G DQ+++ H  +++  +V     +  G+ RI ELV  L  H K   K++L V+ V + ++C +  +KC + +   ++
Sbjct:    4 HESLEFGKADFVLLDNVSLEEFMANLKLRFEKGRIYSYIGEVVVSVNPYRAMNIYGRDVIEQYKGRELYERPPHLFAIADAAYKAMKRRNKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIFQQEGERSFHSFYQLVKGAPDAQLRSLHIQRDPTAYNYIKVGGQLK-SSINDSAEFKAVADAMKVIGFTTEEIQTVYKILATILHLGNLKFGTD------------GDVTLIENSKLVSV--LGDLLSTKEENVEKAMLYRTVATGRDVIDKQHTHQEASYGRDALAKAIYERLFCWIVGRINDIIEVKNYDAR-----VHGKNTVIGVLDIYGFEIFQNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIFAVLDEACMNVGKVTDEMFLQALNGKLAKHAHYTSRKLSPTDKNLEFERDFRIRHYAGDVTYSVVGFIDKNKDTLFQDFKRLLYNSSNPVLKAMWPEGKLSITEVTKRPLTAATLFKNSMISLVEKLASKEPYYVRCIKPNDVKSPLLFEHERCKHQVEYLGLLENVRVRRAGFANRQTYPRFLQRYKMISEFTWPNHDLSSDKEAVKRLLQGCGFEHDVAYGKTKVFIRTPRTIFSLEEQRAEMVKRIVLFLQKVWRGTLARMRYRRMRAALIIIRAYRRYKVKSYIREVIRRFKNVRDMKDHGKHVKWPT--PPKVLRKFEEALRSIYNRWWAWTLIKPLSPEKTVQIRAK-VATLECLKGQRADLGLQRAWEGNYLKKDSPGTASSFTLVSS-DLQRKDKFMRVLFSSNVRKINRFNKAEDRALLITDRHLYKMDPLKQYKPMKS-IPLYNVTGVSISPGKDQLVVFHTKDNRDLIVCLQGMVPAGDSRIGELVGTLLSHFKSE-KRKLQVNTV-SPIHCSMNGRKCTVVVETKIS 984          
BLAST of unconventional myosin-Id vs. Ensembl Zebrafish
Match: myo1g (myosin IG [Source:ZFIN;Acc:ZDB-GENE-060503-562])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 482/1024 (47.07%), Postives = 662/1024 (64.65%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVA-ARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDR---KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNF----LTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKL--RKKKCILRITNGVTYFSLQTGCDGF 3116
            EG EFG  DF+L+D + ++ F++NL+ RF K+RIYT+IGEV+V+VNPY+ L+IY    + +Y+GRELYE+PPH++A+ADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+E VKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+F+F GDP GG +NNYLLEKSRVV QQ GER+FHSFYQLL G   D LK   LQ DP +Y Y +QG +  + S ND   ++ V+ A+  IGFT  E  +I+  ++ ILHLG +QF  +             E V +    M  +K+++EL         KAL  R VA   G+VI KGH+ + A+Y RDAFAKA+Y+RLF+WI  +IN  I++ D +      + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+L+L+QEQEEY REGI W +IEYFNNQ I D+VE P  GI ++LD+ C+  G+VTD + L+ ++  L +   Y SRKL P +KT+E  RDFRI HYAG VTY+V+GFL+KNKD  F+DFKRL+YNS++  +K MW DG  S++E T+RP++    FK SI  LV+ LA K P+YVRCIKPN +KSP   D    QHQ  YLGL+ENVRVRRAGFA R  YARFLQR+KM  + TWP+   S  +E  +AI++  G  +DV +G  KIF+R+ +++F LEQ R   +  +V+ LQK WRG LAR   ++IRA   I+  Y+ YK++++  +    F+S+++ +DYGK + WP    P          + ++ RW A +++   P +   E+R K+     L  + R  +   R W  DYL  A D+P  S  +V    +++      +VLFS     LN    T+ RA++ITD +I+ L   K FK     + L+ +  ++V+ G+DQ+++LH   ++ D + +     L   +DR+ ELV  +  H        L V V    L  ++  + K   +    G T    +    GF
Sbjct:    5 EGLEFGKSDFVLLDEVTMEQFMENLKLRFEKSRIYTFIGEVVVSVNPYRHLDIYGKDVIEDYRGRELYENPPHLYAVADAAYKAMKRRAKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVESVKNVLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFNFNGDPTGGHINNYLLEKSRVVQQQEGERNFHSFYQLLRGGSDDLLKSLYLQRDPAEYTYTSQGASVTLASNNDSQCHKAVMAALKVIGFTAEEISSIYKTLSTILHLGNLQFTSD------------GEHVVLVGEDM--LKNISELTSTEPENTRKALLYRTVATGGGEVIEKGHSEQEASYGRDAFAKALYERLFAWIVGRINGVIEVKDYNP-----ALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELILRQEQEEYQREGITWQHIEYFNNQIIVDLVEQPHKGIISVLDEACLIAGKVTDTVCLDSMNKKLGQHPHYTSRKLCPADKTMEFNRDFRIRHYAGDVTYSVDGFLDKNKDPLFQDFKRLMYNSSDPVLKEMWPDGKMSITEVTKRPLTAATLFKNSIIALVDKLACKEPYYVRCIKPNEVKSPLLFDDGRCQHQVAYLGLLENVRVRRAGFAYRQPYARFLQRYKMTCEYTWPNHLMSTDQEAVEAIVNQHGFEDDVAYGLNKIFVRTPRTLFTLEQERAALIPILVLFLQKVWRGALARMRCRKIRAIYTIMGYYKCYKVKAHFWEVERRFASVRNMADYGKSVEWPT--PPAALAQFHRITQHLYRRWWARQLIKNIPPSDMAEVRAKVAAFSALSGE-RMDWGYSRSWERDYLANAKDSPLMSSNFVRITKELKNKDQYGQVLFSSAVRMLNWFNNTKDRALLITDKHIYRLEPKKHFKV-QKRIALDSVVGLSVTSGSDQLVVLH-TATQDDFLVHLQRGQLNPNQDRVGELVGAITDHFTRVKSTPLPVKVCSTGLQVQMGGKPKSITVETKPGQTISDFKKSRTGF 1004          
BLAST of unconventional myosin-Id vs. Ensembl Zebrafish
Match: myo1g (myosin IG [Source:ZFIN;Acc:ZDB-GENE-060503-562])

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 472/972 (48.56%), Postives = 646/972 (66.46%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVA-ARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDR---KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNF----LTFGEDRIPELVAKL 2966
            EG EFG  DF+L+D + ++ F++NL+ RF K+RIYT+IGEV+V+VNPY+ L+IY    + +Y+GRELYE+PPH++A+ADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+E VKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+F+F GDP GG +NNYLLEKSRVV QQ GER+FHSFYQLL G   D LK   LQ DP +Y Y +QG +  + S ND   ++ V+ A+  IGFT  E  +I+  ++ ILHLG +QF  +             E V +    M  +K+++EL         KAL  R VA   G+VI KGH+ + A+Y RDAFAKA+Y+RLF+WI  +IN  I++ D +      + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+L+L+QEQEEY REGI W +IEYFNNQ I D+VE P  GI ++LD+ C+  G+VTD + L+ ++  L +   Y SRKL P +KT+E  RDFRI HYAG VTY+V+GFL+KNKD  F+DFKRL+YNS++  +K MW DG  S++E T+RP++    FK SI  LV+ LA K P+YVRCIKPN +KSP   D    QHQ  YLGL+ENVRVRRAGFA R  YARFLQR+KM  + TWP+   S  +E  +AI++  G  +DV +G  KIF+R+ +++F LEQ R   +  +V+ LQK WRG LAR   ++IRA   I+  Y+ YK++++  +    F+S+++ +DYGK + WP    P          + ++ RW A +++   P +   E+R K+     L  + R  +   R W  DYL  A D+P  S  +V    +++      +VLFS     LN    T+ RA++ITD +I+ L   K FK     + L+ +  ++V+ G+DQ+++LH   ++ D + +     L   +DR+ EL   L
Sbjct:    5 EGLEFGKSDFVLLDEVTMEQFMENLKLRFEKSRIYTFIGEVVVSVNPYRHLDIYGKDVIEDYRGRELYENPPHLYAVADAAYKAMKRRAKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVESVKNVLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFNFNGDPTGGHINNYLLEKSRVVQQQEGERNFHSFYQLLRGGSDDLLKSLYLQRDPAEYTYTSQGASVTLASNNDSQCHKAVMAALKVIGFTAEEISSIYKTLSTILHLGNLQFTSD------------GEHVVLVGEDM--LKNISELTSTEPENTRKALLYRTVATGGGEVIEKGHSEQEASYGRDAFAKALYERLFAWIVGRINGVIEVKDYNP-----ALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELILRQEQEEYQREGITWQHIEYFNNQIIVDLVEQPHKGIISVLDEACLIAGKVTDTVCLDSMNKKLGQHPHYTSRKLCPADKTMEFNRDFRIRHYAGDVTYSVDGFLDKNKDPLFQDFKRLMYNSSDPVLKEMWPDGKMSITEVTKRPLTAATLFKNSIIALVDKLACKEPYYVRCIKPNEVKSPLLFDDGRCQHQVAYLGLLENVRVRRAGFAYRQPYARFLQRYKMTCEYTWPNHLMSTDQEAVEAIVNQHGFEDDVAYGLNKIFVRTPRTLFTLEQERAALIPILVLFLQKVWRGALARMRCRKIRAIYTIMGYYKCYKVKAHFWEVERRFASVRNMADYGKSVEWPT--PPAALAQFHRITQHLYRRWWARQLIKNIPPSDMAEVRAKVAAFSALSGE-RMDWGYSRSWERDYLANAKDSPLMSSNFVRITKELKNKDQYGQVLFSSAVRMLNWFNNTKDRALLITDKHIYRLEPKKHFKV-QKRIALDSVVGLSVTSGSDQLVVLH-TATQDDFLVHLQRGQLNPNQDRVGELSTPL 952          
BLAST of unconventional myosin-Id vs. Ensembl Zebrafish
Match: myo1b (myosin IB [Source:ZFIN;Acc:ZDB-GENE-030131-695])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 341/726 (46.97%), Postives = 491/726 (67.63%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR----KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ +  +SF++NL+KRF  N IYTYIG V++++NPYK L+IYS ++V EY+ R  YE  PHI+A+AD A++ ++ Q++D CI+I+GESG+GKTEASK ++ Y+A V    GQ E+ +VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKGDP+GG+++NYLLEKSRVV Q  GER+FH FYQLL GA  D LK+  L  D  KY Y++  +++ V  ++D A ++ V  A+  +GF   E ++I  L+AA+L LG ++F+        S + G  ES ++ D +   +K M EL  + ++ L +A S R V A+ + +     +  A YARDA AK +Y RLF+W+  +INE IK   K  ++          V+GVLDIYGFEIFE+NSFEQF INYCNEKLQQ+FI+L L++EQEEY+REGI+WTNIEYFNN  ICD++E  + GI A+LD+ C++PG VTD+ FL+ L++   +   ++SR      F T+ ++ H   FRI HYAG+V Y V GF++KN D  + D  + +Y +N+N +K ++ +G        +RP + G  F+ S+  L++NL  K P+Y+RCIKPN  K+       LV HQ RYLGL+ENVRVRRAG+A R  Y   L+R+KML K+TWP W    +EG + ++ D+ + +E+  +G +KIFIR+ +++F LE+ R   ++ +  ++QK +RG
Sbjct:   13 GVGDMVLLEPLSEESFIENLKKRFDHNEIYTYIGSVVISMNPYKSLSIYSAEKVEEYRNRNFYELSPHIYALADEAYRSLRHQDKDQCILITGESGAGKTEASKFVMSYVAAVCG-KGQ-EVNKVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHIFYQLLSGASDDMLKKLKLDRDFSKYNYLSL-DSATVNGLDDAASFRTVRNAMQIVGFMEDEVQSILELIAAVLKLGNIEFK------PESRVNGFDES-RVKDKN--DLKEMCELLGIEQSVLERAFSFRTVEAKMEKVSTTLNVAQAYYARDALAKNLYSRLFTWLVNRINESIKAQTKTRKK----------VMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLREEQEEYIREGIEWTNIEYFNNAIICDLIENNKNGILAMLDEECLRPGTVTDETFLDKLNTVCAEHQHFESRLSKNSKFLTDHSLPHN-CFRIQHYAGKVLYRVEGFVDKNNDLLYRDLSQAMYKANHNLIKLLFPEG-NPAKVNLKRPPTAGFQFRASVGTLMKNLLTKNPNYIRCIKPNDKKAAHIFTDSLVCHQVRYLGLMENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPAREGVEVLLSDLQVPAEEFAYGRSKIFIRNPRTLFFLEEKRRQCLEDLAALIQKIYRG 714          
BLAST of unconventional myosin-Id vs. Ensembl Zebrafish
Match: myo1cb (myosin Ic, paralog b [Source:ZFIN;Acc:ZDB-GENE-090429-3])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 344/725 (47.45%), Postives = 470/725 (64.83%), Query Frame = 3
Query:   93 GIPDFILVDNIDLK-SFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLF--PTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ DF+L++N   + +F++NL KRF +N IYTYIG VLV+VNPYK+L IY+ + +  Y+G   YE  PHI+A+AD A++ ++ + +D CI+ISGESG+GKTEASK +L+Y A        D ++ VK+ LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKG PVGG + NYLLEKSRVV Q  GER+FH FYQL+ G   D L+  GL+ +  +Y Y+ +GN  KV SIND+  ++ V +A++ IGFT+ E + + N++A++LHLG VQ+   +S S          +   TD+    IK++A L  V    L +AL+ + + A+G+ +M     E A  ARDA +KAIY R FSW+  KIN+ +   D+       SS N  SVIG+LDIYGFE+F+NNSFEQFCINYCNEKLQQLFI+L LK EQEEY  EGI W  ++YFNN+ ICD+VE    GI +ILD+ C++PG  +D  FLE L++ +   + + + KL    T K +  E +FR+ HYAG+V YNV GFL+KN D  F + K+++  S N  +   +    +      +RP +    FK S+ KL+E L  K P YVRCIKPN  K  GR D  L++HQ +YLGL+EN+RVRRAGFA R  Y  FLQR+K L   TWP+W+    +G   ++  +G   E+ + G TKIFIR  +++F  E A       +   LQ  W+G
Sbjct:   54 GVQDFVLLENHTSEVAFIENLRKRFKENLIYTYIGSVLVSVNPYKDLEIYTKQHMERYRGVNFYEVSPHIYAVADNAYRSMRTERRDQCILISGESGAGKTEASKKVLQYYA--VTCPASDHVQTVKDRLLQSNPVLEAFGNAKTLRNDNSSRFGKYMDIQFDFKGAPVGGHILNYLLEKSRVVHQSNGERNFHIFYQLIEGGEDDLLRRLGLERNAQQYQYLVKGNCPKVSSINDRNDWKTVRKALSVIGFTDDEVEELLNIIASVLHLGNVQYGGEDSGS----------AYITTDT---QIKYLARLLGVDGTVLKEALTHKKIIAKGEELMSPLNQEQAASARDALSKAIYGRTFSWLVNKINDSLAFKDE-----SFSSKNA-SVIGLLDIYGFEVFQNNSFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGITWEPVQYFNNKIICDLVEEKFKGIISILDEECLRPGDASDITFLEKLENTVGGHAHFLTHKLADGKTRKVMGRE-EFRLIHYAGEVNYNVKGFLDKNNDLLFRNLKQVMCMSENKILNQCF---DREELSDKKRPETAATQFKNSLAKLMEILMSKEPSYVRCIKPNDAKQAGRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRRYETFLQRYKSLCPDTWPNWDGRQVDGVSTLVKHLGYKPEEYKLGRTKIFIRFPKTLFATEDALEVRKHSLATQLQSSWKG 753          
BLAST of unconventional myosin-Id vs. Ensembl Xenopus
Match: rnft2 (ring finger protein, transmembrane 2 [Source:Xenbase;Acc:XB-GENE-966981])

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 495/1011 (48.96%), Postives = 672/1011 (66.47%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQ--GNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAI---IDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKG-RSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKI-RGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG----EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             EG +FG  DF+L+D++ L  F++NL+ RF K RIYT+IGEV+V+VNPYK L IY    + +YKGRELYE PPH+F+IADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG ++NYLLEKSRV++QQ+GER+FHSFYQ++ GAP   L+   LQ D   Y Y      NN  +P  N +  +++V EA+  IGF   E +T++ ++AAILHLG ++F L+  ++         E+ K+       I  +A+L       + KAL  R VA   DVI K HT + A Y RDAFAKAIY+RLF WI  +IN+ I     D ++ D + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVL QEQ EY REGI W +I+YF+NQ I D+VE    GI A+LDD C+  G+VTD MFLE LD  L K + Y SRK+  T+K +E+ RDFRI HYAG V Y+V GF++KNKD  F+DFKRL++NS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D    +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+K++S  TWP  N +L     A+   + D G++ D  +G TKIFIR+ +++F LE+ R+  +  I++ LQK WRG LARR  KRIRA   I+  YR YK++SY+ + +  F+ +K+  DYGK + WP    PK     +  L+ ++NRWR  +++   P A+ P++R K+   + L  KG R    + R W G YL    +N  +S  +V+   ++ R D+  + LFS    K+N+  K E RAI ITD +++++   KA+K  +S  L   ++ I+V+ G DQ+++ H  ++K DL+      G    E RI ELV  L  H K   ++ L V  V + + C+   + C + +
Sbjct:    4 QEGLQFGKADFVLMDSVTLPEFMENLKLRFEKGRIYTFIGEVVVSVNPYKNLPIYGRDTIEQYKGRELYERPPHLFSIADAAYKAMKRRCKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHISNYLLEKSRVIVQQLGERNFHSFYQMILGAPEQTLRSLHLQKDISLYAYTRSLSSNNQMIP--NGQCDFKDVAEAMKVIGFKPEEIQTVYKILAAILHLGNLKFVLDGDTT-------LIENGKV-------ISVVADLLGTRSEQVEKALLFRTVATGRDVIDKQHTEKEANYGRDAFAKAIYERLFCWIVNRINDVI-----DVKQQDAALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLTQEQAEYQREGIPWKHIDYFDNQIIVDLVEQQHRGIIALLDDACMNVGKVTDNMFLEALDKQLGKHAHYSSRKVCATDKALEYNRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLMFNSSNAVLKAMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNEKKSPALFDEVRCKHQVEYLGLLENVRVRRAGFAYRQVYEKFLHRYKLISSLTWP--NHSLPSDRIAVERFMVDCGLNHDAAYGKTKIFIRTPRTLFFLEERRSEMLIRIILFLQKLWRGTLARRRCKRIRAGLTILRYYRRYKVKSYLREVMHRFNGVKNSRDYGKHVKWPT--PPKVLRRFQEALQHIYNRWRGYQIIRSLPPAEIPKVRAKVAAFENL--KGHRVDMGLQRCWEGSYLALNQENGRDSDLFVSRSSELQRKDKFMQALFSCHVRKVNRFNKVEDRAIFITDRHLYKMDPGKAYKVMTSTPLYN-VSGISVTSGKDQLVVFHTKDNK-DLIVCLGCSGQPPCESRIGELVGVLANHFKSE-RRPLQV-TVSHPIQCRQHGRSCSITV 983          
BLAST of unconventional myosin-Id vs. Ensembl Xenopus
Match: rnft2 (ring finger protein, transmembrane 2 [Source:Xenbase;Acc:XB-GENE-966981])

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 493/1013 (48.67%), Postives = 667/1013 (65.84%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAI---IDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRV----FNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKG-RSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKI-RGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG----EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             EG +FG  DF+L+D++ L  F++NL+ RF K RIYT+IGEV+V+VNPYK L IY    + +YKGRELYE PPH+F+IADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG ++NYLLEKSRV++QQ+GER+FHSFYQ++ GAP   L+   LQ D   Y Y       K  S ND   +++V EA+  IGF   E +T++ ++AAILHLG ++F L+  ++         E+ K+       I  +A+L       + KAL  R VA   DVI K HT + A Y RDAFAKAIY+RLF WI  +IN+ I     D ++ D + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVL QEQ EY REGI W +I+YF+NQ I D+VE    GI A+LDD C+  G+VTD MFLE LD  L K + Y SRK+  T+K +E+ RDFRI HYAG V Y+V GF++KNKD  F+DFKRL++NS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D    +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+K++S  TWP  N +L     A+   + D G++ D  +G TKIFIR+ +++F LE+ R+  +  I++ LQK WRG LARR  KRIRA   I+  YR YK++SY+ + +  F+ +K+  DYGK + WP    PK     +  +  +      RWR  +++   P A+ P++R K+   + L  KG R    + R W G YL    +N  +S  +V+   ++ R D+  + LFS    K+N+  K E RAI ITD +++++   KA+K  +S  L   ++ I+V+ G DQ+++ H  ++K DL+      G    E RI ELV  L  H K   ++ L V  V + + C+   + C + +
Sbjct:    4 QEGLQFGKADFVLMDSVTLPEFMENLKLRFEKGRIYTFIGEVVVSVNPYKNLPIYGRDTIEQYKGRELYERPPHLFSIADAAYKAMKRRCKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHISNYLLEKSRVIVQQLGERNFHSFYQMILGAPEQTLRSLHLQKDISLYAYTRSLAQLK-SSNNDTGDFKDVAEAMKVIGFKPEEIQTVYKILAAILHLGNLKFVLDGDTT-------LIENGKV-------ISVVADLLGTRSEQVEKALLFRTVATGRDVIDKQHTEKEANYGRDAFAKAIYERLFCWIVNRINDVI-----DVKQQDAALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLTQEQAEYQREGIPWKHIDYFDNQIIVDLVEQQHRGIIALLDDACMNVGKVTDNMFLEALDKQLGKHAHYSSRKVCATDKALEYNRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLMFNSSNAVLKAMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNEKKSPALFDEVRCKHQVEYLGLLENVRVRRAGFAYRQVYEKFLHRYKLISSLTWP--NHSLPSDRIAVERFMVDCGLNHDAAYGKTKIFIRTPRTLFFLEERRSEMLIRIILFLQKLWRGTLARRRCKRIRAGLTILRYYRRYKVKSYLREVMHRFNGVKNSRDYGKHVKWPT--PPKVLRRFQEHMPGLIVLFLFRWRGYQIIRSLPPAEIPKVRAKVAAFENL--KGHRVDMGLQRCWEGSYLALNQENGRDSDLFVSRSSELQRKDKFMQALFSCHVRKVNRFNKVEDRAIFITDRHLYKMDPGKAYKVMTSTPLYN-VSGISVTSGKDQLVVFHTKDNK-DLIVCLGCSGQPPCESRIGELVGVLANHFKSE-RRPLQV-TVSHPIQCRQHGRSCSITV 986          
BLAST of unconventional myosin-Id vs. Ensembl Xenopus
Match: rnft2 (ring finger protein, transmembrane 2 [Source:Xenbase;Acc:XB-GENE-966981])

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 486/1009 (48.17%), Postives = 665/1009 (65.91%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEF-GLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAI---IDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKI-RGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG----EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             EG +FG  DF+L+D++ L  F++NL+ RF K RIYT+IGEV+V+VNPYK L IY    + +YKGRELYE PPH+F+IADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG ++NYLLEKSRV++QQ+GER+FHSFYQ+ +     R+  F G+                ++ S ND   +++V EA+  IGF   E +T++ ++AAILHLG ++F L+  ++         E+ K+       I  +A+L       + KAL  R VA   DVI K HT + A Y RDAFAKAIY+RLF WI  +IN+ I     D ++ D + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVL QEQ EY REGI W +I+YF+NQ I D+VE    GI A+LDD C+  G+VTD MFLE LD  L K + Y SRK+  T+K +E+ RDFRI HYAG V Y+V GF++KNKD  F+DFKRL++NS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D    +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+K++S  TWP  N +L     A+   + D G++ D  +G TKIFIR+ +++F LE+ R+  +  I++ LQK WRG LARR  KRIRA   I+  YR YK++SY+ + +  F+ +K+  DYGK + WP    PK     +  L+ ++NRWR  +++   P A+ P++R K+   +  L+  R    + R W G YL    +N  +S  +V+   ++ R D+  + LFS    K+N+  K E RAI ITD +++++   KA+K  +S  L   ++ I+V+ G DQ+++ H  ++K DL+      G    E RI ELV  L  H K   ++ L V  V + + C+   + C + +
Sbjct:    4 QEGLQFGKADFVLMDSVTLPEFMENLKLRFEKGRIYTFIGEVVVSVNPYKNLPIYGRDTIEQYKGRELYERPPHLFSIADAAYKAMKRRCKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHISNYLLEKSRVIVQQLGERNFHSFYQVSHEILGFRILFFHGIM---------------ELSSNNDTGDFKDVAEAMKVIGFKPEEIQTVYKILAAILHLGNLKFVLDGDTT-------LIENGKV-------ISVVADLLGTRSEQVEKALLFRTVATGRDVIDKQHTEKEANYGRDAFAKAIYERLFCWIVNRINDVI-----DVKQQDAALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLTQEQAEYQREGIPWKHIDYFDNQIIVDLVEQQHRGIIALLDDACMNVGKVTDNMFLEALDKQLGKHAHYSSRKVCATDKALEYNRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLMFNSSNAVLKAMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNEKKSPALFDEVRCKHQVEYLGLLENVRVRRAGFAYRQVYEKFLHRYKLISSLTWP--NHSLPSDRIAVERFMVDCGLNHDAAYGKTKIFIRTPRTLFFLEERRSEMLIRIILFLQKLWRGTLARRRCKRIRAGLTILRYYRRYKVKSYLREVMHRFNGVKNSRDYGKHVKWPT--PPKVLRRFQEALQHIYNRWRGYQIIRSLPPAEIPKVRAKVAAFEN-LKGHRVDMGLQRCWEGSYLALNQENGRDSDLFVSRSSELQRKDKFMQALFSCHVRKVNRFNKVEDRAIFITDRHLYKMDPGKAYKVMTSTPLYN-VSGISVTSGKDQLVVFHTKDNK-DLIVCLGCSGQPPCESRIGELVGVLANHFKSE-RRPLQV-TVSHPIQCRQHGRSCSITV 969          
BLAST of unconventional myosin-Id vs. Ensembl Xenopus
Match: rnft2 (ring finger protein, transmembrane 2 [Source:Xenbase;Acc:XB-GENE-966981])

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 481/1008 (47.72%), Postives = 653/1008 (64.78%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEF-GLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAI---IDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASD--NPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG----EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             EG +FG  DF+L+D++ L  F++NL+ RF K RIYT+IGEV+V+VNPYK L IY    + +YKGRELYE PPH+F+IADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG ++NYLLEKSRV++QQ+GER+FHSFYQ+ +     R+  F G+                ++ S ND   +++V EA+  IGF   E +T++ ++AAILHLG ++F L+  ++         E+ K+       I  +A+L       + KAL  R VA   DVI K HT + A Y RDAFAKAIY+RLF WI  +IN+ I     D ++ D + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVL QEQ EY REGI W +I+YF+NQ I D+VE    GI A+LDD C+  G+VTD MFLE LD  L K + Y SRK+  T+K +E+ RDFRI HYAG V Y+V GF++KNKD  F+DFKRL++NS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D    +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+K++S  TWP  N +L     A+   + D G++ D  +G TKIFIR+ +++F LE+ R+  +  I++ LQK WRG LARR  KRIRA   I+  YR YK++SY+ + +  F+ +K+  DYGK + WP    PK     +  L+ ++NRWR  +++   P A+ P++R K+   +  L+  R    + R W G YL  +S    P  SL   N                 + +N+  K E RAI ITD +++++   KA+K  +S  L   ++ I+V+ G DQ+++ H  ++K DL+      G    E RI ELV  L  H    FK+      V + + C+   + C + +
Sbjct:    4 QEGLQFGKADFVLMDSVTLPEFMENLKLRFEKGRIYTFIGEVVVSVNPYKNLPIYGRDTIEQYKGRELYERPPHLFSIADAAYKAMKRRCKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHISNYLLEKSRVIVQQLGERNFHSFYQVSHEILGFRILFFHGIM---------------ELSSNNDTGDFKDVAEAMKVIGFKPEEIQTVYKILAAILHLGNLKFVLDGDTT-------LIENGKV-------ISVVADLLGTRSEQVEKALLFRTVATGRDVIDKQHTEKEANYGRDAFAKAIYERLFCWIVNRINDVI-----DVKQQDAALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLTQEQAEYQREGIPWKHIDYFDNQIIVDLVEQQHRGIIALLDDACMNVGKVTDNMFLEALDKQLGKHAHYSSRKVCATDKALEYNRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLMFNSSNAVLKAMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNEKKSPALFDEVRCKHQVEYLGLLENVRVRRAGFAYRQVYEKFLHRYKLISSLTWP--NHSLPSDRIAVERFMVDCGLNHDAAYGKTKIFIRTPRTLFFLEERRSEMLIRIILFLQKLWRGTLARRRCKRIRAGLTILRYYRRYKVKSYLREVMHRFNGVKNSRDYGKHVKWPT--PPKVLRRFQEALQHIYNRWRGYQIIRSLPPAEIPKVRAKVAAFEN-LKGHRVDMGLQRCWEGSYLAPSSGKIQPELSLQLANIEK--------------TTVNRFNKVEDRAIFITDRHLYKMDPGKAYKVMTSTPLYN-VSGISVTSGKDQLVVFHTKDNK-DLIVCLGCSGQPPCESRIGELVGVLANH----FKRRPLQVTVSHPIQCRQHGRSCSITV 952          
BLAST of unconventional myosin-Id vs. Ensembl Xenopus
Match: rnft2 (ring finger protein, transmembrane 2 [Source:Xenbase;Acc:XB-GENE-966981])

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 477/979 (48.72%), Postives = 641/979 (65.47%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAI---IDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKI-RGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG----EDRIPELVAKLFLHCK 2981
             EG +FG  DF+L+D++ L  F++NL+ RF K RIYT+IGEV+V+VNPYK L IY    + +YKGRELYE PPH+F+IADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG ++NYLLEK   VM            Q++ GAP   L+   LQ D   Y Y       K  S ND   +++V EA+  IGF   E +T++ ++AAILHLG ++F L+  ++         E+ K+       I  +A+L       + KAL  R VA   DVI K HT + A Y RDAFAKAIY+RLF WI  +IN+ I     D ++ D + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVL QEQ EY REGI W +I+YF+NQ I D+VE    GI A+LDD C+  G+VTD MFLE LD  L K + Y SRK+  T+K +E+ RDFRI HYAG V Y+V GF++KNKD  F+DFKRL++NS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D    +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+K++S  TWP  N +L     A+   + D G++ D  +G TKIFIR+ +++F LE+ R+  +  I++ LQK WRG LARR  KRIRA   I+  YR YK++SY+ + +  F+ +K+  DYGK + WP    PK     +  L+ ++NRWR  +++   P A+ P++R K+   +  L+  R    + R W G YL    +N  +S  +V+   ++ R D+  + LFS    K+N+  K E RAI ITD +++++   KA+K  +S  L   ++ I+V+ G DQ+++ H  ++K DL+      G    E RI ELV  L  H K
Sbjct:    4 QEGLQFGKADFVLMDSVTLPEFMENLKLRFEKGRIYTFIGEVVVSVNPYKNLPIYGRDTIEQYKGRELYERPPHLFSIADAAYKAMKRRCKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHISNYLLEKDNDVM---------ILLQMILGAPEQTLRSLHLQKDISLYAYTRSLAQLK-SSNNDTGDFKDVAEAMKVIGFKPEEIQTVYKILAAILHLGNLKFVLDGDTT-------LIENGKV-------ISVVADLLGTRSEQVEKALLFRTVATGRDVIDKQHTEKEANYGRDAFAKAIYERLFCWIVNRINDVI-----DVKQQDAALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLTQEQAEYQREGIPWKHIDYFDNQIIVDLVEQQHRGIIALLDDACMNVGKVTDNMFLEALDKQLGKHAHYSSRKVCATDKALEYNRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLMFNSSNAVLKAMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNEKKSPALFDEVRCKHQVEYLGLLENVRVRRAGFAYRQVYEKFLHRYKLISSLTWP--NHSLPSDRIAVERFMVDCGLNHDAAYGKTKIFIRTPRTLFFLEERRSEMLIRIILFLQKLWRGTLARRRCKRIRAGLTILRYYRRYKVKSYLREVMHRFNGVKNSRDYGKHVKWPT--PPKVLRRFQEALQHIYNRWRGYQIIRSLPPAEIPKVRAKVAAFEN-LKGHRVDMGLQRCWEGSYLALNQENGRDSDLFVSRSSELQRKDKFMQALFSCHVRKVNRFNKVEDRAIFITDRHLYKMDPGKAYKVMTSTPLYN-VSGISVTSGKDQLVVFHTKDNK-DLIVCLGCSGQPPCESRIGELVGVLANHFK 946          
BLAST of unconventional myosin-Id vs. Ensembl Mouse
Match: Myo1d (myosin ID [Source:MGI Symbol;Acc:MGI:107728])

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 505/1010 (50.00%), Postives = 665/1010 (65.84%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKH------MAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    V +YKGRELYE PPH+FAIADAA+K +KR+++DTCI+ISGESG+GKTEASK I++YIA +TN S + EIERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L    LQ     Y YI  G   K  SIND A ++ V +A+  IGF   E +T++ ++A ILHLG ++F                    I D   P I++      +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD MFLE L+S L K   + SRK   ++K +E +RDFRI HYAG V Y+  GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G +KIFIR+ +++F LE+ R   +  +V+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K   K+ L V+V  N + C L  KKC + +
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKVLNIYGRDTVEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIMISGESGAGKTEASKYIMQYIAAITNPSQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLHSLHLQKSLSSYNYIRVGAQLK-SSINDAAEFKVVADAMKVIGFKPEEIQTVYKILAVILHLGNLKF--------------------IVDGDTPLIENGKVVSVIAELLSTKADMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDGMFLEALNSKLGKHGHFSSRKTCASDKILEFDRDFRIRHYAGDVVYSAIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKSKIFIRTPRTLFTLEELRAQMLVRVVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKNMRDYGKHVKWPT--PPKVLRRFEEALQSIFNRWRASQLIKTIPASDLPQVRAKVAAME-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSE-KRHLQVNVT-NPVQCSLHGKKCTVSV 981          
BLAST of unconventional myosin-Id vs. Ensembl Mouse
Match: Myo1d (myosin ID [Source:MGI Symbol;Acc:MGI:107728])

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 487/971 (50.15%), Postives = 639/971 (65.81%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKH------MAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELV 2957
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    V +YKGRELYE PPH+FAIADAA+K +KR+++DTCI+ISGESG+GKTEASK I++YIA +TN S + EIERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L    LQ     Y YI  G   K  SIND A ++ V +A+  IGF   E +T++ ++A ILHLG ++F                    I D   P I++      +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD MFLE L+S L K   + SRK   ++K +E +RDFRI HYAG V Y+  GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G +KIFIR+ +++F LE+ R   +  +V+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K      +++ I    +S      + LH L  ++    NF T   + +P LV
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKVLNIYGRDTVEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIMISGESGAGKTEASKYIMQYIAAITNPSQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLHSLHLQKSLSSYNYIRVGAQLK-SSINDAAEFKVVADAMKVIGFKPEEIQTVYKILAVILHLGNLKF--------------------IVDGDTPLIENGKVVSVIAELLSTKADMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDGMFLEALNSKLGKHGHFSSRKTCASDKILEFDRDFRIRHYAGDVVYSAIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKSKIFIRTPRTLFTLEELRAQMLVRVVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKNMRDYGKHVKWPT--PPKVLRRFEEALQSIFNRWRASQLIKTIPASDLPQVRAKVAAME-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYK------VMKTIPLYNISHAHSSALTLHLLLGRT----NFRTM--EWLPPLV 933          
BLAST of unconventional myosin-Id vs. Ensembl Mouse
Match: Myo1g (myosin IG [Source:MGI Symbol;Acc:MGI:1927091])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 467/981 (47.60%), Postives = 656/981 (66.87%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSIN----DKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQF-ELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARG-DVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIR---GDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG---EDRIPELVAKLFLHCK 2981
            EGPE+G PDF+L+D + ++ F+ NLE RF K RIYTYIGEVLV+VNPY+EL +Y  + + +Y+GRELYE PPH++A+A+AA+K +KR+++DTCIVISGESG+GKTEASK I++YIA VTN S + E+ERVKN+LLKS C+LE FGNA+TNRN NSSRFGKYMDI+FDFKGDPVGG +++YLLEKSRV+ Q VGER+FH+FYQLL G+    L+   L+ +P  Y +  QG    +   N    D+  +Q V+EA+  IGF+  E ++I  ++AAILHLG ++F E  E+  Q   ++ A E++         + ++A+L       + + L  R VA+ G +VI K HT+  A+YARDA AKA+Y RLF W+  KIN  ++  ++D R +      K +VIGVLDIYGFE+F  NSFEQFCINYCNEKLQQLFIQL+LKQEQEEY REGI W  IEYFNN  I ++VE P  GI A+LD+ C   G +TD++FL+ LD++ +    Y SR+L PT+KT+E  RDF+I HYAG VTY+V GF++KN+D+ F+DFKRLLYNS + T+++MW DG + ++E T+RP++ G  FK S+  LVENLA K P YVRCIKPN  K  GRLD    +HQ  YLGL+ENVRVRRAGFA+R  Y RFL R+KM  + TWP+    + ++   A+++  G+  DV +GH+K+FIRS +++  LEQ+R   +  IV++LQK WRG LAR   +R+RA   I+  +R +K+R+++++    F + +    YG++L WP    P      +   + +F+RWRA +++   P +   +I+ K+      LQ  R  +   R W  DYL   +DNPT S  +      +R   G   VLFS    K+N+  K+  RA+++TD Y+++L   + ++   + V LE +  ++V+ G DQ+++LH  +   DLV          ++RI ELV  L  HC+
Sbjct:   11 EGPEYGKPDFVLLDQLTMEDFMKNLELRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIAKYQGRELYERPPHLYAVANAAYKAMKRRSRDTCIVISGESGAGKTEASKHIMQYIAAVTNPSQRAEVERVKNVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPVGGHIHSYLLEKSRVLKQHVGERNFHAFYQLLRGSEDQELQGLHLERNPAVYNFTRQGAGLNMGVHNALDSDEKSHQGVMEAMRIIGFSPDEVESIHRILAAILHLGNIEFVETEENGPQKGGLEVADEAL---------VGYVAKLTATPRDLVLRTLLARTVASGGREVIEKSHTVAEASYARDACAKAMYQRLFEWVVNKINSIMEPRNRDPRCD-----GKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQQLFIQLILKQEQEEYEREGIAWQTIEYFNNATIVELVEQPHRGILAVLDEACSTAGPITDRIFLQTLDTHHRHHPHYSSRQLCPTDKTMEFGRDFQIKHYAGDVTYSVEGFIDKNRDSLFQDFKRLLYNSVDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVRCIKPNEDKVAGRLDEAHCRHQVEYLGLLENVRVRRAGFASRQPYPRFLLRYKMTCEYTWPNHLLGSDRDAVSALLEQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQKAWRGTLARWHCRRLRAIYTIMRWFRRHKVRAHLIELQRRFQAARQPPLYGRDLVWPT--PPAVLQPFQDTCRVLFSRWRARQLVKNIPPSDMIQIKAKVAAMGA-LQGLRQDWGCQRAWARDYLSSDTDNPTASHLFAEQLKALREKDGFGSVLFSSHVRKVNRFRKSRDRALLLTDRYLYKLEPGRQYRVMRA-VPLEAVTGLSVTSGRDQLVVLH-AQGYDDLVVCLHRSQPPLDNRIGELVGMLAAHCQ 972          
BLAST of unconventional myosin-Id vs. Ensembl Mouse
Match: Myo1a (myosin IA [Source:MGI Symbol;Acc:MGI:107732])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 393/1051 (37.39%), Postives = 601/1051 (57.18%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERD---FRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXY-------RHY-KIRSYIVKFVANFSSLKSRSDYGKEL------------------------------------SWPQYRVPKPCIGL-EAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRS-KFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNK-KGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNG 3077
            EGP  G+ D IL++ +D +S + NL+ R+    IYTYIG V++++NPY++L IY  + + +Y+    YE  PHI+A+A+ A++ +K +++D CI+I+GESG+GKTEASK+++ Y+A V      +++  VK  LL+SN +LE FGNAKT RN+NSSRFGKYMDI FDFKG P+GG++ NYLLEKSRVV Q  GER+FH FYQLL GA +  LK   L+ D   Y Y+N G  SKV  ++D + ++ V  A++ IGF+  E + +  + A +L LG V+   +E  +      G      I D     I+ + E+  ++   L +AL  R +    + ++    +  A YARDA AK IY RLF WI  +INE IK+   + ++          V+GVLDIYGFEI E+NSFEQF INYCNE+LQQ+FI+L LK+EQEEY REGI WT +EYF+N  IC+++E  + GI A+LD+ C++PG V+D  FL  L+    K S Y+S+     ++  +       FRI HYAG+VTYNV GF++KN D  F D  + ++ + +  +KS++ +G      + +RP + G  FK S+  L++NL  K P+Y+RCIKPN  +  GR   E+V  Q RYLGL+ENVRVRRAG+A R  Y  FL+R+++LS+ TWP WN + +EG + ++  + + SE++ +G TKIFIRS +++F LE+ R   +  +  ++QK +RG   R   +++R +  +I+A+       +HY KIRS ++   A     ++R +Y K                                      +WP    P  C      EL+R+F +W+  K        +   +R KL  +++   K  S   ++   +RGDY+     NP         R K R +  VL +    K+N+  GKT  R +++T  ++  LT  K   +    + LE +  ++VS   D +  LH  E  S +    +    D + EL+ K++    DA +++L+V V E   + + ++    +++  G
Sbjct:    5 EGP-VGVEDLILLEPLDEESLIKNLQLRYENKEIYTYIGNVVISMNPYEQLPIYGPEFIAKYRDYTFYELKPHIYALANVAYQSLKDRDRDQCILITGESGAGKTEASKLVMSYVAAVCGKG--EQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITNYLLEKSRVVKQLKGERNFHIFYQLLAGADAQLLKALKLEEDTSVYGYLN-GEVSKVNGMDDASNFRAVQHAMSVIGFSEEEIRQVLEVTALVLKLGNVKLT-DEFQANGIPASG------ICDGK--GIQEIGEMMGLNSTELERALCSRTMETGKEKVVTVLNVTQAQYARDALAKNIYSRLFDWIVKRINESIKVGTGEKKK----------VMGVLDIYGFEILEDNSFEQFVINYCNERLQQVFIELTLKEEQEEYKREGIPWTKVEYFDNGIICNLIEHSQRGILAMLDEECLRPGVVSDSTFLAKLNQLFSKHSHYESKVSQNAQRQYDRTMGLSCFRISHYAGKVTYNVTGFIDKNNDLLFRDLSQTMWKAQHPLLKSLFPEGNPK-EASLKRPPTAGTQFKNSVAVLMKNLYSKNPNYIRCIKPNDQQQKGRFTSEMVMVQARYLGLLENVRVRRAGYAFRQGYKPFLERYRLLSRSTWPRWNGDDREGVEKVLGSLTLSSEELAYGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKVYRGWRCRTHYQQMRKSQILISAWFRGNKQKKHYGKIRSSVLLIQAFVRGWRARKNYRKYFRSGAALTLANFIYQSMAQKFLLNLKKNLPSTKVLDNTWPA--APYRCFNTANQELQRLFYQWKCKKFRDQLSPKQVQTLREKLCASELFKGKKASYPQSVPIPFRGDYIG-LQGNPKLQ------RLKGREEGPVLVADTVKKVNRGNGKTSARILLLTKGHVI-LTDAKK-SQAQIVIGLEDVAGVSVSSLQDGLFSLHLSEMSSAVSKGDILLVSDHVVELLTKMYQAVLDATQRQLSVTVTEK-FSVRFKEGSVAVKVIQG 1019          
BLAST of unconventional myosin-Id vs. Ensembl Mouse
Match: Myo1b (myosin IB [Source:MGI Symbol;Acc:MGI:107752])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 334/726 (46.01%), Postives = 485/726 (66.80%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR----KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGIS-EDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ ++ ++F+DNL+KRF  N IYTYIG V+++VNPY+ L IYS ++V +Y+ R  YE  PHIFA++D A++ ++ Q++D CI+I+GESG+GKTEASK+++ Y+A V       E+ +VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKGDP+GG+++NYLLEKSRVV Q  GER+FH FYQLL GA  + L +  L+ D  +Y Y++  +++KV  ++D A ++ V  A+  +GF + E++ +  +VAA+L LG ++F+        S + G  ES KI D +   +K + EL  + +  L +A S R V A+ + +     +  A YARDA AK +Y RLFSW+  +INE IK   K  ++          V+GVLDIYGFEIFE+NSFEQF INYCNEKLQQ+FI+L LK+EQEEY+RE I+WT+I+YFNN  ICD++E    GI A+LD+ C++PG VTD+ FLE L+        ++SR      F  + T+ H   FRI HYAG+V Y V GF++KN D  + D  + ++ + ++ +KS++ +G        +RP + G+ FK S+  L+ NL  K P+Y+RCIKPN  K+    +  LV HQ RYLGL+ENVRVRRAG+A R  Y   L+R+KML K+TWP W    + G + + +++ I  E+  +G +KIFIR+ +++F+LE  R   ++ +  ++QK +RG
Sbjct:   22 GVGDMVLLEPLNEETFIDNLKKRFDHNEIYTYIGSVVISVNPYRSLPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGA--EVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLYKLKLERDFSRYNYLSL-DSAKVNGVDDAANFRTVRNAMQIVGFLDHEAEAVLEVVAAVLKLGNIEFK------PESRVNGLDES-KIKDKN--ELKEICELTSIDQVVLERAFSFRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKK----------VMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLNQVCATHQHFESRMSKCSRFLNDTTLPHS-CFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKAGHSLIKSLFPEG-NPAKVNLKRPPTAGSQFKASVATLMRNLQTKNPNYIRCIKPNDKKAAHIFNESLVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLFQLEDLRKQRLEDLATLIQKIYRG 723          
BLAST of unconventional myosin-Id vs. UniProt/SwissProt
Match: sp|E7F9L8|MYO1D_DANRE (Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 511/1008 (50.69%), Postives = 686/1008 (68.06%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF--NFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNGVT 3083
            HE  EFG  DF+L+DN+ L+ F+ NL+ RF K RIY+YIGEV+V+VNPY+ +NIY    + +YKGRELYE PPH+FAIADAA+K +KR+N+DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV+ QQ GERSFHSFYQL+ GAP  +L+   +Q DP  Y YI  G   K  SIND A ++ V +A+  IGFT  E +T++ ++A ILHLG ++F  +             +   I +S + S+  + +L    E  + KA+  R VA   DVI K HT + A+Y RDA AKAIY+RLF WI  +IN+ I++ + D+R      H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GIFA+LD+ C+  G+VTD+MFL+ L+  L K + Y SRKL PT+K +E ERDFRI HYAG VTY+V GF++KNKD  F+DFKRLLYNS+N  +K+MW +G  S++E T+RP++    FK S+  LVE LA K P+YVRCIKPN +KSP   + E  +HQ  YLGL+ENVRVRRAGFA R  Y RFLQR+KM+S+ TWP+ + S+ KE  K ++   G   DV +G TK+FIR+ ++IF LE+ R   V  IV+ LQK WRG LAR   +R+RAA  II AYR YK++SYI + +  F +++   D+GK + WP    PK     E  L+ ++NRW A  ++      K  +IR K V T   L+  R+   + R W G+YL + S    +S   V++ D  R D+  +VLFS    K+N+  K E RA++ITD +++++   K +K   S + L  +  +++S G DQ+++ H  +++  +V     +  G+ RI ELV  L  H K   K++L V+ V + ++C +  +KC + +   ++
Sbjct:    4 HESLEFGKADFVLLDNVSLEEFMANLKLRFEKGRIYSYIGEVVVSVNPYRAMNIYGRDVIEQYKGRELYERPPHLFAIADAAYKAMKRRNKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIFQQEGERSFHSFYQLVKGAPDAQLRSLHIQRDPTAYNYIKVGGQLK-SSINDSAEFKAVADAMKVIGFTTEEIQTVYKILATILHLGNLKFGTD------------GDVTLIENSKLVSV--LGDLLSTKEENVEKAMLYRTVATGRDVIDKQHTHQEASYGRDALAKAIYERLFCWIVGRINDIIEVKNYDAR-----VHGKNTVIGVLDIYGFEIFQNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIFAVLDEACMNVGKVTDEMFLQALNGKLAKHAHYTSRKLSPTDKNLEFERDFRIRHYAGDVTYSVVGFIDKNKDTLFQDFKRLLYNSSNPVLKAMWPEGKLSITEVTKRPLTAATLFKNSMISLVEKLASKEPYYVRCIKPNDVKSPLLFEHERCKHQVEYLGLLENVRVRRAGFANRQTYPRFLQRYKMISEFTWPNHDLSSDKEAVKRLLQGCGFEHDVAYGKTKVFIRTPRTIFSLEEQRAEMVKRIVLFLQKVWRGTLARMRYRRMRAALIIIRAYRRYKVKSYIREVIRRFKNVRDMKDHGKHVKWPT--PPKVLRKFEEALRSIYNRWWAWTLIKPLSPEKTVQIRAK-VATLECLKGQRADLGLQRAWEGNYLKKDSPGTASSFTLVSS-DLQRKDKFMRVLFSSNVRKINRFNKAEDRALLITDRHLYKMDPLKQYKPMKS-IPLYNVTGVSISPGKDQLVVFHTKDNRDLIVCLQGMVPAGDSRIGELVGTLLSHFKSE-KRKLQVNTV-SPIHCSMNGRKCTVVVETKIS 984          
BLAST of unconventional myosin-Id vs. UniProt/SwissProt
Match: sp|Q17R14|MYO1D_BOVIN (Unconventional myosin-Id OS=Bos taurus OX=9913 GN=MYO1D PE=2 SV=1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 511/1004 (50.90%), Postives = 674/1004 (67.13%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    + +YKGRELYE PPH+FAIADAA+K +KR+++DTCIVISGESG+GKTEASK I++YIA +TN S + EIERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L+   LQ     Y YI+ G   K  SIND A ++ V +A+  IGF   E +T + ++AAILHLG ++F ++             ++  I D  + SI  +AEL       + KAL  R VA   DVI K HT + A+Y RDAFAKAIY+RLF WI ++IN+ I + + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD+MFLE L+S L K   + SRKL  ++K +E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN +KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +++  G  +DV +G TKIFIR+ +++F LE+ R   +  IV+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ VFNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K   K+ L V+V  N + C L  KKC + +
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKSLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSDQMLRSLHLQKSLSSYSYIHVGAQLK-SSINDAAEFKVVADAMKVIGFKPEEIQTAYKILAAILHLGNLKFVVD------------GDTTLIEDGKLVSI--IAELLSTKTDMVEKALLYRTVATGRDVIDKQHTEQEASYGRDAFAKAIYERLFCWIVSRINDIIAVKNSDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHGHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTRRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDMKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLVEYCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLVRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGIKTMRDYGKHVQWPT--PPKVLHRFEEVLQAVFNRWRASQLIKTIPASDLPQVRAKVAAVE-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSE-KRHLQVNVT-NPVQCSLHGKKCTVSV 981          
BLAST of unconventional myosin-Id vs. UniProt/SwissProt
Match: sp|F1PRN2|MYO1D_CANLF (Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2)

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 509/1004 (50.70%), Postives = 676/1004 (67.33%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    + +YKGRELYE PPH+FAIADAA+K +KR+++DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L+   LQ     Y YI+ G   K  SIND A ++ V +A+  IGF   E++T++ ++AAILHLG ++F ++             ++  I +  + SI  +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD+MFLE L+S L K   + SRKL  ++K +E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRLLYNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G TKIFIR+ +++F LE+ R   +  IV+ LQK WRG LAR   KR +AA  II  YRHYK++SYI +    F  +K+  D+GK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K   K+ L V+V  N + C L  KKC + +
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKALNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLK-SSINDAAEFKVVADAMKVIGFKPEETQTVYKILAAILHLGNLKFMVD------------GDTPLIENGKVVSI--IAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHGHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLLYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIEHCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRHYKVKSYIQEVARRFHGVKTMKDHGKHVKWPT--PPKVLRRFEEALQAIFNRWRASQLIKSLPASDLPQVRAKVAAME-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSE-KRHLQVNVT-NPVQCSLHGKKCTVSV 981          
BLAST of unconventional myosin-Id vs. UniProt/SwissProt
Match: sp|Q23978|MY31D_DROME (Unconventional myosin ID OS=Drosophila melanogaster OX=7227 GN=Myo31DF PE=1 SV=1)

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 499/1011 (49.36%), Postives = 682/1011 (67.46%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI--KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIG--LEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD-------RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCK-AFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFN----FLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            E G+ DF+L+D + ++ F+DNL KRF    IYTYIGEV V++NPY+++NIY  + + +YKGREL+E+ PH+FAIAD+A++++K++ QDTCI+ISGESG+GKTEASKII++YIA VTN  GQ+EIERVKN+L++SN ILE FGNAKTNRNDNSSRFGKYMDI FD+K DPVGGI+ NYLLEKSRVV QQ GER+FHSFYQLL GA  + L+++ LQ +  KY Y+NQG+   +  + +K+ Y+    A   +GF+  E +TIW  +AA+LHLG V+F+  E               ++  S+   +K  A+L  V+E  L+ AL++R +AA G+V+ K H    A Y +DA AKAIYDRLF+WI ++IN  I  + S   +R N        SVIGVLDIYGFEIF++NSFEQFCINYCNEKLQQLFI+LVLKQEQEEY REGI+WTNIEYFNN+ ICD+VE P  GI AI+D+ C+  G+VTD   L  +D NL K   Y SR+L PT+K ++H  DFRI HYAG V YN+NGF+EKNKD  ++DFKRLL+NS +  +  MW +GA+ + +TT+RP++ G  F+ S+  LV  L KK P YVRCIKPN +KS    D E V+HQ RYLGL+EN+RVRRAGF  R  Y +FL R+KM+S+ TWP++ +   ++G + +I++   ++DV++GHTKIFIRS +++F LE  R   +  IV +LQKR RG + RR  K+++AA  I+ AY+ YK+RSY+ +        K   DYGK + WPQ     P  G  +EA+L R+F+ WRAN +L  YP+++WP++RL+++    L  + R  +   R W GDYL  + +N +   AY  +   IR         ++VLFS F  K N   K   RA I++D  IH+L   K  FK     + + ++ SI+VS G DQ+I+ H  ++K DLVF+    +    EDRI E+V  +     D    EL V+V  N ++C+L  K  I+ +
Sbjct:    6 EAGVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFENAPHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAVTNAQGQNEIERVKNVLIQSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYELQKETGKYHYLNQGS---MDILTEKSDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEFQTIED--------------ELVISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNVMQKDHNATQAEYGKDALAKAIYDRLFTWIISRINRAILFRGSKTQARFN--------SVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELVLKQEQEEYQREGIEWTNIEYFNNKIICDLVEQPHKGIIAIMDEACLSVGKVTDDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLSEMWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLKSSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRVLIEEKKFAQDVKYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQKRVRGWIVRRNFKKMKAAITIVRAYKAYKLRSYVQELANRLRKAKQMRDYGKSIQWPQ----PPLAGRKVEAKLHRMFDFWRANMILHKYPRSEWPQLRLQIIAATALAGR-RPYWGQARRWVGDYLANSQEN-SGYEAYNGSIKNIRNHPADGETFQQVLFSSFVKKFNHFNKQANRAFIVSDSTIHKLDGIKNKFKDMKRTIKIRELTSISVSPGRDQLIVFHSSKNK-DLVFSLESEYTPLKEDRIGEVVGIVCKKYHDLTGTELRVNVTTN-ISCRLDGKARIITV 983          
BLAST of unconventional myosin-Id vs. UniProt/SwissProt
Match: sp|O94832|MYO1D_HUMAN (Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 508/1004 (50.60%), Postives = 675/1004 (67.23%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRK---VLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV--FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
             E  EFG  DF+L+D + +  F+ NL  RF K RIYT+IGEV+V+VNPYK LNIY    + +YKGRELYE PPH+FAIADAA+K +KR+++DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV++QQ GERSFHSFYQLL G     L+   LQ     Y YI+ G   K  SIND A ++ V +A+  IGF   E +T++ ++AAILHLG ++F ++             ++  I +  + SI  +AEL       + KAL  R VA   D+I K HT + A+Y RDAFAKAIY+RLF WI  +IN+ I++ + D+     + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GI AILDD C+  G+VTD+MFLE L+S L K + + SRKL  ++K +E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRL+YNS+N  +K+MW +G  S++E T+RP++    FK S+  LV+NLA K P+YVRCIKPN  KSP   D E  +HQ  YLGL+ENVRVRRAGFA R  Y +FL R+KM+S+ TWP+ +  + KE  K +I+  G  +DV +G TKIFIR+ +++F LE+ R   +  IV+ LQK WRG LAR   KR +AA  II  YR YK++SYI +    F  +K+  DYGK + WP    PK     E  L+ +FNRWRA++++   P +  P++R K+   + +L+  R+   + R W G+YL    D P  S  +V   ++++   K   VLFS    K+N+  K E RAI +TD +++++   K +K   + + L  +  ++VS G DQ+++ H  ++K  +V  F+     E RI ELV  L  H K   K+ L V+V  N + C L  KKC + +
Sbjct:    4 QESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLK-SSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVD------------GDTPLIENGKVVSI--IAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDT-----TIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPS--PPKVLRRFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVE-MLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKT-IPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSE-KRHLQVNVT-NPVQCSLHGKKCTVSV 981          
BLAST of unconventional myosin-Id vs. TrEMBL
Match: A0A1S3ITX2 (unconventional myosin-Id OS=Lingula unguis OX=7574 GN=LOC106167411 PE=3 SV=1)

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 523/1009 (51.83%), Postives = 705/1009 (69.87%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCI-GLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIR---GDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTF-GEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKL--RKKKCILRITNG 3077
            HEGPEFGI DF+L++ + L  F++NL  RF K R YTYIGEV+V+VNPY+ LNIY    V +Y+GRE+YE PPHIFAIADAA+K++KR+++DTCIVISGESG+GKTEASKII+RYIA +T +SGQ E+ RVK++L+KSN ILE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRVV QQ GER+FHSFYQLL GA  ++L E  L+ DP  Y Y  QG++ KV SIND+  Y+ V +A+ A GF+  +++T+W +V A++HLG V++               TE  ++   +   +  +A+L  +    L KAL  R VAA G+V+ KGHT   A YARDAFAKA+YD +F+WI  +INE I++      + D+  H + +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+LVLKQEQ+EYMREGI+W ++EYFNN+ IC +VE P  GI AILD+ C+  G+VTD MFL  +D  L     Y SR+L P +KT+EH+RDFR+ HYAG V Y+V GF++KNKD  F+DFKRLLY S N  +KSMW +GAK V+E  +RP++ G NFK SI  LVENLA K PHYVRCIKPN  KSP   +   V+HQ  YLGL+ENVRVRRAGFA RM Y +FL+R+K +S  TWP++     K+G   I+++ G  +DVQ+G TKIFI+S Q++F LE+AR   +  +VV LQK WRG  AR  AKR+RA  KI+  +R YK+R+YI+K V  F +++S  DYGK + WP    P P + GL ++L++   RWRA  +L   P+A+ P  RLK+   ++L +  R ++   R W G+YL ++SDN +N+L YV+   K++   G  KVLFS    K+N+  KT  RAI++TD YI++L Q K +K       +  +  ++++ G DQ+ I+H L+  +DLV   ++   E+R+ ELV  +    + +  + L V +++N L C L  + ++  ++ +NG
Sbjct:    7 HEGPEFGIGDFVLLEEVSLNKFMENLHLRFEKGRFYTYIGEVVVSVNPYRPLNIYGQDYVEQYQGREIYERPPHIFAIADAAYKVMKRKSRDTCIVISGESGAGKTEASKIIMRYIAAITGVSGQKEVNRVKDVLIKSNAILEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVVYQQKGERNFHSFYQLLSGAAEEKLAELKLKRDPTLYHYTRQGDSHKVSSINDRNDYRSVQDAMKATGFSYKDAETLWKIVGAVIHLGEVKYH--------------TEDDQVVVENPDQLTTIAKLLAIDRDMLEKALCFRVVAAAGEVMEKGHTAAEAVYARDAFAKAMYDHMFTWIVGRINEAIEV------KRDVVQHGRNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELVLKQEQDEYMREGIEWQHVEYFNNEVICHLVEKPHKGIMAILDEACLNVGKVTDVMFLHAMDQKLSDHKHYTSRRLEPADKTLEHDRDFRVKHYAGDVMYSVIGFIDKNKDMLFQDFKRLLYGSENAMIKSMWPEGAKGVTEVNKRPITAGTNFKNSIIALVENLASKEPHYVRCIKPNEEKSPVLFNETRVRHQVLYLGLLENVRVRRAGFAYRMSYVKFLERYKCISSSTWPTFRRGAEKQGVDIILNERGFGQDVQYGKTKIFIKSPQTVFALEEARAARIPSLVVFLQKYWRGGTARLRAKRMRAIYKIMARFRRYKLRNYILKLVNTFRNVRSMKDYGKSIKWPD---PPPVLKGLVSQLQKTHQRWRAYMILKPIPEAERPTYRLKIAAAEVLGR--RKEWGFQRKWLGNYLAESSDN-SNTLPYVDQLTKLKHADGFSKVLFSMHVKKVNRHNKTADRAIVVTDKYIYKLDQKKKYKPMRHGTPITDVTGLSITPGPDQLCIIH-LQGGNDLVVYLVSPKSEERVGELVGVVNRQWQKSQNRNLRV-IIDNTLQCMLGDKPRQITVQESNG 987          
BLAST of unconventional myosin-Id vs. TrEMBL
Match: V4ATI0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_143556 PE=3 SV=1)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 524/988 (53.04%), Postives = 693/988 (70.14%), Query Frame = 3
Query:   63 MAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD---RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLT-FGEDRIPELVAKLFLHCKDAFKKELTVDV 3014
            MA  HEGPEFGI DF+L+ ++ L  F++NL+ RF K +IYTYIGEV+V+VNPY+ ++IY+   V +Y+GRE+YE PPHIFA+AD+A+K +KR ++DTCIVISGESG+GKTEASKII+RYIA VTNISGQ E+ERVK++L+KSN ILE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRVV QQ GER+FHSFYQLL G    +L +  L  D  KY +I+QG +S+VP+INDK  ++ V +A+   GF+     ++W +VAA++HLG ++FE +    +   I           S+  ++  +A LF V    L KAL  R +AA G V+ KG     A YARDAFAKA YDR+FSWI  +INE I     D + + L    K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+LVLKQEQEEYM+EGI+W +++YFNN+ ICD+VEL   GI AILD+ C+  G+VTD MFL+ + + L K   +  R L   +KT++H+RDFRI HYAG V+Y+V GF++KNKD  F+DFKRLLYNS +  +KSMW +G +SV+ETT+RP++ G NFK SI  LVENLA K PHYVRCIKPN +KSP   D E V HQ RYLGLIENVRVRRAGFA RM Y RFL+R+K + KKTWP+++    +G+  II + G S+DV++G +KIFIRS Q++F LE+AR   +  IV  LQK WRG L R  A+++RA  KI+  YR YK+RSYI+K V+ F ++++   YGK ++WP  R P    GL A L +V  RWRAN +L   P ++ P +RLK+   D+L  K RS + + R W G+YL    DN   +  +V+    ++G     K+LFS F  K+NK  K   R IIIT+  I++L   K FK  +    + +I  ++++  +DQ++++H L   +DLV   ++  GE+R+ ELV  L  H     KK+L V++
Sbjct:    1 MAGIHEGPEFGIGDFVLLRDVTLDGFMENLKLRFQKGKIYTYIGEVVVSVNPYRPIDIYNTSYVEQYRGREIYERPPHIFALADSAYKNMKRNSKDTCIVISGESGAGKTEASKIIMRYIAAVTNISGQKEVERVKDILIKSNVILETFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVVYQQEGERTFHSFYQLLSGGSEKQLSDLKLSRDCSKYYFISQGGSSQVPTINDKREFKAVNDAMKGAGFSAEHISSLWKIVAAVIHLGDIKFEADPDQHEQVLI-----------SNQNNLNDIARLFSVDVDALQKALCFRTIAAGGQVVEKGLKQTEAHYARDAFAKATYDRMFSWIVGRINELI-----DPKISGLKYVGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELVLKQEQEEYMKEGIEWQHVDYFNNKVICDLVELQHKGILAILDEACLNVGKVTDVMFLQAMATKLNKHDRFTCRSLNAADKTLQHDRDFRIRHYAGDVSYSVIGFIDKNKDTLFQDFKRLLYNSKDELIKSMWPEGKQSVTETTRRPVTAGTNFKNSIIALVENLASKEPHYVRCIKPNELKSPSVFDDERVGHQVRYLGLIENVRVRRAGFAFRMHYDRFLRRYKCICKKTWPTFHGTDYDGTICIIKEKGFSDDVKYGRSKIFIRSPQTLFALEEARDSVIPSIVAYLQKNWRGGLGRMKARKVRAIYKIMARYRKYKMRSYILKCVSIFKNVRTMPGYGKNITWP--RPPNVLEGLVALLLKVHRRWRANMILRNVPMSERPVLRLKVTAGDVLKGK-RSDWGVKRKWEGNYLASTKDNSATA-DFVSQAATLKGQDGYSKILFSSFVKKVNKHNKMADRGIIITNKSIYKLDSKKRFKPMTKGTPISEITGLSITPESDQLVVIH-LSGGNDLVICLISQSGEERVGELVGILCSHWHKTMKKDLKVNI 967          
BLAST of unconventional myosin-Id vs. TrEMBL
Match: A0A131XP45 (Putative myosin class ii heavy chain OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 1014.6 bits (2622), Expect = 0.000e+0
Identity = 510/999 (51.05%), Postives = 692/999 (69.27%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKD--SRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEA--ELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD---RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG---EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKK 3050
            + GI DF+L++NI   +F+DNL+ R+   R+YTYIGEV V+VNPY+ LNIY   +V +YKGRE++E PPH+FAIADAA+K +KR+ +DTCIVISGESGSGKTEASKII+RYIA +TN++GQ EIERVKN+LL+SNCILE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV+ QQ GER+FH+FY+LLYGAP  +L  +GL+++P  Y Y  QG + KV +IND+A +++V  A+  +GFT  E  ++W +VAAI+HLG V F + E  ++                   S+K +++L  VSE  L +AL  R +AA G+V+ KGHT+  A Y RDAFAKAIY+R+FSWI  ++N+ I++       R+N        +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+LVLKQEQEEY+REGI+W ++ YFNN+ ICD+VE P  GI A+ D+ C+  G+VTD+M LE LD  L     Y SR+L PT+K++EH++ FR+ HYAG+VTY++ GFL+KNKD  F+DFKRLLYNS++  +KSMW +GA++V++ T+RP++ G  FK S+  LV+NLA K P YVRCIKPN  KSP   D E V+HQ  YLGL+ENVRVRRAGFA R +Y RFL+R+KM+++ TWP++     ++G + IID MG S+DV++G TKIFIRS Q++ +LE  R   +  IVV LQK WRG +AR   ++ RAA  I+  YR Y  R YI      F ++    DYGK ++WP    P PC   EA   LK +F+RWR + +L   P+ +WP++ LK+   D+L  + R  +   R W G+YL   ++N    L Y+ +   ++     RKV+FS F  K+N+  ++  RA+++TD  I ++   K FK   SPV +  +  I+V+ G DQ+ ILH L   +DLV   +T      +R+ ELV  +    + + K++L V +V + L C L  K
Sbjct:    6 DVGIGDFVLLENITTDAFLDNLKVRYNAGRVYTYIGEVCVSVNPYRTLNIYGPDQVADYKGREIFERPPHVFAIADAAYKEMKRKARDTCIVISGESGSGKTEASKIIMRYIAAITNVTGQQEIERVKNILLQSNCILEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPLGGHINNYLLEKSRVIYQQPGERNFHAFYELLYGAPDAQLSSYGLKHEPQLYFYTRQGGSPKVETINDRADFKQVCSALKLLGFTQAECDSLWKIVAAIVHLGEVSFVVEEDQAKTKG----------------SLKQLSQLLSVSEKELNQALCHRVIAAGGEVMQKGHTVTEAVYGRDAFAKAIYERMFSWIVGRVNKAIEVHTNGILGRKN--------TVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELVLKQEQEEYLREGIQWQDVPYFNNKIICDLVEEPHRGIIALSDEACLNVGKVTDEMLLETLDKKLANHKHYTSRRLSPTDKSLEHQKHFRVLHYAGEVTYSITGFLDKNKDTLFQDFKRLLYNSSDPLIKSMWPEGARNVNQVTKRPLTAGTLFKNSMVALVQNLASKEPFYVRCIKPNEHKSPILFDEERVRHQVNYLGLLENVRVRRAGFAYRQDYTRFLRRYKMITEYTWPNYRGGSDRDGCEVIIDKMGFSDDVKYGRTKIFIRSPQTLSRLENERLAIIPRIVVFLQKMWRGAIARMHYRKTRAAITILAHYRKYAARKYITDLKTAFRNVHQTKDYGKNIAWP----PPPCCVREAVPGLKAIFSRWRGSMILRKVPREQWPQLHLKVTAADVLASR-RRDWGQSRKWHGNYLSLTAENDA-CLPYITSVTGLKSKDNFRKVVFSSFVKKVNRHNQSSDRALVVTDTCIFKM-DIKKFKPLRSPVPISDLTGISVTPGPDQLAILH-LRGNNDLVVCLVTSNTADSNRVGELVGAVVRQWQRSQKRDLRV-MVASQLQCMLGNK 971          
BLAST of unconventional myosin-Id vs. TrEMBL
Match: A0A224Z3N2 (Myosin I OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 1013.83 bits (2620), Expect = 0.000e+0
Identity = 509/999 (50.95%), Postives = 692/999 (69.27%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKD--SRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNL-KEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEA--ELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD---RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG---EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKK 3050
            + GI DF+L++NI   +F+DNL+ R+   R+YTYIGEV V+VNPY+ LNIY   +V +YKGRE++E PPH+FAIADAA+K +KR+++DTCIVISGESGSGKTEASKII+RYIA +TN++GQ EIERVKN+LL+SNCILE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV+ QQ GER+FH+FY+LLYGAP  +L  +GL+++P  Y Y  QG + KV +IND+A +++V  A+  +GF   E  ++W +VAAI+HLG V F + E  ++                   S+K +++L  VSE  L +AL  R +AA G+V+ KGHT+  A Y RDAFAKAIY+R+FSWI  ++N+ I++       R+N        +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+LVLKQEQEEY+REGI+W ++ YFNN+ ICD+VE P  GI A+ D+ C+  G+VTD+M LE LD  L     Y SR+L PT+K++EH++ FRI HYAG+VTY++ GFL+KNKD  F+DFKRLLYNS++  +KSMW +GA++V++ T+RP++ G  FK S+  LV+NLA K P YVRCIKPN  KSP   D + V+HQ  YLGL+ENVRVRRAGFA R +Y RFL+R+KM+++ TWP++     ++G + IID MG S+DV++G TKIFIRS Q++ +LE  R   +  IVV LQK WRG +AR   ++ RAA  I+  YR Y  R YI    A F ++    DYGK ++WP    P PC   EA   LK +F+RWR + +L   P+ +WP++ LK+   D+L  + R  +   R W G+YL   ++N    L Y+ +   ++     RKV+FS F  K+N+  ++  RA+++TD  I ++   K FK   SPV +  +  I+++ G DQ+ ILH L   +DLV   +T      +R+ ELV  +    + + K++L V +V   L C L  K
Sbjct:    6 DVGIGDFVLLENITTDAFLDNLKVRYNAGRVYTYIGEVCVSVNPYRTLNIYGPDQVADYKGREIFERPPHVFAIADAAYKEMKRKSRDTCIVISGESGSGKTEASKIIMRYIAAITNVTGQQEIERVKNILLQSNCILEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPLGGHINNYLLEKSRVIYQQPGERNFHAFYELLYGAPDSQLSSYGLKHEPQLYFYTRQGGSPKVETINDRADFKQVCSALKLLGFAPAECDSLWKVVAAIVHLGEVSFVVEEDQAKTKG----------------SLKQLSQLLSVSEKDLNQALCHRVIAAGGEVMQKGHTLTEAVYGRDAFAKAIYERMFSWIVGRVNKAIEVHTNGVLGRKN--------TVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELVLKQEQEEYLREGIQWQDVPYFNNKIICDLVEEPHRGIIALADEACLNVGKVTDEMLLESLDKKLANHKHYTSRRLSPTDKSLEHQKHFRILHYAGEVTYSITGFLDKNKDTLFQDFKRLLYNSSDPLIKSMWPEGARNVNQVTKRPLTAGTMFKNSMVALVQNLASKEPFYVRCIKPNEHKSPILFDEQRVRHQVNYLGLLENVRVRRAGFAYRQDYTRFLRRYKMITEYTWPNYRGGSDRDGCEVIIDKMGFSDDVKYGRTKIFIRSPQTLSRLETERLAIIPRIVVFLQKMWRGAIARMHYRKTRAAITILAHYRKYAARKYITDLKAAFRNVHQTKDYGKNVAWP----PPPCCVREAVPGLKSIFSRWRGSMILRKVPREQWPQLHLKVTAADVLAGR-RRDWGQSRKWHGNYLSLTAENDA-CLPYITSVTGLKSKDSFRKVVFSSFVKKVNRHNQSSDRALVVTDSCIFKMDD-KKFKALRSPVPISDLTGISITPGPDQLAILH-LRGNNDLVVCLVTSNTADSNRVGELVGAVVRQWQRSQKRDLRV-MVGTQLQCMLGNK 971          
BLAST of unconventional myosin-Id vs. TrEMBL
Match: A0A2C9KFS6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106057773 PE=3 SV=1)

HSP 1 Score: 1013.45 bits (2619), Expect = 0.000e+0
Identity = 523/1000 (52.30%), Postives = 698/1000 (69.80%), Query Frame = 3
Query:   63 MAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD---RKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFG-EDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKK 3050
            MA  HEGPEFGI DF+L+  + L +F++NL+ RF K++IYTYIGEV+V+VNPYK+L+IY++  V EYK RE+YE PPHIFA+AD AHK +KRQ++DTCIVISGESGSGKTEASKII+RYIA VTNISGQ E+ERVK++L+KSN ILE FGNAKTNRNDNSSRFGKYMDI+FDFKGDPVGG +NNYLLEKSRV+ Q  GER+FHSFYQLL GA    L E+ L  DP KY +INQG + KV SINDK  ++ V++A+ A GFT  E  T W +VAAILHLG ++F   + ++             I +   PSI  +A L  V++  L K L  R +AA G V+ K   ++ A YA  AF+KA+YDRLF+WI  +IN+ I     D ++  +   N  +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+LVLKQEQEEYM+EGI+W +++YFNN+ ICD+VE+P  GI AILD+ C+  G++TD+ +LE +   L K   +  R+L P +KT+EH RDFRI HYAG VTY+V GF++KNKD  F DFKRLL+NS+N  +KSMW +GA+SV+ET++RP++ G  FK S+ +LV+NLA KIP+YVRCIKPN +KSP   D    +HQ  YLGL+ENVRVRRAGFA RM Y RFL+R+KM+  KTWP++   + +G +A+ID  G S DV++G +KIFIRS Q++F LE+ART  +  +V+ LQK  RG LAR+  KR+RA   I++ Y+ YK+RSY +  +  F + K   DYG  + WP  + P         LK+   RWRA  +L   P A  P +RLK++  D+L+ K R+ + + R+W G+YL  + DN +N+  +V+A + ++     + +LFS +  K NK  KT  R ++ITD +I+++   K FK      LL +I  ++++ G DQ+II+H +   +D V        E+R+ ELV  L  H     K +L V++ ++ LNC L  K
Sbjct:    1 MAGIHEGPEFGIGDFVLLRELSLDAFMENLKLRFEKSKIYTYIGEVVVSVNPYKQLDIYNSSYVQEYKDREIYERPPHIFALADNAHKTMKRQSRDTCIVISGESGSGKTEASKIIMRYIAAVTNISGQKEVERVKDVLIKSNNILEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPVGGHINNYLLEKSRVIYQHKGERNFHSFYQLLSGAQDAMLSEYKLTRDPQKYHFINQGGDPKVGSINDKQDFRGVMDALKATGFTPDEVSTTWKIVAAILHLGNIEFVGEDDAT-------------INNQEEPSI--IASLLGVTKDNLVKTLLSRVIAAGGQVVDKLLNVQEAQYANKAFSKALYDRLFTWIVGRINDAI-----DPKKGGIVGKN--TVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELVLKQEQEEYMKEGIEWQHVDYFNNKIICDLVEIPHNGILAILDEACLNVGKITDETYLEAMAKKLSKHDRFTCRQLEPADKTLEHHRDFRIKHYAGDVTYSVIGFIDKNKDTLFMDFKRLLFNSSNGVLKSMWPEGAQSVNETSKRPITAGTAFKNSMIELVQNLASKIPYYVRCIKPNEVKSPLLFDDTRTRHQVMYLGLLENVRVRRAGFAFRMAYDRFLKRYKMICTKTWPNYKGQVVDGVRALIDSQGYSSDVKYGKSKIFIRSPQTLFALEKARTAKIPSVVLFLQKHTRGALARKRVKRLRAVYLIMHHYKRYKLRSYALACLEKFKNAKKMKDYGLSVQWP--KPPNTLRATVEMLKKAHLRWRAFMILSRIPVADRPMMRLKVMAGDVLVGK-RADWGVKRNWEGNYLASSKDN-SNTADFVSAINTLKSKDQFKTILFSSYVKKTNKFNKTAERGLVITDKFIYKVDAKKKFKPMGHGQLLTQITGVSLTPGKDQLIIIH-MSGGNDFVVCLENPAHEERVGELVGILVSHMHKILKSDLKVNISKS-LNCMLGHK 972          
BLAST of unconventional myosin-Id vs. Ensembl Cavefish
Match: MYO1D (myosin ID [Source:HGNC Symbol;Acc:HGNC:7598])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 500/992 (50.40%), Postives = 666/992 (67.14%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQF----------------CINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVL-GIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAY-VNARDKIRGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF--NFLTFGEDRIPELVAKLFLHCK 2981
            HE  EFG  DF+L+DN+ L+ F+ NL+ RF K RIY+YIGEV+V+VNPY+ +NIY    V +YKGRELYE PPH+FAIADAA+K +KR+N+DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEKSRV+ QQ GERSFHSFYQL+ GAP   L+   +Q DP  Y YI  G   K  SIND A ++ V +A+  IGFT  E  T++ ++A ILHLG ++F             G+   V + ++S   +  + EL    E  + KAL  R VA   DVI K HT + A+Y RDA AKAIY+RLF WI  +IN+ I++ + D+R      H K +VIGVLDIYGFEIF+NN F                   CINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GIF++LD+ C+  G+VTD+MFL+ L+  L K + Y SRKL PT+K++E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRLLYNS+N  +K+MW +G  S++E T+RP++    FK S+  LVENLA K P+YVRCIKPN +KSP   + E  +HQ  YLGL+EN+RVRRAGFA R  Y RFLQR+KM+S+ TWP+ +  + +E  K ++   G   DV +G TK+FIR+ ++IF LE+ R   V  IV+ LQK WRG +AR   +R+RAA  I+ AYR YK++SYI +    F +++S  D+GK + WP    PK     E  L+ ++NRW A  ++ G+ P+ +  +IR K V T   L+  R+   + R W G+YL    D+P  + ++ + + D  R D+  +VLFS    K+N+  K E RA++ITD +++++   K +K   S + L  +  ++VS G DQ+++ H  +S+  +V     +  GE RI ELV  L  H K
Sbjct:    4 HESLEFGKADFVLLDNVSLEEFLANLKLRFEKGRIYSYIGEVVVSVNPYRAMNIYGRDTVEQYKGRELYERPPHLFAIADAAYKAMKRRNKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIFQQEGERSFHSFYQLVKGAPESLLRSLHIQKDPTAYNYIKVGGMIK-SSINDNAEFKAVADAMKVIGFTTEEVHTVYRILATILHLGNLKF-------------GSDGDVTLIENS-KLVAVLGELLSTKEENVEKALLYRTVATGRDVIDKQHTDKEASYGRDALAKAIYERLFCWIVGRINDIIEVKNYDAR-----VHGKNTVIGVLDIYGFEIFQNNRFSSITFYLYLFFFCFSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIFSVLDEACMNVGKVTDEMFLQALNGKLAKHAHYTSRKLSPTDKSLEFDRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLLYNSSNPVLKAMWPEGKLSITEVTKRPLTAATLFKNSMISLVENLASKEPYYVRCIKPNDVKSPLLFEYERCKHQVEYLGLLENLRVRRAGFANRQTYPRFLQRYKMISEFTWPNHDLPSDREAVKRLLQGCGFEHDVAYGKTKVFIRTPRTIFSLEEQRAEMVQRIVLFLQKVWRGTIARMRYRRMRAALIILRAYRRYKVKSYIKEVNRRFKNVRSMKDHGKHVKWPT--PPKVLRRFEEALRNIYNRWWAWTLIKGLSPE-EMLQIRAK-VATLECLKGQRADLGLQRAWEGNYLVSKRDSPETASSFTLVSSDLQRKDKFMRVLFSCNVRKINRFNKAENRAVLITDRHLYKMDPLKQYKPMKS-IPLYNVTGVSVSPGKDQLVVFHTKDSRDLIVCLQGMVPAGESRIGELVGTLLSHFK 970          
BLAST of unconventional myosin-Id vs. Ensembl Cavefish
Match: MYO1D (myosin ID [Source:HGNC Symbol;Acc:HGNC:7598])

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 496/1004 (49.40%), Postives = 671/1004 (66.83%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVL-GIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF--NFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            HE  EFG  DF+L+DN+ L+ F+ NL+ RF K RIY+YIGEV+V+VNPY+ +NIY    V +YKGRELYE PPH+FAIADAA+K +KR+N+DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEK                  L+ GAP   L+   +Q DP  Y YI  G   K  SIND A ++ V +A+  IGFT  E  T++ ++A ILHLG ++F             G+   V + ++S   +  + EL    E  + KAL  R VA   DVI K HT + A+Y RDA AKAIY+RLF WI  +IN+ I++ + D+R      H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GIF++LD+ C+  G+VTD+MFL+ L+  L K + Y SRKL PT+K++E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRLLYNS+N  +K+MW +G  S++E T+RP++    FK S+  LVENLA K P+YVRCIKPN +KSP   + E  +HQ  YLGL+EN+RVRRAGFA R  Y RFLQR+KM+S+ TWP+ +  + +E  K ++   G   DV +G TK+FIR+ ++IF LE+ R   V  IV+ LQK WRG +AR   +R+RAA  I+ AYR YK++SYI +    F +++S  D+GK + WP    PK     E  L+ ++NRW A  ++ G+ P+ +  +IR K V T   L+  R+   + R W G+YL + S    +S   V++ D  R D+  +VLFS    K+N+  K E RA++ITD +++++   K +K   S + L  +  ++VS G DQ+++ H  +S+  +V     +  GE RI ELV  L  H K   +++L V++V + ++C +  +KC + +
Sbjct:    4 HESLEFGKADFVLLDNVSLEEFLANLKLRFEKGRIYSYIGEVVVSVNPYRAMNIYGRDTVEQYKGRELYERPPHLFAIADAAYKAMKRRNKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEK------------------LVKGAPESLLRSLHIQKDPTAYNYIKVGGMIK-SSINDNAEFKAVADAMKVIGFTTEEVHTVYRILATILHLGNLKF-------------GSDGDVTLIENS-KLVAVLGELLSTKEENVEKALLYRTVATGRDVIDKQHTDKEASYGRDALAKAIYERLFCWIVGRINDIIEVKNYDAR-----VHGKNTVIGVLDIYGFEIFQNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIFSVLDEACMNVGKVTDEMFLQALNGKLAKHAHYTSRKLSPTDKSLEFDRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLLYNSSNPVLKAMWPEGKLSITEVTKRPLTAATLFKNSMISLVENLASKEPYYVRCIKPNDVKSPLLFEYERCKHQVEYLGLLENLRVRRAGFANRQTYPRFLQRYKMISEFTWPNHDLPSDREAVKRLLQGCGFEHDVAYGKTKVFIRTPRTIFSLEEQRAEMVQRIVLFLQKVWRGTIARMRYRRMRAALIILRAYRRYKVKSYIKEVNRRFKNVRSMKDHGKHVKWPT--PPKVLRRFEEALRNIYNRWWAWTLIKGLSPE-EMLQIRAK-VATLECLKGQRADLGLQRAWEGNYLKRDSPETASSFTLVSS-DLQRKDKFMRVLFSCNVRKINRFNKAENRAVLITDRHLYKMDPLKQYKPMKS-IPLYNVTGVSVSPGKDQLVVFHTKDSRDLIVCLQGMVPAGESRIGELVGTLLSHFKSE-RRKLQVNIV-SPIHCSMNGRKCTVVV 961          
BLAST of unconventional myosin-Id vs. Ensembl Cavefish
Match: MYO1D (myosin ID [Source:HGNC Symbol;Acc:HGNC:7598])

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 490/975 (50.26%), Postives = 653/975 (66.97%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVL-GIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF--NFLTFGEDRIPELVAKLFLHCK 2981
            HE  EFG  DF+L+DN+ L+ F+ NL+ RF K RIY+YIGEV+V+VNPY+ +NIY    V +YKGRELYE PPH+FAIADAA+K +KR+N+DTCIVISGESG+GKTEASK I++YIA +TN S + E+ERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG +NNYLLEK                  L+ GAP   L+   +Q DP  Y YI  G   K  SIND A ++ V +A+  IGFT  E  T++ ++A ILHLG ++F             G+   V + ++S   +  + EL    E  + KAL  R VA   DVI K HT + A+Y RDA AKAIY+RLF WI  +IN+ I++ + D+R      H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GIF++LD+ C+  G+VTD+MFL+ L+  L K + Y SRKL PT+K++E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRLLYNS+N  +K+MW +G  S++E T+RP++    FK S+  LVENLA K P+YVRCIKPN +KSP   + E  +HQ  YLGL+EN+RVRRAGFA R  Y RFLQR+KM+S+ TWP+ +  + +E  K ++   G   DV +G TK+FIR+ ++IF LE+ R   V  IV+ LQK WRG +AR   +R+RAA  I+ AYR YK++SYI +    F +++S  D+GK + WP    PK     E  L+ ++NRW A  ++ G+ P+ +  +IR K V T   L+  R+   + R W G+YL + S    +S   V++ D  R D+  +VLFS    K+N+  K E RA++ITD +++++   K +K   S + L  +  ++VS G DQ+++ H  +S+  +V     +  GE RI ELV  L  H K
Sbjct:    4 HESLEFGKADFVLLDNVSLEEFLANLKLRFEKGRIYSYIGEVVVSVNPYRAMNIYGRDTVEQYKGRELYERPPHLFAIADAAYKAMKRRNKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEK------------------LVKGAPESLLRSLHIQKDPTAYNYIKVGGMIK-SSINDNAEFKAVADAMKVIGFTTEEVHTVYRILATILHLGNLKF-------------GSDGDVTLIENS-KLVAVLGELLSTKEENVEKALLYRTVATGRDVIDKQHTDKEASYGRDALAKAIYERLFCWIVGRINDIIEVKNYDAR-----VHGKNTVIGVLDIYGFEIFQNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIFSVLDEACMNVGKVTDEMFLQALNGKLAKHAHYTSRKLSPTDKSLEFDRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLLYNSSNPVLKAMWPEGKLSITEVTKRPLTAATLFKNSMISLVENLASKEPYYVRCIKPNDVKSPLLFEYERCKHQVEYLGLLENLRVRRAGFANRQTYPRFLQRYKMISEFTWPNHDLPSDREAVKRLLQGCGFEHDVAYGKTKVFIRTPRTIFSLEEQRAEMVQRIVLFLQKVWRGTIARMRYRRMRAALIILRAYRRYKVKSYIKEVNRRFKNVRSMKDHGKHVKWPT--PPKVLRRFEEALRNIYNRWWAWTLIKGLSPE-EMLQIRAK-VATLECLKGQRADLGLQRAWEGNYLKRDSPETASSFTLVSS-DLQRKDKFMRVLFSCNVRKINRFNKAENRAVLITDRHLYKMDPLKQYKPMKS-IPLYNVTGVSVSPGKDQLVVFHTKDSRDLIVCLQGMVPAGESRIGELVGTLLSHFK 934          
BLAST of unconventional myosin-Id vs. Ensembl Cavefish
Match: myo1g (myosin IG [Source:ZFIN;Acc:ZDB-GENE-060503-562])

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 465/979 (47.50%), Postives = 633/979 (64.66%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVK-ITDSSMPSIKHMAELFDVSEAGLTKALSERAVA-ARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGD---RKVLFSGFASKLN---KKGKTEIRAIIITDLYIHELTQCKAFK-KGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF---NFLTFGEDRIPELVAKLFLH 2975
            EG EFG  DF+L+D + ++ F+DNL+ RF K RIYTYIGEV+V+VNPY++++IY    ++ Y+GRELYE+PPH++A+ADAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN S + E+E VKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+F+F GDP GG +NNYLLEKSRVV QQ GER+FHSFYQ    A SD                             D+  ++ V+ A+  IGFT  E  +I+ +++ ILHL +        SS   ++ GA E  + I  S   +++H+AEL       + KAL  R VA   G+VI KGH+ + A+Y RDAFAKA+Y+RLF WI  +IN  I++ D +      + H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+L+LKQEQ EY REGI W +I+YFNNQ I D+VE P  GI +ILDD C+  G+VTD + L+ ++  L + + Y SRKL PT+KT+E  R FRI HYAG VTY+V  FL+KNKD  F+DFKRL++NS +  +  MW DG  S++E T+RP++    FK SI  LV+ LA K P+YVRC+KPN +KSP   D    +HQ  YLGL+ENVRVRRAGFA R  Y RFLQR+KM  + TWP+   S+ +E  +AI+   G   DV +G TK+F+R+ +S+F LEQ R   +  +V+ LQK WRG LAR   +++RA   I+  Y+ YK++++  +    F+++++ SDYGK + WP    P   +      + +  RWRA +++   P +  PE+R K+     L  + R  +   R W  DYL  A D+P  S  +V    ++       +VLFSGF   L        T+ RA++ITD +I++L   K FK +   P+  E + S++V+ G+DQ++ LH       LV+     L   +DR+ ELV  L  H
Sbjct:    5 EGFEFGKSDFVLLDEVTMEQFLDNLKMRFEKGRIYTYIGEVVVSVNPYRQMDIYGKDAIDAYRGRELYENPPHLYAVADAAYKAMKRRAKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRLEVESVKNVLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFNFNGDPTGGHINNYLLEKSRVVQQQEGERNFHSFYQ----ASSD-----------------------------DRCCHKAVMSALKVIGFTEAEINSIYKILSTILHLVSY-------SSSALTVGGALEQERQIFLSEGDAVQHIAELTSTEPESVNKALLYRTVATGGGEVIEKGHSEQEASYGRDAFAKALYERLFGWIVGRINSVIEVKDYNP-----ALHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELILKQEQAEYNREGITWQHIDYFNNQIIVDLVEQPHKGIISILDDACLTAGKVTDTVCLDSMNQKLGQHAHYTSRKLCPTDKTMEFNRHFRIRHYAGDVTYSVESFLDKNKDPLFQDFKRLMFNSLDPVLTEMWPDGKLSITEVTKRPLTAATLFKNSIIALVDKLACKEPYYVRCVKPNEVKSPMLFDEARCRHQVAYLGLLENVRVRRAGFAYRQPYERFLQRYKMTCEYTWPNHLMSSDREAVEAIVVQHGFEGDVAYGLTKLFVRTPRSLFTLEQERAALIPILVLFLQKVWRGALARMRCRQMRAIYTIMGCYKRYKVKAHFWEVERRFANVRNMSDYGKSVEWPT--PPAALMQFHRITQHLHRRWRARQIVKNIPPSDMPEVRAKVAALGALSGE-RVDWGFNRAWERDYLANARDSPLTSTNFVRITKELTNKDQYSQVLFSGFVRMLYCSFLSSSTKDRALLITDKHIYKLEHKKHFKVQKRMPI--ETVTSLSVTSGSDQMVALHTASQDDMLVYLQRGQLGPKQDRVGELVGTLCDH 933          
BLAST of unconventional myosin-Id vs. Ensembl Cavefish
Match: myo1b (myosin IB [Source:NCBI gene;Acc:103043526])

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 338/726 (46.56%), Postives = 486/726 (66.94%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR----KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ +  ++F+ NL KRF  N IYTYIG V++++NPYK L IY+  +V EY+ R  YE  PHI+A+AD A++ ++ Q++D CI+I+GESG+GKTEASK+++ Y+A V    GQ E+ +VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKGDP+GG+++NYLLEKSRVV Q  GER+FH FYQLL GA  D LK+  L  D  KY Y++  +++ V  ++D A ++ V  A+  +GF   E +++  LVAA+L LG ++F+        S + G  ES ++ D +   +K M EL  + ++ L +A S R V A+ + +     +  A YARDA AK +Y R+FSW+  +INE IK   K  ++          V+GVLDIYGFEIFE+NSFEQF INYCNEKLQQ+FI+L L++EQEEY+REGI+WTNIEYFNN  ICD++E  + GI A+LD+ C++PG VTD+ FL+ L++   +   ++SR      F T+ ++ H   FRI HYAG+V Y V GF++KN D  + D  + +Y +N++ +K ++ +G        +RP + G  FK S+  L++NL  K P+Y+RCIKPN  K+       LV HQ RYLGL+ENVRVRRAG+A R  Y   L+R+KML K+TWP W    +EG + ++  + +  E+  +G +KIFIR+ +++F LE+ R   ++ +  ++QK +RG
Sbjct:   16 GVGDMVLLEPLSEETFIGNLRKRFEHNEIYTYIGSVVISMNPYKSLPIYTADKVEEYRNRNFYELSPHIYALADEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCG-KGQ-EVNKVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHIFYQLLSGASDDTLKKLKLDRDFSKYNYLSL-DSATVNGLDDAANFRTVRNAMQIVGFMEDELQSVMELVAAVLKLGNIEFK------PESRVNGFDES-RVKDKN--DLKEMCELLGIEQSVLERAFSYRTVEAKMEKVSTTLNVAQAYYARDALAKNLYSRMFSWLVTRINESIKAQTKSRKK----------VMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLREEQEEYVREGIEWTNIEYFNNAIICDLIENNQNGILAMLDEECLRPGTVTDETFLDKLNTICAEHQHFESRLSKNSKFLTDHSLPHS-CFRIQHYAGKVLYRVEGFVDKNNDLLYRDLSQAMYKANHSLMKLLFPEG-NPAKVNLKRPPTAGFQFKASVGTLMKNLQTKNPNYIRCIKPNDKKASQVFTDSLVCHQVRYLGLMENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPAREGVEVLLKGLEVPEEEFAYGRSKIFIRNPRTLFFLEEKRRQCLEDLATLIQKIYRG 717          

HSP 2 Score: 51.2174 bits (121), Expect = 8.238e-6
Identity = 60/235 (25.53%), Postives = 98/235 (41.70%), Query Frame = 3
Query: 2403 SWPQYRVPKPCI---GLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILL-QKGRSKFNIGRDWRGDYLCQASDNPT----NSLAYVNARDKIRGDRKVLFSGFASKLNK-KGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLF-LHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNG 3077
            +WP     +P +   G   EL+R+F+ WR  K    + + K      KL  + I   +K     ++G+ ++GDYL + + NP     NS+           D KVL +   +K+N+  GK   R  ++T        Q     K S P  L  +NS++VS  +D    L   E              DR+ E++ KL       A ++ + VD+ +  L    + K C+  I  G
Sbjct:  840 TWP----ARPYLFLDGTHQELRRIFHLWRCKKYRSQFTEEKKAIYEEKLEASKIFKDKKALYPSSVGQPFKGDYL-EINKNPKYQKLNSVM----------DEKVLLADVVNKINRANGKGAPRIFLLTKKKFVLADQKTGQVKASVP--LPDLNSVSVSTQSDGFFALKLKEGTPSAAKGDFLLSSDRLIEIITKLHRTGAASAERETIGVDISDEFLVQFKQDKVCVKFIQAG 1057          
BLAST of unconventional myosin-Id vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000990.1 (pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 gene:ENSPMAG00000000865.1 transcript:ENSPMAT00000000990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 331/727 (45.53%), Postives = 462/727 (63.55%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVE---LPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEK--TIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L+D +   SF+ NL +RF  +  YTYIG V+++VNPYK L IYS ++V EY+ R +YE  PH+FAIAD A++ ++  ++D CI+I+GESG+GKTE SK ++ Y+A V      +E+  VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI F+FKGDPVGGI+ NYLLEKSRVV Q  GER+FH FYQLL GA    L    LQ +P  Y Y+ QG  + V  +ND   +  V +A+  IGF++ E  T+W  +A +L LG + F           I       + T      +  +  L  + +  L +AL++R V A  + +     M    YARDA  K +Y+RLFSW+ ++INE IK+  K  +           V+GVLDIYGFEIFE NSFEQF IN+CNEKLQQ+FI+L LK+EQEEY+REG+KW  IEYFNN  ICD++E      LG   +LDD C++PG VTD  FL+ L+    K   ++      + +  T  H R FR+ HYA +VTY+V+GF++KN D  F D  + ++ S    V+ ++ +G  S  ++ +RP++  +  KTS+  L+++L  K P+Y+RC+KPN  KS      ELV +Q RYLGL+ENVRVRRAG+  R  YA  L R+KML  +TWP WN + KEG K+I+ D+ +  E+  +G TK+FI+S  ++F+LE+ RT  +  +  ++QK +RG
Sbjct:   15 GLADMVLLDPLTEDSFLKNLRERFKHDEFYTYIGNVVLSVNPYKPLTIYSAEKVEEYRNRNIYELSPHVFAIADEAYRSLRDADKDQCILITGESGAGKTEVSKYVMSYVAAVCGKG--EEVNMVKEQLLQSNPVLEAFGNAKTIRNDNSSRFGKYMDIEFNFKGDPVGGIIRNYLLEKSRVVYQLQGERNFHIFYQLLAGASPSLLASLKLQQNPSVYTYLMQGKTAHVEGLNDSQSFHTVQKAMQVIGFSDEEIATVWEALAVVLKLGNIVF---------VDIPRTNGLDECTFKESKELDEVCALLGLDDELLERALTKRTVEANKEKVSTTLNMAQGKYARDALCKNLYNRLFSWLVSRINESIKVKSKIKK----------KVMGVLDIYGFEIFEVNSFEQFIINFCNEKLQQIFIELTLKEEQEEYIREGVKWIQIEYFNNAIICDLIENNVFVYLG--PMLDDECMRPGNVTDSTFLDKLNDKCGKHEHFEKHNSASSARSTTKRHYRCFRVQHYAVKVTYSVDGFVDKNNDLLFRDISQTMWQSQRKLVRDLFPEGNPS-KQSLKRPLTASSQLKTSVNALMKDLLIKNPNYIRCLKPNDRKSSSLFQDELVLNQVRYLGLMENVRVRRAGYVFRQLYALCLHRYKMLGSQTWPHWNGDAKEGVKSILVDLKLPQEEYAFGVTKVFIKSPTTLFQLERKRTERMHELATLIQKTYRG 717          
BLAST of unconventional myosin-Id vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001434.1 (pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 gene:ENSPMAG00000001264.1 transcript:ENSPMAT00000001434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 546.199 bits (1406), Expect = 4.197e-176
Identity = 289/732 (39.48%), Postives = 440/732 (60.11%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFEL--NESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAV----AARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVE--LPRLGIFAILDDNCI---KPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISED-VQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            G+ D +L+  I   + VDNL+KR++ + I+TYIG VL++VNP+K++  +++KE+  Y+G   YE+PPHI+A+AD  ++ +    ++ C++ISGESG+GKT A+K I+ Y+++V+   G  +++ VK+++L SN +LE FGNAKT RN+NSSRFGKY +I F   G+P GG ++N+LLEKSRVV Q   ER+FH +YQL   A  D+ +  G+   PD Y Y+NQ    KV  I+D+  +QE ++A+  IG      + +  +VA ILHLG + F    N ++ +N                   +   A L  + +A L + L+ R +      + + I     +E A Y RDA AKA+Y R+F ++   IN  I+             H +++V GVLDIYGFEIF+ N FEQFCIN+ NEKLQQ+FI+L LK EQEEY++EGIKWT I+YFNN+ +CD++E  +   GI ++LDD C      G   D   L+ L + +     + S             + F + HYAG+V+Y+V GF E+N+D  F D   L+ +S ++ +++++ +  +  SE   RP +V +  K     LV  L K  PHY+RCIKPN  K P   +   V+HQ  YLGL EN+RVRRAG+A R  + +FLQR+ +L+++TWP W+   ++G + ++  + +  D  Q G TK+F+++ +S+F LE+ R    D     +QK WR
Sbjct:   18 GVDDMVLLPKISEDAIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFTDKEIELYQGAAQYENPPHIYALADNMYRNMLIDQENQCVIISGESGAGKTVAAKYIMSYVSKVS--GGGSKVQHVKDIILLSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNPQERNFHIYYQLTEAAVGDQKESLGITT-PDYYYYLNQSGAYKVDDIDDRKDFQETMKAMRVIGIPAEHQQMVLQIVAGILHLGNLSFREAGNYAAVENDDF----------------LAFPAFLLGIEQARLKEKLTSRQMDSKWGGKSETIEVTLNVEQANYTRDALAKALYARVFDYLVEAINRAIQ-----------KDHEEYNV-GVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIENKVNPPGIMSVLDDVCATMHAKGEGADATLLQKLRAQIGSHEHFNS-----------WNQGFIVHHYAGKVSYDVEGFCERNRDVLFTDLIELMQSSEHSFIQALFPENIQ--SEKKGRPTTVASKIKKQANDLVNTLMKCTPHYIRCIKPNETKRPRDWEESRVKHQAEYLGLRENIRVRRAGYAYRRIFKKFLQRYAILTRETWPEWHGEERKGVEYLLRTVNMDPDQYQMGRTKVFVKAPESLFLLEEMRERKYDGYARAIQKAWR 705          
BLAST of unconventional myosin-Id vs. Ensembl Sea Lamprey
Match: myo1f (myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506])

HSP 1 Score: 532.332 bits (1370), Expect = 7.697e-171
Identity = 287/731 (39.26%), Postives = 436/731 (59.64%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVIS-GESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAV----AARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVE--LPRLGIFAILDDNCI---KPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISED-VQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            G+ D +L+  +   + V+NL+KR + + I+TYIG VL++VNP+K++  ++++E++ Y+G   +E+PPHI+A++D  ++ +   +++ C++IS GESG+GKT A+K I+ Y+++V+   G D+++ VK+++L+SN +LE FGNAKT RN+NSSRFGKY +I F   G+P GG ++N+LLEKSRVV Q   ER+FH +YQLL G+   + +  G+ + PD Y Y+NQ     V   +D   +QE + A+  IG    E   +  +VA ILHLG + F            QG   +V+    S+  +   A L  + +  L + L+ R +      + + I      E A Y RDA AKA++ RLF ++  +IN+ I+   K+  E +         IGVLDIYGFEIF+ N FEQFCIN+ NEKLQQ+FI+L LK EQEEY++EGIKWT IEYFNN+ +CD++E  +   G+ +ILDD C      G   D   L+ L + +     + +             R F + HYAG+V+Y+V GF E+N+D  F D   L+ +S      S++ +  +   E   RP +  +  K     LV  L +  PHY+RCIKPN  K P   +   V+HQ  YLGL EN+RVRRAGFA R  + +FLQR+ +L+ +TWP+W  + ++G   I+  + +  D  Q G +K+FI++ +S+F LE+ R    D     +QK WR
Sbjct:   18 GVDDMVLLSKVTEDAIVENLKKRLMDDWIFTYIGPVLISVNPFKQMPYFTDREIDIYQGAAQFENPPHIYALSDFMYRNMLIDSENQCVIISSGESGAGKTVAAKYIMSYVSKVS--GGGDKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGNISNFLLEKSRVVSQNTEERNFHIYYQLLTGSSGTQKENLGI-STPDYYFYLNQTGTYVVDDTDDNKDFQETMAAMQVIGILPDEQAMVLQIVAGILHLGNISF----------MEQGNYAAVE----SLDYLAFPAHLLGIEQDRLMEKLTSRTMDSKWGGKSESITVTLNTEQAAYTRDALAKALHSRLFDFLVQEINKAIR---KEREEYN---------IGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAKGEGADTTLLQKLQAGIGCHEHFNT-----------WNRGFVVHHYAGKVSYDVEGFCERNRDVLFPDLVELMQSSQYPFFYSLFPENLQ--VEKKGRPTTASSKIKKQANDLVNTLMRCTPHYIRCIKPNETKRPRDWEESRVRHQVEYLGLRENIRVRRAGFAYRRVFQKFLQRYAILTAETWPAWRGDERQGITHILRAVNMEADQFQMGRSKVFIKAPESLFLLEEMRDRKFDAFARTIQKAWR 706          
BLAST of unconventional myosin-Id vs. Ensembl Sea Lamprey
Match: myo1hb (myosin IHb [Source:ZFIN;Acc:ZDB-GENE-070705-355])

HSP 1 Score: 419.468 bits (1077), Expect = 5.969e-135
Identity = 233/573 (40.66%), Postives = 342/573 (59.69%), Query Frame = 3
Query:  300 FAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYI---NQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVI--GVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERD-FRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAG 2000
            +A++D  ++ ++ + +D CI+I+GESG+GKTEASK +L +++ +   S    ++ ++N L+ SN ILE FGNA T  NDNSSRFGKYM I FDF G PVGG + N+LLEKSRVV+Q  GER+FH FYQLL G     L   GL  DP +Y Y+    QG  +K+  +ND   ++ + EA +A+GF   + +T+++++A+++HLG  ++               T    ITDS+   I  +++L D+SE  L  AL+++ ++A G+ ++       A +ARDA AKAIY+R FSW+  ++N            N L++H   +V       +YG  +   NSFEQ CINYCNEKLQQLFI   L  EQ EY  EGI+W +I YF+N+ ICD+VE    GI AILD+ C++PG  TD  FLE L+  +     + + KL   +   E +RD F++ HYAG+V YNV GFL+KN+D    + K ++  + N  +K  +    + ++E  + P ++GA FK+S+ KL+E L  K P YVRCIKPN  K    L    +     Y  LI  VR+ ++ 
Sbjct:    1 YALSDHVYRAMRSEYRDQCILITGESGAGKTEASKKVLHFLSNICEAS--PSVDSLRNRLIHSNPILEAFGNALTLCNDNSSRFGKYMHIQFDFTGTPVGGHILNFLLEKSRVVLQHGGERNFHIFYQLLAGGRESLLDRLGLARDPARYRYLLVSQQGEEAKISPLNDVENWRVLQEAFHAVGFDEPQIETLFDVIASVIHLGNTRY-----------TTSPTGYALITDST--EIHVISKLLDISEETLESALTKKTISASGEEVVSPLGPVQAAHARDALAKAIYERAFSWLVGQLN------------NSLATHQHRAVRLNKQWAVYGTVLCTVNSFEQLCINYCNEKLQQLFITHTLGTEQVEYEAEGIEWESILYFDNKIICDLVEQKHKGILAILDEECLRPGEATDLSFLEKLEGKIGGHPHFLTHKLGDHKNRREIKRDEFQLRHYAGEVNYNVKGFLDKNQDLLLRNLKEVMCGAGNMIIKECFC--PQELNE-KKWPGTIGAQFKSSLGKLMEILMSKDPSYVRCIKPNNEKQAVSLSGGELTKTRLYKTLISRVRLTKSA 543          
BLAST of unconventional myosin-Id vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 429.483 bits (1103), Expect = 7.417e-133
Identity = 266/756 (35.19%), Postives = 416/756 (55.03%), Query Frame = 3
Query:   84 PEFG-IPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVT-------NISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMP---SIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEIC-DMVELPR--LGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMW--------LDGAKSVSET-------TQRPM--SVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDV-QWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            P+F  + D   +  ++  S + NL+ R+    IYTY G   V VNPYK L IYS + +  Y+G++ +E PPHI+A+ D A++ + +  +D  I+ +GESG+GKTE +K +++Y+A V        +     E+E+    LL++N ILE FGNAKT +NDNSSRFGK++ I+FD  G  VG  +  YLLEKSR + Q   ER+FH FYQLL GA  + LK   L    + Y +++ G N  +P   DK  +QE   ++N +GFT+ E  ++  +V+++LH G + F+   ++ Q               +SMP   + + +  L  ++    T+A+    +    D + K  T E A +A +A AKA Y+RLF W+  ++N+ +          D +     S IG+LDI GFEIFE NSFEQ CINY NEKLQQLF   +   EQEEY REGI+W  I++  + + C +++E P    GI A+LD+ C  P + TD+ F E L   +Q++  +     F   K ++ + DF + HYAG+V Y  + +L KN D   ++   LL+ S++  V  +W        LD    +++T       T++ M  +VG  +K  + KL+  L    P++VRCI PN  K  G+L+  LV  Q R  G++E +R+ R GF  R+ +  F QR+++L+    P    + K+  + +I  + +  ++ + G +KIF R A  +  LE+ R   +  I++  Q   RG
Sbjct:   88 PKFAKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVVNPYKNLPIYSEEIIEMYRGKKRHEVPPHIYAVTDTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHGAPGELEKQ---LLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLSGA-GEHLKTDLLLEGYNNYRFLSNG-NVVIPGQQDKDNFQETTSSMNIMGFTHEEQISLLRVVSSVLHYGNIVFKKERNTDQ---------------ASMPDNTAAQKLCHLLGIAVTDFTRAILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERLFRWLVQRLNKAL----------DRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFP-KATDKSFCEKL---VQEQGTHPK---FQKPKQLKDKADFSVIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKDVDRIVGLDTVSGMTDTAFGSTYKTRKGMFRTVGQLYKEQLTKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIIFQEFRQRYEILTPNAIPKGFMDGKQACERMIKGLELDPNLYRIGQSKIFFR-AGVLAHLEEERDLKITDIIIAFQATCRG 805          
BLAST of unconventional myosin-Id vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 514.998 bits (1325), Expect = 2.206e-163
Identity = 291/734 (39.65%), Postives = 425/734 (57.90%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAA-----RGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPR-LGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIE-HERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTW----PSWNSNLKEGSKAIIDDMGIS-EDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            E G+ D  L+  I  ++  +NL+KRF+   IYTYIG VL++VNP+++L IY++  +NEYKG+   E PPH+FAIA++ +  +K  N++ C++ISGESG+GKTEA+K I++YIA  ++ +  + I ++K+++L +N +LE FG AKT RN+NSSR GKY++I F+ + +P  G + NYLLEK RVV Q   ER+FH FYQ   GA     + FG+Q  P++Y Y          +I+D   YQE ++A+  IG    E   I+ ++AAIL +G V F  NE             + ++ D+S+     +A L  +    L K+L ER +       RG V      +  A   RDA AKAIY+ LF WI +++N+ ++      +            IG+LDIYGFEIFE+NSFEQ CINY NEKLQQ+FIQL LK EQE Y RE I+WT I+YF+N+ +CD++E  R  GIFA ++D+                DSN   ++F +   LF T    +     F I HYAG VTY+++G  +KNKD   +D   L+  + N  + +++ D      E+ +RP + G     S   LVE L+K  P Y+R IKPN  KSP   D   V HQ +YLGL ENVR+RRAGFA R  + +F++RF +LS         +W  +  +  K I+ D  I  ++ Q G T +FI++ +++F LE  R      +   +Q+ WR
Sbjct:   35 EVGVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASS-THTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQK-PEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEG-----------NAQVRDTSVTDF--VAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKS-----------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVA----------TAHADSNAADQAFAQRLNLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVD--RESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWR 730          
BLAST of unconventional myosin-Id vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 511.916 bits (1317), Expect = 9.575e-162
Identity = 298/737 (40.43%), Postives = 423/737 (57.39%), Query Frame = 3
Query:   87 EFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAA-----RGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKI---SDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPR-LGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIE-HERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTW----PSWNSNLKEGSKAIIDDMGISE-DVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            E GI D  L+  I  +S  +NL+KRF    IYTYIG VL++VNP+++L IY+N  +  YKG+   E PPH+FAIA++ +  +K  N++ C++ISGESG+GKTEA+K I++YIA  +N S  + I ++K+++L +N +LE FG AKT RN+NSSR GKY++I F+ + +P  G + NYLLEK RVV Q   ER+FH FYQ   GA     + FG+Q  P++Y Y      +   +I+D   Y+  +EA+  IG    E   I+ ++AAIL +G + F  NE             + ++ D+S+     +A L  V  + L K L ER +       RG V         AT  RDA AKAIY+ LF WI  ++N  ++    +DK               IG+LDIYGFEIFE+NSFEQ CINY NEKLQQ+FIQL LK EQE Y RE IKWT I+YF+N+ +CD++E     GI A ++D+          +     DSN   ++F +   LF +    E     F I HYAG VTY++NG  +KNKD   +D   L+  + N  + +++ D      ++ +RP + G     S  +LVE L+K  P Y+R IKPN  KSP   D   V HQ +YLGL ENVR+RRAGFA R  + +F++RF +LS         +W+ +  E  K I+ D  I E + Q G T +FI++ +S+F LE  R      +   +Q+ WR
Sbjct:   35 EVGISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASN-SHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQM-PEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEG-----------NAQVGDTSVTDF--VAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKS--------------IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDS----------IATAHADSNAADQAFAQRLNLFNSNPYFELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDDVD--KDSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWR 730          
BLAST of unconventional myosin-Id vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 411.379 bits (1056), Expect = 9.346e-123
Identity = 267/779 (34.27%), Postives = 413/779 (53.02%), Query Frame = 3
Query:   48 LSLLRMAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELN-IYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQV-----TNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI---KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTD---QMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDG----AKSVSE------------------TTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKML-SKKTWPSWNSNLKEGSKAIIDDMGISEDV--------QWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            L LLR     E  E    D   +  ++  + +  +++R+ +  IYTY G VL+A NP+  ++ +Y+   +  Y G+   E  PH+FAIA+ A++++K   Q+  IV+SGESG+GKT ++K I+RY A V       +  Q E+   +  +L +N I+E FGNAKT RNDNSSRFGKY++I FD     +G  +  YLLE+SR+V Q   ER++H FYQL+ G P+   +E  L  D   Y Y+NQG ++K+  I+D   Y+  ++A+  +G T      I+ ++AA+LH+G ++ +     ++N +   A E         P++K   EL  +      K ++++ +  R + I+       A  A+D+ AK IY  LF W+   IN  +    ++D+ S           S IGVLDIYGFE FE NSFEQFCINY NEKLQQ F Q V K EQEEY++E I+W+ IE+ +NQ   D++E  +LGI ++LD+    P    +   Q   + LD +   K F K R  F   K       F + HYA  V Y+V GF+EKN+D   +    +L  S N T+ ++ L+G    AK + E                  T  R  ++G+ FK S+ +L+  +     HY+RCIKPN  K   + D  +V  Q R  G++E +R+  AGF +R  +  F+ R+ +L   + W       +   + II  + +  D         Q G+TKIF ++    + LE+ R+  +   +V++QK+ R 
Sbjct:   60 LPLLRNPPILEATE----DLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHL-TDASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIK----KTRNDASLSADE---------PNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQIS-----------SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIE-NKLGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPR--FGQTK-------FIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINI-LEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAY-LEKLRSNKMHNSIVMIQKKIRA 797          
BLAST of unconventional myosin-Id vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 408.297 bits (1048), Expect = 4.258e-122
Identity = 257/752 (34.18%), Postives = 412/752 (54.79%), Query Frame = 3
Query:  102 DFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELN-IYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQV---TNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDA-------FFED-----FKRLLYN---------SNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKT-WPSWNSNLKEGSKAIID------DMGISEDVQW--GHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            D   +  ++  + +  ++KR++  +IYTY G VL+A NP+ +++ +YS + +  Y  +   E  PH+FAIA+ A++ +  +  +  +V+SGESG+GKT ++K I+RY A V    N  G+ E+ ++++ +L +N I+E FGNAKT RNDNSSRFGKY+ I FD      G  +  YLLEKSR+V Q   ER++H FYQ+L G P    +E  L + P  Y Y NQG    +  I++   Y+   +A++ +G  +     I+ ++A +LH+G ++ ++   +  ++S+    ++++I            EL  +      K + ++ +  R + I+       A  ARD+ AK IY  LF W+   IN+ +   + D +++       FS IG+LDIYGFE FE NSFEQFCINY NEKLQQ F Q V K EQEEY++E I+W+ IE+ +NQ   D++E  +LGI ++LD+    P   +D+ +   L S   K     S ++F   +    +  F + HYA  V Y V GF+EKN+D+        F+      FK++L N            NT K + +    S     Q+  ++G+ FK S+ +L+  +     HY+RCIKPN  K P   D  +V  Q R  G++E +R+  AGF +R  +  F+QR+ +L+  + W     N     +AI++      D  IS+  ++  G+TKIF ++    F LE+ RT  ++ I +I+QK+ R 
Sbjct:   75 DLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHL-SSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKM---TRNDASLSSEEQNLQIA----------CELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDH------VFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIE-NKLGILSLLDEESRLPSG-SDESWASKLYSAFNKPP---SNEVFSKPRF--GQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLS-----QKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAF-LEKLRTNKMNEICIIIQKKIRA 793          
BLAST of unconventional myosin-Id vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 365.925 bits (938), Expect = 4.675e-106
Identity = 259/755 (34.30%), Postives = 401/755 (53.11%), Query Frame = 3
Query:  135 SFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEY--KGRELYES----------PPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTN--------ISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQN-DPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEIC-DMVEL--PRLGIFAILDDNCIKPGRVTDQMFLEDLDSNL-QKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWL-DGAKSVSETTQRPMS--------VGANFKTSIQK-------LVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKML--SKKTWPSWNSNLKEGSKA----IIDDMGISEDV-QWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            S + NLEKR+  + IYTY G  LVA+NPY  LN+YS   +N Y  K   L +S          PPHIFAIA+ A++ +  + +D  I+++GESG+GKTE +K IL+Y+A +T+        +SG   +E  +  +L+SN ILE FGNA+T RN+NSSRFGK++ I F+  G   G  +  YLLEKSR+V Q   ER++H FYQLL G     LK   L++ +   Y  ++  N   +P IND   ++E++ A+N IGF+  + + I+ +VA IL +G ++F          S +    S K   S++ S         V E     A+      A  + + +    + A +  +A ++ +Y+RLF +I   IN+ +          D  S    + IG+LDI GFEIFENNSFEQ CINY NEKLQQ F   +   EQ EY++E I+W  I+Y  + ++  D++E   P  G+  +LD+  + P + TD+ F   L S   Q  S +K  +L         +  F + HYAG V Y V G+L KNKD   ++   LL +S N+ +  ++  +G KS S   +  +S          + FKT+  +       L+  LA   PH+VRCI PN +K     +  L+  Q R  G++E +R+ R G+  R+ +  F QR+++L     T  +++S LK  +K     ++  + +   V + G+TK+F + A  +  LE+ +   ++ I++ L    RG
Sbjct:   90 SVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEF---------VSDRAEQASFKNDVSAICSN------LGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNL----------DHGSAT-LNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLP-KSTDESFYSKLISTWDQNSSKFKRSRL---------KNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFK-AGVLADLEKQKDVKLNNIMIKLTATIRG 807          
BLAST of unconventional myosin-Id vs. Ensembl Nematostella
Match: EDO45835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW9])

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 503/1027 (48.98%), Postives = 676/1027 (65.82%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRL-KEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKW------TNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSK-FNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHEL-TQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGE-DRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKL--RKKKCILRITNGVTYFSL-QTGCDGF 3116
             E  E+G  DF+L+D +   +F++NLE RF K RIYTYIGEV+V+VNPYK L+IY + ++ EYK RE+YE PPHIFA+ADA+++ +KR+++DTCI+ISGESGSGKTEASKII+RYIA +TN+S Q EIERVK++LLKSN ILE FGNA+TNRNDNSSRFGKYMDI FDFKGDP+GG + NYLLEKSRVV QQ GER+FHSFYQ+    PSD +  E+GL+ D   Y Y  QG   K+ +IND + Y+   +A+ ++GF+  E KT+W LVAAILHLG V F      +     Q   E+  +       ++ +A+L  +S   L +AL  R VAARG+V+ KGH  + A + RDA AKA YDRLFSWI ++IN+ I++ DK         H K +VIGVLDIYGFEIFE NSFEQ CINYCNEKLQQLFI+LVLK+EQEEY REGI+W      + +EYFNN+ ICD++E    GI AI+D+ C+  G+VTDQM L+ +D  L K   Y+SR   P++K++E  RDF I HYAG V Y+V  FL+KNKD  F+DFKRLLYNS + ++K MW +G +S+++TTQRP + G  FK S+  LVE L  K P YVRCIKPN IKSP   D ++V +Q  YLGL+ENVRVRRAG+A RM Y RFL R+KM   KTWPS+     +G + I+D  G S+DV++G TKIFIR+ Q+IF+LE++R   +  +V +LQ+ WRG +AR  AKR+R+   I+  ++ +++RS++ +    F     RSD+GK   WP+   PK        LK ++ RW A KV+   P+   PE+ LK    + L   GR K + +   W GDYL  + +NP   L Y        G   V+FS    K+NK  K E R +++T+  I ++ ++ K  K     + L+KI S+TVS G DQ+II+H     +DLV   L   + +R+ E +A ++       KK L V+V  N  NC L  + K+  +  T+   + +  + G DGF
Sbjct:    4 QESLEYGKGDFVLLDEVTKTAFMENLESRFHKERIYTYIGEVVVSVNPYKTLDIYGDDKIQEYKMREMYERPPHIFALADASYRAMKRRSEDTCIMISGESGSGKTEASKIIMRYIAAITNLSKQKEIERVKDILLKSNAILESFGNARTNRNDNSSRFGKYMDIDFDFKGDPIGGHIFNYLLEKSRVVKQQEGERNFHSFYQV----PSDSMIGEYGLERDAMLYYYTKQGKVPKISTINDSSLYKLNCDAMKSVGFSAEEQKTVWKLVAAILHLGNVVF------THEDHEQAVVENKDV-------LQIIAKLLGLSHEMLERALCYRVVAARGEVMEKGHNEKEAYHGRDALAKAAYDRLFSWIVSRINDSIEVRDK-------KEHGKCTVIGVLDIYGFEIFETNSFEQLCINYCNEKLQQLFIELVLKEEQEEYQREGIEWKSIHRCSQVEYFNNKIICDLIEQSHKGIIAIMDEGCLNVGKVTDQMLLQTMDKKLAKHPHYRSRLTDPSDKSMEFHRDFCIKHYAGNVIYSVEEFLDKNKDTLFQDFKRLLYNSKHKSLKDMWPEGQESITKTTQRPATAGTLFKNSMIALVEKLISKRPFYVRCIKPNEIKSPVAFDEKVVGNQVDYLGLLENVRVRRAGYAFRMHYKRFLLRYKMTDAKTWPSYPGQDIDGVREIVDSHGFSDDVKYGTTKIFIRTPQTIFELEKSRAAKLPDLVFMLQRCWRGGIARMRAKRMRSIYCIMTCFKRHQLRSFLSQIETRFKDCAQRSDFGKSNEWPE--SPKVAREFCDYLKAIYGRWWALKVINRIPEEDKPELALKSAAYNCL--DGRRKHWGLRTRWMGDYLALSDENPETEL-YKRCVHTKAG--TVIFSSRVQKINKHSKEESRTLVLTENAILKMDSKYKVLK----TIPLDKITSLTVSAGQDQLIIVHI--PHNDLVVCLLNNKKANRVVEFMASIYKQVLQTQKKALPVEVTANP-NCVLGNKAKRLTIEETDKADHVTFKKQGGDGF 992          
BLAST of unconventional myosin-Id vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 336/724 (46.41%), Postives = 480/724 (66.30%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR--KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ +   + ++NL  R+    IYTYIG V+V++NPY++  +Y+ + + EY+ R +YE PPHI+AIAD A++ ++  N+D CI+I+GESGSGKTEASK+I++Y+A V    G+ E++RVK  LL+SN ILE FGNAKT RNDNSSRFGKYMDI FDFKGDPVGG++  YLLEKSR+V Q  GER+FH FY LL GA  + L +  L  D D Y Y+NQ     VP+ +DK  +  V +A+  +GFT  E   ++ L++AIL+LG  + E   +S         TE+V + +  +  +K+  E+       L  +L ER V  + + +     +  A+YARDA AKA+Y RLF+WI  ++N+ I++  +  R+          VIGVLDIYGFEIF +NSFEQF INYCNEKLQQ+FI+L LK EQEEY+REGI+WT IEYFNN  IC+++E    GI A+LD+ C++PG V+D  FLE LD        Y+SR  K + ++KT+ H   FR+ HYAG+VTY+V+GFL+KN D  F    + +Y+ N+   K ++ +G  + S + +RP +    FK S+ +L++NL  K P+Y+RCIKPN  K+ G  D  L++HQ RYLGL+EN+RVRRAGFA R EY   LQR+KML  +TWP+W    ++G   ++  + +   +  +G TKIFIR+ +++F LE+ R   ++ + VI+QK +RG
Sbjct:   22 GVSDMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCG-KGR-EVDRVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSD-------GTEAVTVLNEQV--LKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVNDSIQVRKRGKRK----------VIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVICELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGY-FRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEGCPTKS-SKRRPKTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRG 722          
BLAST of unconventional myosin-Id vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 456.833 bits (1174), Expect = 1.581e-145
Identity = 261/717 (36.40%), Postives = 411/717 (57.32%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEY-KGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQ 2240
            G+ + I + ++D    + NL  R+  N+IYTY+G VLVAVNPY    IY    ++ Y K     + PPHI+A  + +  ++KR+  + C+VISGESG+GKTE++K IL+Y+   T +SG+     ++  +L +N ILE FGNAKT RNDNSSRFGKY+D+HF+      G  +++YLLE+SR+V Q   ER++H FY++L G      K   L +  D Y Y++QGN      ++D   Y  + +A+ A+ FT  E++ I+  +AA+LHLG + FE        + ++   E+  + +    ++   A+L  V +  + +A + ++  A G++I    ++E AT  RDAF K +Y ++F WI  KIN  I    K   ++D S       IGVLDI+GFE F+ NSFEQ CINY NE LQQ F+  + K EQEEY REGI+W  + + +NQE+ DM+    +   A++D+    P + TD+ FL+ L+ N      +K  K F   K+   +  F + H+AG V Y+  GFL+KN++ F  D   L+ +S  N   +M+       +ET +R  ++G  F+ S+  L++ LA     +VRC+KPN  K P   D EL   Q RY G++E VR+R++G+A R  +  F+ R+ ML + +    +S  ++ S  I   +   E+ + G  +IF++ +Q +  LE++R   +   ++ LQ
Sbjct:   65 GVENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYL---TAVSGRHST--IEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLHLTHAQDYY-YLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFE--------AKMEDNIEACDVMNPE--TVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSSIY---KPRGKDDTSGRQS---IGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTFVDNQEVLDMLAEKPMNFIALIDEESRFP-QGTDESFLDKLNYN------HKDNKHFVRPKS-RVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKERSMGTETRKRSPTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRDMSS--RDASHLIATSLLGQENWKLGTKRIFLKESQDVL-LEESRAQLLSSKIIFLQ 748          
BLAST of unconventional myosin-Id vs. Ensembl Nematostella
Match: EDO35007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP8])

HSP 1 Score: 453.366 bits (1165), Expect = 2.641e-145
Identity = 274/735 (37.28%), Postives = 402/735 (54.69%), Query Frame = 3
Query:   96 IPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYES--PPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDP-DKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQF--ELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPR-LGIFAILDDNCIKPGRVTD---QMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLD---GAKS-VSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAII--DDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            + D I + ++   S  +NL+ R  +  IYT IG VL++VNP+K++NIY    V  Y G++  E   PPH++ +A+   + +  +    C++ISGESG+GKT ++K ++ ++++V    G  E+ERVK+++++SN +LE FGNAKT  N+NSSRFGK+M+I +   G P GG ++ +LLEKSRVV Q  GER++H FYQLL G   D + E  +   P + Y Y+NQ     +   +D + Y   I A+  IG  +    T+  LVA +LHLG +QF  E N++   + S+  A   +   D  +        L D     LT    E     + +V  K    + A  ARDA AKAI+ +LF ++   +N  +   D+D              IGVLDIYGFE F+ N FEQF INY NEKLQ LFI   LK EQEEY  EGI W++I+YFNN  +  ++E  R  GI  +LDD C     V++      ++ L   +   S +   K F  +      R F I HYAG+V+Y   GF EKNKD    D   L+ +S    V+ M+ D   GA + V     +  +  +  +T    LV  +    PHYVRC+KP   K P   D + V HQ RYLGL EN++VRRAGFA R E+ R ++R+ +L   T     S+     KAI+   ++ +++  Q G TK+F++  Q I +LE+AR   +    + +Q  +RG
Sbjct:    5 VSDMIEIPDVSEASIANNLKIRLKQEEIYTNIGRVLISVNPFKKINIYGMDAVELYSGKKHNEGAKPPHLYEVANNMFENMLIEGDSQCVIISGESGAGKTVSAKHVMGFLSKVCG-EGSTEVERVKDIIMQSNPLLEAFGNAKTVMNNNSSRFGKFMEIQYSRSGQPNGGKISTFLLEKSRVVSQGQGERNYHIFYQLLSGCTPDEMSELEIDLGPAESYKYLNQTGVYTIEGTDDVSDYAATINAMEVIGIASSTRNTVLKLVATVLHLGNIQFTEEDNQAVPVDVSMLDAPSRLLSVDKDI--------LLD----KLTSYSMETRWGGKVEVTKKTLNKDQAVIARDALAKAIFFQLFEYLVEAVNSTMATRDQD------------FYIGVLDIYGFESFKVNGFEQFSINYVNEKLQNLFIDFTLKMEQEEYAEEGISWSDIDYFNNDVVLQLIESRRPPGIMGVLDDVCSTLHAVSEGSANTLMDKLRGVIGSNSSFA--KYFQAQA-----RHFAITHYAGKVSYESEGFCEKNKDTLSNDLVCLMQSSTEPFVRDMFPDSLYGASAGVGGRKAKSNTGSSKIRTQAHALVSKIRMCTPHYVRCVKPTESKIPLDWDDKKVLHQVRYLGLAENIKVRRAGFAFRREFPRIVERYSLLDPITVRKHQSDPVAACKAILLAGNLDMTK-YQVGKTKLFLKEPQMINQLEEARNAIITKYALTIQTVYRG 706          
BLAST of unconventional myosin-Id vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 447.203 bits (1149), Expect = 1.055e-137
Identity = 278/745 (37.32%), Postives = 406/745 (54.50%), Query Frame = 3
Query:   84 PEF--GIPDFILVDNIDLKSFVDNLEKRFIK-NRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQK-KSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDG-------AKSVSETTQRPM-------SVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLK---EGSKAIIDDMGISEDV-QWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            PE   G  D   +  +   + + NL  RFI+ N IYTY G VLVA+NPY+EL +Y    V  Y+GR + +  PHIFA+A+ A + + R  ++  +++SGESG+GKT ++K  +RY + V   S + +IE+    ++ +N I+E  GNAKT RNDNSSRFGKY++I FD     +G  M  YLLEKSRVV Q   ER++H FYQ+        +K+F L + PD + Y+NQG+   V SI+D   ++E+ EA++ +G  + E   ++ +++AILHLG V+            +Q   +   + ++    ++  A L  + +  L K L  R +   G+V++K  ++  A Y R+A +K IY +LF W+   IN  +            S+    S IGVLDIYGFE FE NSFEQFCINY NEKLQQ F Q V K EQ+EY+RE I+W+ I +++NQ   D++E  +LGI  +LD+ C  P     Q   +    +LQK K F K R              F I H+A  V Y V+GF+EKN+D   ++   LL  S +  V  M+ +         ++ S   ++         SVG+ F  S+ KL+E L    PHYVRCIKPN  K+P     +    Q R  G++E +R+  AG+ +R  Y  F  R+ ML     PS   N K   E  K I++     ED+ Q G TKIF R+ Q  + LE+ R   +    V++QK +R
Sbjct:   51 PEILVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQIEKK---VIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLAH-PDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEI-----------LQAGDDECTVEENDF-HLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLT-----------STSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINFYDNQPCIDLIE-AKLGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRM---------SNLAFVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIML----LPSKKINRKKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAY-LEKLRGDKLRRSCVMIQKNYR 753          
BLAST of unconventional myosin-Id vs. Ensembl Medaka
Match: MYO1D (myosin ID [Source:NCBI gene;Acc:101174957])

HSP 1 Score: 948.347 bits (2450), Expect = 0.000e+0
Identity = 503/1007 (49.95%), Postives = 684/1007 (67.92%), Query Frame = 3
Query:   75 HEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWN-SNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVL-GIYPKAKWPEIRLKLVGTDILLQKG-RSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKI-RGDR--KVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVF---NFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRI 3068
            HE  E+G  DF+L+D++ ++ F+ NL+ RF K RIY+YIGEV+V+VNPY+ +NIY    + +YKGRELYE PPH+FAIADAA+K +KR+N+DTCIVISGESG+GKTEASK I++YIA +TN + + EIERVKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+FDFKGDP+GG ++NYLLEKSRV+ QQ GERSFHSFYQLL GAP   L+   +Q DP  Y YI  G   K   IND A ++ V +A+  IGFT  E +T++ ++A ILHLG + F ++   +         E+VK+       +  + EL    E  + KAL  R VA   DVI K HT + A+Y RDA AKA+Y+RLF WI  +IN+ I++     +  D+  H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFIQLVLKQEQEEY REGI W +I+YFNNQ I D+VE    GIFA+LD+ C+  G+VTD++FL+ L+  L K + + SRKL P +K++E +RDFRI HYAG V Y+V GF++KNKD  F+DFKRLLYNS+N  +K MW +G   ++E T+RP++    FKTS+  LVENLA K P+YVRCIKPN +KSP   + E  +HQ  YLGL+ENVRVRRAGFA R  Y RFLQR+KM+SK TWP+ +  + K+  K ++   G   DV +G TK+FIR+ +++F LE+ R   V  IV+ LQK WRG LAR   +R+RAA+ I+ AYR YK++SYI +    F ++++  DYG+ + WP    PK     E  LK ++NRW A  ++ G+ P+    ++R K+   + L  KG R+   + R W G+YL    D+P  + ++     ++ R D+  +VLFS    K+N+  KTE RA++ITD +++++   K +K   S + L  +  ++VS G DQ+++ H  +S+ DLV      +   E RI ELV  L  H K   K++L V++  + + C +  +KC + +
Sbjct:    4 HESLEYGKADFVLLDSVSMEDFMANLKLRFEKGRIYSYIGEVVVSVNPYRAMNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRNKDTCIVISGESGAGKTEASKYIMQYIAAITNPNQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHISNYLLEKSRVIFQQDGERSFHSFYQLLIGAPDSLLRSLHIQKDPAAYNYIRVGGQIK-SGINDGADFKAVADAMKVIGFTGDEIQTVYKILATILHLGNLTFGVDGDVT-------LIENVKL-------VSVIRELLSTKEENVEKALLYRTVATGRDVIEKQHTTQEASYGRDALAKAMYERLFCWIVGRINDIIEV-----KNYDVKVHGKNTVIGVLDIYGFEIFQNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIFAVLDEACMNVGKVTDEVFLQGLNGKLAKHAHFTSRKLSPADKSLEFDRDFRIRHYAGDVVYSVVGFIDKNKDTLFQDFKRLLYNSSNQVLKVMWPEGKLRITEVTKRPLTAATLFKTSMISLVENLACKEPYYVRCIKPNDVKSPLIFEQERCRHQVEYLGLLENVRVRRAGFAYRQTYPRFLQRYKMISKFTWPNHDLPSDKDAVKKLLQGCGFEHDVAYGKTKVFIRTPRTLFSLEEQRADMVQRIVLFLQKVWRGTLARMRYRRMRAAHTILQAYRRYKVKSYIREVNRRFRNVRTMKDYGRRVKWPT--PPKVLRKFEEALKNIYNRWWAWTLIKGLSPEETL-QVRAKVASLEAL--KGQRADLGLQRAWEGNYLVSKRDSPDTASSFTLVSSELQRKDKFMRVLFSCNVRKINRFHKTENRAVLITDRHLYKMDPLKQYKPMKS-IPLYNVTGVSVSPGKDQLVVFHTKDSR-DLVVCLQGMVPANESRIGELVGTLLSHFKSE-KRKLQVNIA-SPIQCSMNGRKCTVMV 981          
BLAST of unconventional myosin-Id vs. Ensembl Medaka
Match: myo1g (unconventional myosin-Ig [Source:NCBI gene;Acc:101167133])

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 445/967 (46.02%), Postives = 620/967 (64.12%), Query Frame = 3
Query:   78 EGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVA-ARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPS-WNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNF----LTFGEDRIPELVA 2960
            EG EFG  DF+L+D + ++ F++NL+ RF K RIYTYIGEV+V+VNPY++++I+  + +  Y+GRELYE+PPH++A++DAA+K +KR+ +DTCIVISGESG+GKTEASK I++YIA +TN   + E+E VKN+LLKSNC+LE FGNAKTNRNDNSSRFGKYMDI+F+F GDP GG +NNYLLEKSRVV QQ GER+FHSFYQ                                  S ND++ ++ V+ A++ IGF+N E  +I+ ++A+IL LG VQFE +             ESV++ +  +  +  +AEL       + K+L  R VA   G+VI KGHT + A + R+AFAKA+Y+RLF WI ++IN  I++ + +        H K +VIGVLDIYGFEIF+NNSFEQFCINYCNEKLQQLFI+L+L+QEQ EY REGI W +I+YFNNQ I D+VE P  GI +ILD+ C+  G+VTD + LE +++ L +   Y SRKL PT+KT++ ++ FRI HYAG VTY+V GFL+KNKD  F+DFKRL+YNS N  +K MW DG   ++E T+RP++  + FK SI  LV+ LA K P+YVRCIKPN +KSP   D    QHQ  YLGL+ENV VRRAGFA R  Y+RFLQR+KM  + TWP+   ++ ++  +AII   G  +DV +GHTK+F+R+ +S+F LEQ R   +  +V+ LQK WRG LAR   KR+RA   I+  Y+ YK++++  +    F+++++ +DYGK + WP    P            +  RW A +V+   P +   E+R K V     LQ  R  + +GR W  DYL                   +R   K LF+          K+  RA++ITD ++++L   K +K     + L+    ++ + G DQ+++LH   +K D++       L   +DR+ E+V 
Sbjct:    5 EGLEFGKSDFVLLDEVTMEQFMENLKLRFQKGRIYTYIGEVVVSVNPYRQMDIFGKETIEAYRGRELYENPPHLYAVSDAAYKAMKRRAKDTCIVISGESGAGKTEASKYIMQYIAAITNPGQRVEVESVKNVLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFNFNGDPTGGHINNYLLEKSRVVHQQEGERNFHSFYQ---------------------------------TSNNDRSNHKAVMSALDVIGFSNQEITSIYQILASILLLGNVQFEED------------GESVQVVEDGV--VNQIAELTATDPDCVVKSLLYRTVATGGGEVIEKGHTEQDACFGREAFAKALYERLFGWIVSRINSVIEVKNYNP-----VLHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIELILQQEQSEYQREGITWQHIDYFNNQIIVDLVEQPHKGIISILDEACLTVGKVTDTVCLESMNTKLAQHPHYTSRKLSPTDKTMDFQKHFRIRHYAGDVTYSVEGFLDKNKDLLFQDFKRLMYNSANPVLKEMWPDGQLGITEVTKRPLTAASLFKNSIVALVDKLACKEPYYVRCIKPNEVKSPVLFDDARCQHQVAYLGLLENVMVRRAGFAYRQLYSRFLQRYKMTCEYTWPNHLMASDRDAVEAIIRQHGFQDDVAFGHTKLFVRTPRSLFTLEQERAALIPILVLFLQKIWRGALARLRCKRMRAIYTIMGCYKRYKVKAHFWEVEGRFANVRTTADYGKSVEWPA--PPAALTQFHQITLMLHRRWWARQVVKNIPPSDMLEVRAK-VAALTALQGERKHWGVGRAWERDYLA-----------------NVRKHLKTLFN----------KSTDRALLITDKFVYKLEPKKQYKI-LKKLPLDVFTGLSTTSGVDQMLVLH-TSNKDDILLCLQRGELCPNQDRVGEVVG 887          
BLAST of unconventional myosin-Id vs. Ensembl Medaka
Match: myo1b (myosin IB [Source:NCBI gene;Acc:101175446])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 339/726 (46.69%), Postives = 487/726 (67.08%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR----KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ +   SF++NL+KRF  N IYTYIG V++++NPY+ L IY+ ++V EY+ R  YE  PHI+A+AD A++ ++ Q++D CI+I+GESG+GKTEASK+++ Y+A V    GQ E+ +VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKGDP+GG+++NYLLEKSRVV Q  GER+FH FYQLL GA  + LK+  L  D  KY Y+   +++ V  ++D A ++ V  A+  +GF   E +++  LVAA+L LG ++F+    S+      G  ES ++ D +   +K M EL  + ++ L +A S R V A+ + +     +  A YARDA AK +Y RLFSW+  +IN  IK   K           +  V+GVLDIYGFEIFE+NSFEQF INYCNEKLQQ+FI+L L++EQEEY+REGI+WTNIEYFNN  ICD++E  + GI A+LD+ C++PG VTD+ FL+ L++   +   ++SR      F T+ ++ H   FRI HYAG+V Y V GF++KN D  + D  + +Y +N+N +K ++ +G+ +     +RP + G  FK S+  L+ NL  K P+Y+RCIKPN  K+       LV HQ RYLGL+ENVRVRRAG+A R  Y   L+R+KML KKTWP W    ++G + ++ D+ + +E+  +G +KIFIR+ +++F LE+ R   +  +  ++QK +RG
Sbjct:   13 GVGDMVLLEPLSEDSFLENLKKRFDHNEIYTYIGSVVISMNPYRSLPIYTPEKVEEYRNRNFYELSPHIYALADEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCG-KGQ-EVNKVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASDETLKKLKLDRDVSKYNYLCL-DSASVSGVDDAANFRTVRNAMQIVGFMEDEVQSVLQLVAAVLKLGNIEFKPESRSN------GLDES-RVKDKN--DLKEMCELLGIEQSVLERAFSYRTVEAKSEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVTRINGSIKAQAK----------TRHKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLREEQEEYIREGIEWTNIEYFNNAVICDLMENNQNGILAMLDEECLRPGTVTDETFLDKLNTICAEHQHFESRLSKNSKFLTDHSLPHN-CFRIQHYAGKVLYRVEGFVDKNNDLLYRDLSQAMYKANHNLIKQLFPEGSPA-KINLKRPPTAGFQFKASVGTLMRNLQTKNPNYIRCIKPNDKKASHIFTESLVCHQVRYLGLMENVRVRRAGYAFRQAYEPCLERYKMLCKKTWPHWKGPARQGVEVLMADLKVPAEEYSYGRSKIFIRNPRTLFFLEERRRQCLQDLAALIQKIYRG 714          

HSP 2 Score: 57.7658 bits (138), Expect = 8.071e-8
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 3
Query: 2319 HYKIRSYIVKFVANF-SSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILL-QKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNK-KGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLF-LHCKDAFKKELTVDV 3014
            ++ ++  I K+  N   +L S S   K  SWP  R      G+  EL+R+F+ WR  K    + + K      KL  + +   +K     ++ + ++GDYL + + NP     Y      +  D KVL +   SK+N+  GK   R  ++T   +    Q     K S P+L   + S++VSK +D    L   E  +  V        +R+ E++ KL+ L   +A +  L+VD+
Sbjct:  810 NFTVQRIIQKYFLNLRKNLPSMSPIDK--SWPT-RPYSFLDGVHTELRRIFHLWRCKKYRSQFTEEKKAVYEEKLEASKLFKDRKALYPSSVSQSFKGDYL-EINKNPK----YQKLHSAV--DEKVLLADTISKINRANGKGTPRIFLLTKKSVVLADQKTGQVKASVPLL--DLASVSVSKQSDGFFALKLKEGSASAVKGDFLLSSERLIEIITKLYRLSAANAERVPLSVDI 1033          
BLAST of unconventional myosin-Id vs. Ensembl Medaka
Match: myo1b (myosin IB [Source:NCBI gene;Acc:101175446])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 339/726 (46.69%), Postives = 487/726 (67.08%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR----KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ +   SF++NL+KRF  N IYTYIG V++++NPY+ L IY+ ++V EY+ R  YE  PHI+A+AD A++ ++ Q++D CI+I+GESG+GKTEASK+++ Y+A V    GQ E+ +VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKGDP+GG+++NYLLEKSRVV Q  GER+FH FYQLL GA  + LK+  L  D  KY Y+   +++ V  ++D A ++ V  A+  +GF   E +++  LVAA+L LG ++F+    S+      G  ES ++ D +   +K M EL  + ++ L +A S R V A+ + +     +  A YARDA AK +Y RLFSW+  +IN  IK   K           +  V+GVLDIYGFEIFE+NSFEQF INYCNEKLQQ+FI+L L++EQEEY+REGI+WTNIEYFNN  ICD++E  + GI A+LD+ C++PG VTD+ FL+ L++   +   ++SR      F T+ ++ H   FRI HYAG+V Y V GF++KN D  + D  + +Y +N+N +K ++ +G+ +     +RP + G  FK S+  L+ NL  K P+Y+RCIKPN  K+       LV HQ RYLGL+ENVRVRRAG+A R  Y   L+R+KML KKTWP W    ++G + ++ D+ + +E+  +G +KIFIR+ +++F LE+ R   +  +  ++QK +RG
Sbjct:   13 GVGDMVLLEPLSEDSFLENLKKRFDHNEIYTYIGSVVISMNPYRSLPIYTPEKVEEYRNRNFYELSPHIYALADEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCG-KGQ-EVNKVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASDETLKKLKLDRDVSKYNYLCL-DSASVSGVDDAANFRTVRNAMQIVGFMEDEVQSVLQLVAAVLKLGNIEFKPESRSN------GLDES-RVKDKN--DLKEMCELLGIEQSVLERAFSYRTVEAKSEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVTRINGSIKAQAK----------TRHKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLREEQEEYIREGIEWTNIEYFNNAVICDLMENNQNGILAMLDEECLRPGTVTDETFLDKLNTICAEHQHFESRLSKNSKFLTDHSLPHN-CFRIQHYAGKVLYRVEGFVDKNNDLLYRDLSQAMYKANHNLIKQLFPEGSPA-KINLKRPPTAGFQFKASVGTLMRNLQTKNPNYIRCIKPNDKKASHIFTESLVCHQVRYLGLMENVRVRRAGYAFRQAYEPCLERYKMLCKKTWPHWKGPARQGVEVLMADLKVPAEEYSYGRSKIFIRNPRTLFFLEERRRQCLQDLAALIQKIYRG 714          

HSP 2 Score: 57.7658 bits (138), Expect = 7.595e-8
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 3
Query: 2319 HYKIRSYIVKFVANF-SSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILL-QKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKK-GKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLF-LHCKDAFKKELTVDV 3014
            ++ ++  I K+  N   +L S S   K  SWP  R      G+  EL+R+F+ WR  K    + + K      KL  + +   +K     ++ + ++GDYL + + NP     Y      +  D KVL +   SK+N+  GK   R  ++T   +    Q     K S P+L   + S++VSK +D    L   E  +  V        +R+ E++ KL+ L   +A +  L+VD+
Sbjct:  839 NFTVQRIIQKYFLNLRKNLPSMSPIDK--SWPT-RPYSFLDGVHTELRRIFHLWRCKKYRSQFTEEKKAVYEEKLEASKLFKDRKALYPSSVSQSFKGDYL-EINKNPK----YQKLHSAV--DEKVLLADTISKINRANGKGTPRIFLLTKKSVVLADQKTGQVKASVPLL--DLASVSVSKQSDGFFALKLKEGSASAVKGDFLLSSERLIEIITKLYRLSAANAERVPLSVDI 1062          
BLAST of unconventional myosin-Id vs. Ensembl Medaka
Match: myo1b (myosin IB [Source:NCBI gene;Acc:101175446])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 339/726 (46.69%), Postives = 487/726 (67.08%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSR----KLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI-SEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRG 2255
            G+ D +L++ +   SF++NL+KRF  N IYTYIG V++++NPY+ L IY+ ++V EY+ R  YE  PHI+A+AD A++ ++ Q++D CI+I+GESG+GKTEASK+++ Y+A V    GQ E+ +VK  LL+SN +LE FGNAKT RNDNSSRFGKYMDI FDFKGDP+GG+++NYLLEKSRVV Q  GER+FH FYQLL GA  + LK+  L  D  KY Y+   +++ V  ++D A ++ V  A+  +GF   E +++  LVAA+L LG ++F+    S+      G  ES ++ D +   +K M EL  + ++ L +A S R V A+ + +     +  A YARDA AK +Y RLFSW+  +IN  IK   K           +  V+GVLDIYGFEIFE+NSFEQF INYCNEKLQQ+FI+L L++EQEEY+REGI+WTNIEYFNN  ICD++E  + GI A+LD+ C++PG VTD+ FL+ L++   +   ++SR      F T+ ++ H   FRI HYAG+V Y V GF++KN D  + D  + +Y +N+N +K ++ +G+ +     +RP + G  FK S+  L+ NL  K P+Y+RCIKPN  K+       LV HQ RYLGL+ENVRVRRAG+A R  Y   L+R+KML KKTWP W    ++G + ++ D+ + +E+  +G +KIFIR+ +++F LE+ R   +  +  ++QK +RG
Sbjct:   13 GVGDMVLLEPLSEDSFLENLKKRFDHNEIYTYIGSVVISMNPYRSLPIYTPEKVEEYRNRNFYELSPHIYALADEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCG-KGQ-EVNKVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASDETLKKLKLDRDVSKYNYLCL-DSASVSGVDDAANFRTVRNAMQIVGFMEDEVQSVLQLVAAVLKLGNIEFKPESRSN------GLDES-RVKDKN--DLKEMCELLGIEQSVLERAFSYRTVEAKSEKVSTTLNVAQAYYARDALAKNLYSRLFSWLVTRINGSIKAQAK----------TRHKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTLREEQEEYIREGIEWTNIEYFNNAVICDLMENNQNGILAMLDEECLRPGTVTDETFLDKLNTICAEHQHFESRLSKNSKFLTDHSLPHN-CFRIQHYAGKVLYRVEGFVDKNNDLLYRDLSQAMYKANHNLIKQLFPEGSPA-KINLKRPPTAGFQFKASVGTLMRNLQTKNPNYIRCIKPNDKKASHIFTESLVCHQVRYLGLMENVRVRRAGYAFRQAYEPCLERYKMLCKKTWPHWKGPARQGVEVLMADLKVPAEEYSYGRSKIFIRNPRTLFFLEERRRQCLQDLAALIQKIYRG 714          

HSP 2 Score: 57.3806 bits (137), Expect = 8.982e-8
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 3
Query: 2319 HYKIRSYIVKFVANF-SSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILL-QKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKK-GKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLF-LHCKDAFKKELTVDV 3014
            ++ ++  I K+  N   +L S S   K  SWP  R      G+  EL+R+F+ WR  K    + + K      KL  + +   +K     ++ + ++GDYL + + NP     Y      +  D KVL +   SK+N+  GK   R  ++T   +    Q     K S P+L   + S++VSK +D    L   E  +  V        +R+ E++ KL+ L   +A +  L+VD+
Sbjct:  868 NFTVQRIIQKYFLNLRKNLPSMSPIDK--SWPT-RPYSFLDGVHTELRRIFHLWRCKKYRSQFTEEKKAVYEEKLEASKLFKDRKALYPSSVSQSFKGDYL-EINKNPK----YQKLHSAV--DEKVLLADTISKINRANGKGTPRIFLLTKKSVVLADQKTGQVKASVPLL--DLASVSVSKQSDGFFALKLKEGSASAVKGDFLLSSERLIEIITKLYRLSAANAERVPLSVDI 1091          
BLAST of unconventional myosin-Id vs. Planmine SMEST
Match: SMESG000051401.1 (SMESG000051401.1)

HSP 1 Score: 2084.69 bits (5400), Expect = 0.000e+0
Identity = 1027/1033 (99.42%), Postives = 1030/1033 (99.71%), Query Frame = 3
Query:   63 MAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVXXXXXXXXXXXXXXXXXXYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNGVTYFSLQTGCDGFKPAVTFKLISKNLFS 3161
            MAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFT LESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSS+PSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLS+HNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGI EDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVLARRLAKRIRAANKI+NAYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTD LLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNGVTYFSLQTGCDGFKPAVTFKLISKNLFS
Sbjct:    1 MAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTKLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSIPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSNHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGILEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGVLARRLAKRIRAANKIVNAYRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKRVFNRWRANKVLGIYPKAKWPEIRLKLVGTDTLLQKGRSKFNIGRDWRGDYLCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIITDLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLVFNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCILRITNGVTYFSLQTGCDGFKPAVTFKLISKNLFS 1033          
BLAST of unconventional myosin-Id vs. Planmine SMEST
Match: SMESG000068232.1 (SMESG000068232.1)

HSP 1 Score: 535.028 bits (1377), Expect = 1.992e-171
Identity = 294/728 (40.38%), Postives = 440/728 (60.44%), Query Frame = 3
Query:  102 DFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDV---IMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPR-LGIFAILDDNCIKPGRVTDQM---FLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQW--GHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGV 2258
            D +L+  I   S  +NL+KRF+ + IYTYIG VL+AVNP+K+L+I++ KE+  Y+G   YE+PPHI+AIAD   + +    +  C++ISGESG+GKT ++K I+ YI++V+  +G+  +E++K ++L+SN +LE FGNAKT RN+NSSRFGKY++I FD  G+P+GG ++ +LLEKSRVV+Q   ER+FH FYQL+ G   D  + FG+   PD Y Y+NQ    KV   +DK+ ++  + A+  +G    E  +I ++VAA+LHLG V F           I+G  ++ +  D    S++    L  + E+ L   ++ R +A R +    I+     + A  ARDA +KA+Y R+F +I  KIN  + I+  D              IG+LDIYGFEIF  N FEQFCINY NEKLQQ+FI+L LK EQ+EY++EG++WT + YFNN+ +CD++EL    G+F+ILDD C    +VTD +   F+  +D +   K  Y S           H   F I HYAG+V+Y   GF E+N+D    D   ++  S N  +  ++ +    + +  +  ++VG+  +     LV  L K  PHY+RCIKPN  K     + + V  Q  YLGL EN+ VRRAG+A R  + +F+QR+ +LSK+TWP W  ++K+G + ++    I+ D QW  G TK+FI+  +S+F LE+ R    +    ++Q  +R V
Sbjct:   16 DLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGR--VEQIKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITT-PDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLF-----------IEGQQQA-EFKDKR--SLQFPCYLLGLEESELATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAINIDDMN------------IGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVAKMDGSNLNKDHYSS-----------HSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPENVTDL-KNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQRYAILSKETWPKWTGDVKKGIQHLMKTADIN-DGQWQIGKTKLFIKDPESLFLLEERRERKFNHYAKVIQIFFRQV 701          
BLAST of unconventional myosin-Id vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 469.544 bits (1207), Expect = 1.881e-140
Identity = 270/724 (37.29%), Postives = 414/724 (57.18%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI---KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNS-NLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            G+ D I + +++    + NL  R+ +N IYTY G +LVAVNPY  L IY+ KE+  YK  ++ +  PHIFAIAD A+  ++R ++D  I+ISGESG+GKTE++K+IL+++A V   SGQ     ++  +L SN ILE FGNAKT RNDNSSRFGKY+DI+F   G   G  ++ +LLEKSR+V Q   ER++H FY +L G P +    FGL+   D Y Y+NQG    +    D   +  +  A+  + FT  E + I+ L+AA LHLG + F+        + ++   +S +++  S       ++L  +    L KAL+ + +  R D ++   ++      RDA  K IY RLF WI  KIN  I    +S       +  S++K++ IGVLDI+GFE F+NNSFEQ CINY NE LQQ F++ + K EQEEY  E I W +I + +NQE  D++ +    I A++D+    P + TD   L  L +   K   +  +K        +  + F I+H+AG V Y ++GFLEKN+D F  D   L+  + +  +K ++    K   +T +R  ++G  F+ S+  L++ L ++ P +VRCIKPN  K     D  L   Q RY G++E +R+R+AG+  R E+  F+ R+++L      S+   + +E +K +  ++   +  Q G TK+F++ AQ I  LE  R  A+   ++++QK WR
Sbjct:   66 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAV---SGQHSW--IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRAS-DHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFK--------AKLERNMDSCEVSMDS--EFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSLSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFP-KGTDHSLLNKLVNTCSKHPRFIKQK-------ADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWR 764          
BLAST of unconventional myosin-Id vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 469.159 bits (1206), Expect = 2.708e-140
Identity = 270/724 (37.29%), Postives = 414/724 (57.18%), Query Frame = 3
Query:   93 GIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKI---KISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNS-NLKEGSKAIIDDMGISEDVQWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWR 2252
            G+ D I + +++    + NL  R+ +N IYTY G +LVAVNPY  L IY+ KE+  YK  ++ +  PHIFAIAD A+  ++R ++D  I+ISGESG+GKTE++K+IL+++A V   SGQ     ++  +L SN ILE FGNAKT RNDNSSRFGKY+DI+F   G   G  ++ +LLEKSR+V Q   ER++H FY +L G P +    FGL+   D Y Y+NQG    +    D   +  +  A+  + FT  E + I+ L+AA LHLG + F+        + ++   +S +++  S       ++L  +    L KAL+ + +  R D ++   ++      RDA  K IY RLF WI  KIN  I    +S       +  S++K++ IGVLDI+GFE F+NNSFEQ CINY NE LQQ F++ + K EQEEY  E I W +I + +NQE  D++ +    I A++D+    P + TD   L  L +   K   +  +K        +  + F I+H+AG V Y ++GFLEKN+D F  D   L+  + +  +K ++    K   +T +R  ++G  F+ S+  L++ L ++ P +VRCIKPN  K     D  L   Q RY G++E +R+R+AG+  R E+  F+ R+++L      S+   + +E +K +  ++   +  Q G TK+F++ AQ I  LE  R  A+   ++++QK WR
Sbjct:   66 GVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAV---SGQHSW--IEQQVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRAS-DHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFK--------AKLERNMDSCEVSMDS--EFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSLSQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFP-KGTDHSLLNKLVNTCSKHPRFIKQK-------ADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFDTRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETTKLVCKNILDPKGYQIGKTKLFLKDAQDIL-LEDLRDKALSNRIILIQKTWR 764          
BLAST of unconventional myosin-Id vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 420.624 bits (1080), Expect = 8.143e-132
Identity = 254/741 (34.28%), Postives = 417/741 (56.28%), Query Frame = 3
Query:   99 PDFILVDNIDLKSFV------DNLEKRFIKNRIYTYIGEVLVAVNPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHK--IVKRQNQDTCIVISGESGSGKTEASKIILRYIAQVTNISGQDEIE------RVKNLLLKSNCILECFGNAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGERSFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQEVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGATESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTMELATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVIGVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIKWTNIEYFNNQEIC-DMVELPRLGIFAILDDNCIKPGRVTDQMFLEDL-DSNLQKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFEDFKRLLYNSNNNTVKSMWLDGAKSVSETTQRP----MSVGANFKTSIQKLVENLAKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATRMEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDV-QWGHTKIFIRSAQSIFKLEQARTCAVDWIVVILQKRWRGV 2258
            P F++++++   +F+      DNL +R+ KN IYTY G   +AVNPY+   IY+++ + +YKG+   E PPHIF+I+D A+   +V R+NQ   ++I+GESG+GKTE +K ++ Y A V   S +D+ +       +++ ++++N +LE +GNAKT RN+NSSRFGK++ IHF   G   G  +  YLLEKSRV+ QQ GER++H FYQLL         +  +  DP  + +INQG  + +  ++D+   +   EA + +GF++ E  +++    +I+++G ++F+      Q +   G TE+ K++            L  V+   L +A+ +  V    + + KG + +   Y+  A AK++Y+R+F+W+  ++N+ +          D     +F  IGVLDI GFEIF+ N FEQ CINY NE+LQQ F   +   EQEEY +E I W  I++  + + C +++E P +GI +IL++ C+ P + +DQ     L D++L K   +   K     K  +HE  F + HYAG V YN+ G+LEKNKD   E    LL  S    V S++     +    T++     M+V    + S+ KL++NL    PH++RCI PN  K PG +D  LV HQ    G++E +R+ R GF  RM Y+ F QR+ +L+    P      K+ +  I+  + +  ++ + G+TK+F + A ++ +LE  R   +  ++ + Q + R +
Sbjct:   77 PKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQ--SVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELT-IDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQ-AEADGTTEAEKVS-----------FLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTL----------DTKVKRQF-FIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKP-MGILSILEEECMFP-KASDQTLKAKLYDNHLGKSPNFGKPK---PPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFK-AGTLAQLEDIRDEKLSSLISLFQAQIRDI 785          
The following BLAST results are available for this feature:
BLAST of unconventional myosin-Id vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO1D0.000e+050.60myosin ID [Source:HGNC Symbol;Acc:HGNC:7598][more]
MYO1D0.000e+051.08myosin ID [Source:HGNC Symbol;Acc:HGNC:7598][more]
MYO1G0.000e+047.50myosin IG [Source:HGNC Symbol;Acc:HGNC:13880][more]
MYO1G0.000e+047.50myosin IG [Source:HGNC Symbol;Acc:HGNC:13880][more]
MYO1D0.000e+049.73myosin ID [Source:HGNC Symbol;Acc:HGNC:7598][more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hum-50.000e+046.97Heavy chain, Unconventional Myosin; Myosin IA [So... [more]
hum-50.000e+046.97Heavy chain, Unconventional Myosin; Myosin IA [So... [more]
hum-18.281e-16838.77Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-67.050e-13235.51Unconventional myosin heavy chain 6 [Source:UniPr... [more]
hum-21.592e-12235.89Heavy chain, Unconventional Myosin [Source:UniPro... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo31DF0.000e+049.36gene:FBgn0086347 transcript:FBtr0304138[more]
Myo31DF0.000e+049.36gene:FBgn0086347 transcript:FBtr0080036[more]
Myo31DF0.000e+049.36gene:FBgn0086347 transcript:FBtr0080035[more]
Myo61F0.000e+046.72gene:FBgn0010246 transcript:FBtr0072675[more]
Myo61F0.000e+046.78gene:FBgn0010246 transcript:FBtr0072674[more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO1D0.000e+050.69myosin 1D [Source:NCBI gene;Acc:559562][more]
myo1g0.000e+047.07myosin IG [Source:ZFIN;Acc:ZDB-GENE-060503-562][more]
myo1g0.000e+048.56myosin IG [Source:ZFIN;Acc:ZDB-GENE-060503-562][more]
myo1b0.000e+046.97myosin IB [Source:ZFIN;Acc:ZDB-GENE-030131-695][more]
myo1cb0.000e+047.45myosin Ic, paralog b [Source:ZFIN;Acc:ZDB-GENE-090... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnft20.000e+048.96ring finger protein, transmembrane 2 [Source:Xenba... [more]
rnft20.000e+048.67ring finger protein, transmembrane 2 [Source:Xenba... [more]
rnft20.000e+048.17ring finger protein, transmembrane 2 [Source:Xenba... [more]
rnft20.000e+047.72ring finger protein, transmembrane 2 [Source:Xenba... [more]
rnft20.000e+048.72ring finger protein, transmembrane 2 [Source:Xenba... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo1d0.000e+050.00myosin ID [Source:MGI Symbol;Acc:MGI:107728][more]
Myo1d0.000e+050.15myosin ID [Source:MGI Symbol;Acc:MGI:107728][more]
Myo1g0.000e+047.60myosin IG [Source:MGI Symbol;Acc:MGI:1927091][more]
Myo1a0.000e+037.39myosin IA [Source:MGI Symbol;Acc:MGI:107732][more]
Myo1b0.000e+046.01myosin IB [Source:MGI Symbol;Acc:MGI:107752][more]
back to top
BLAST of unconventional myosin-Id vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7F9L8|MYO1D_DANRE0.000e+050.69Unconventional myosin-Id OS=Danio rerio OX=7955 GN... [more]
sp|Q17R14|MYO1D_BOVIN0.000e+050.90Unconventional myosin-Id OS=Bos taurus OX=9913 GN=... [more]
sp|F1PRN2|MYO1D_CANLF0.000e+050.70Unconventional myosin-Id OS=Canis lupus familiaris... [more]
sp|Q23978|MY31D_DROME0.000e+049.36Unconventional myosin ID OS=Drosophila melanogaste... [more]
sp|O94832|MYO1D_HUMAN0.000e+050.60Unconventional myosin-Id OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of unconventional myosin-Id vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3ITX20.000e+051.83unconventional myosin-Id OS=Lingula unguis OX=7574... [more]
V4ATI00.000e+053.04Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A131XP450.000e+051.05Putative myosin class ii heavy chain OS=Hyalomma e... [more]
A0A224Z3N20.000e+050.95Myosin I OS=Rhipicephalus zambeziensis OX=60191 PE... [more]
A0A2C9KFS60.000e+052.30Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO1D0.000e+050.40myosin ID [Source:HGNC Symbol;Acc:HGNC:7598][more]
MYO1D0.000e+049.40myosin ID [Source:HGNC Symbol;Acc:HGNC:7598][more]
MYO1D0.000e+050.26myosin ID [Source:HGNC Symbol;Acc:HGNC:7598][more]
myo1g0.000e+047.50myosin IG [Source:ZFIN;Acc:ZDB-GENE-060503-562][more]
myo1b8.238e-646.56myosin IB [Source:NCBI gene;Acc:103043526][more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000990.10.000e+045.53pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 ... [more]
ENSPMAT00000001434.14.197e-17639.48pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 ... [more]
myo1f7.697e-17139.26myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506][more]
myo1hb5.969e-13540.66myosin IHb [Source:ZFIN;Acc:ZDB-GENE-070705-355][more]
myh107.417e-13335.19myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO52.206e-16339.65One of two type I myosin motors; contains proline-... [more]
MYO39.575e-16240.43One of two type I myosins; localizes to actin cort... [more]
MYO29.346e-12334.27Type V myosin motor involved in actin-based transp... [more]
MYO44.258e-12234.18Type V myosin motor involved in actin-based transp... [more]
MYO14.675e-10634.30Type II myosin heavy chain; required for wild-type... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458350.000e+048.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495150.000e+046.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455631.581e-14536.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350072.641e-14537.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418191.055e-13737.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of unconventional myosin-Id vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO1D0.000e+049.95myosin ID [Source:NCBI gene;Acc:101174957][more]
myo1g0.000e+046.02unconventional myosin-Ig [Source:NCBI gene;Acc:101... [more]
myo1b8.071e-846.69myosin IB [Source:NCBI gene;Acc:101175446][more]
myo1b7.595e-846.69myosin IB [Source:NCBI gene;Acc:101175446][more]
myo1b8.982e-846.69myosin IB [Source:NCBI gene;Acc:101175446][more]
back to top
BLAST of unconventional myosin-Id vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051401.10.000e+099.42SMESG000051401.1[more]
SMESG000068232.11.992e-17140.38SMESG000068232.1[more]
SMESG000005090.11.881e-14037.29SMESG000005090.1[more]
SMESG000005090.12.708e-14037.29SMESG000005090.1[more]
SMESG000056451.18.143e-13234.28SMESG000056451.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033662 ID=SMED30033662|Name=unconventional myosin-Id|organism=Schmidtea mediterranea sexual|type=transcript|length=3402bp
ATGAACTGTATATTAAGTTACAATTAATATAAGTTATTTTAAATTTTTTA
TCACTTTTAAGAATGGCTTTTTTTCACGAAGGACCGGAATTTGGTATTCC
AGATTTCATATTGGTTGATAATATTGATCTGAAATCATTTGTTGATAACT
TAGAGAAACGATTCATCAAAAATCGAATTTACACTTACATCGGAGAAGTA
TTGGTCGCTGTTAATCCCTATAAAGAACTGAACATTTATAGTAATAAAGA
AGTAAACGAATATAAAGGAAGAGAATTATATGAAAGTCCCCCGCATATAT
TTGCAATTGCTGATGCAGCTCATAAAATTGTCAAACGTCAAAACCAAGAC
ACGTGCATTGTAATTTCTGGAGAATCTGGATCCGGAAAAACCGAAGCGTC
GAAAATAATTTTAAGATATATCGCTCAAGTAACGAATATCAGTGGGCAGG
ATGAAATCGAGCGAGTGAAAAATCTCTTGTTGAAATCGAATTGCATTTTA
GAATGTTTCGGTAATGCGAAAACAAATCGCAACGACAATTCGAGCCGATT
TGGAAAATATATGGATATACACTTTGATTTCAAGGGTGACCCAGTAGGTG
GAATCATGAATAATTATCTCTTAGAAAAGTCGCGGGTGGTGATGCAACAG
GTCGGAGAGCGATCTTTTCATTCATTTTATCAGCTACTATATGGGGCACC
GTCAGACAGATTGAAAGAATTTGGTCTTCAGAATGATCCCGACAAATACT
GCTACATTAATCAAGGAAATAATTCAAAAGTGCCATCCATCAATGACAAG
GCTCGTTATCAAGAAGTCATTGAAGCTATAAATGCAATAGGATTTACTAA
CTTAGAAAGTAAAACTATATGGAATCTAGTGGCTGCAATTCTTCATTTAG
GAACTGTGCAATTTGAACTAAATGAATCCAGTTCTCAGAATTCCTCAATT
CAAGGAGCAACTGAGTCTGTGAAAATCACTGATTCCAGTATGCCTTCTAT
CAAGCACATGGCTGAATTGTTTGATGTTTCTGAAGCGGGGTTGACAAAAG
CTCTGAGCGAAAGAGCTGTAGCTGCCAGAGGTGATGTCATTATGAAAGGA
CATACAATGGAATTGGCTACTTATGCTCGGGATGCTTTTGCTAAGGCAAT
CTATGACCGTTTGTTTTCATGGATATTTGCAAAAATCAACGAAAAGATAA
AAATCTCTGACAAAGATTCAAGGGAAAATGATTTATCAAGCCATAATAAA
TTTTCTGTTATTGGGGTTTTGGATATTTACGGATTCGAGATTTTCGAGAA
CAACAGTTTTGAGCAGTTCTGTATCAATTATTGCAACGAAAAATTACAGC
AATTATTCATCCAGTTGGTTTTGAAACAAGAACAAGAAGAATACATGCGC
GAAGGTATCAAATGGACTAATATTGAATATTTCAACAACCAAGAAATATG
CGACATGGTCGAATTGCCAAGACTGGGAATATTTGCCATACTTGATGACA
ACTGCATCAAACCTGGCCGAGTTACTGATCAGATGTTCCTAGAAGATCTA
GACAGTAATCTACAGAAAAAAAGTTTTTACAAGAGTAGAAAATTGTTTCC
AACGGAGAAAACAATTGAACATGAAAGAGATTTCCGTATTGATCATTACG
CTGGACAAGTCACGTACAATGTCAACGGTTTCCTTGAAAAAAATAAAGAC
GCCTTCTTTGAAGATTTTAAGCGACTTTTGTATAATAGCAATAACAATAC
TGTCAAATCAATGTGGCTCGATGGTGCAAAAAGTGTATCAGAGACAACCC
AGCGACCGATGAGTGTGGGGGCCAATTTCAAAACATCCATTCAAAAATTA
GTGGAAAATTTAGCGAAAAAGATCCCCCATTACGTACGTTGCATCAAACC
AAATGGCATCAAATCACCCGGCCGACTTGACATAGAACTTGTTCAACATC
AGACCAGATATTTAGGTTTGATTGAAAATGTCAGAGTTCGTCGAGCTGGA
TTTGCCACGAGAATGGAGTATGCAAGATTTTTACAAAGATTTAAAATGTT
GTCAAAAAAAACTTGGCCTTCTTGGAATTCGAATCTAAAAGAAGGATCAA
AAGCAATAATAGACGACATGGGAATTTCAGAGGATGTACAATGGGGTCAT
ACGAAAATATTTATACGCAGCGCTCAGTCTATTTTCAAGCTTGAACAAGC
AAGGACTTGTGCCGTTGATTGGATCGTTGTGATTTTGCAGAAGCGTTGGC
GAGGAGTACTGGCACGAAGACTGGCAAAACGAATACGGGCTGCCAATAAA
ATAATTAACGCTTATAGGCATTACAAAATCCGCAGTTATATCGTCAAGTT
CGTGGCTAACTTCAGCTCATTAAAATCAAGATCAGACTATGGAAAAGAAC
TGTCATGGCCTCAATATAGGGTTCCAAAACCATGTATTGGTTTGGAGGCT
GAATTGAAGCGTGTATTCAATAGATGGAGGGCCAACAAAGTACTTGGAAT
CTATCCAAAAGCCAAATGGCCTGAGATCAGATTAAAATTAGTTGGAACTG
ACATTCTCTTGCAGAAAGGACGTTCAAAATTCAACATCGGTCGAGATTGG
AGAGGTGATTATTTGTGTCAGGCTTCAGATAATCCGACCAACAGTCTGGC
GTATGTCAACGCTCGTGACAAAATACGCGGCGATAGAAAGGTTTTATTTT
CAGGATTTGCTAGCAAATTGAACAAAAAGGGTAAAACTGAAATTCGCGCT
ATCATCATAACGGATTTATATATTCATGAACTAACCCAGTGCAAAGCCTT
CAAGAAAGGTAGCTCGCCAGTTTTATTAGAGAAGATTAATTCTATCACAG
TGTCTAAAGGGACAGATCAAATTATAATTCTTCATTTCTTGGAATCTAAA
AGTGATTTAGTTTTTAATTTTCTGACATTCGGCGAAGACCGAATCCCGGA
ACTGGTGGCGAAACTGTTTCTCCATTGTAAAGATGCATTCAAAAAAGAGT
TGACTGTTGATGTGGTTGAGAACGACCTGAATTGCAAATTACGGAAGAAA
AAGTGTATATTGAGGATTACCAACGGAGTGACGTATTTCAGCCTCCAAAC
CGGCTGCGATGGATTCAAACCGGCCGTTACATTCAAATTGATATCGAAAA
ATTTATTTTCTGTTGAAAAATTTGTCGAACCCCCGAAAAAGAAATAGTTT
TACTATTTTTTATTGAAGTTTATATTGTAAACATTTGAAAAATATTTTTG
TTCGTGATAATTTGCATTAAGAATTTATAGATGAATGTCACTATTCGTAT
GATTGTTTTTATTTCTGTTTCATTACCAGAATTTCATTTTGCTTGCGACT
GTATGTCAATGTATTTGCCCTTTGACCTCCTCGATATGAGATGCGATTGG
AT
back to top

protein sequence of SMED30033662-orf-1

>SMED30033662-orf-1 ID=SMED30033662-orf-1|Name=SMED30033662-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1045bp
MAFFHEGPEFGIPDFILVDNIDLKSFVDNLEKRFIKNRIYTYIGEVLVAV
NPYKELNIYSNKEVNEYKGRELYESPPHIFAIADAAHKIVKRQNQDTCIV
ISGESGSGKTEASKIILRYIAQVTNISGQDEIERVKNLLLKSNCILECFG
NAKTNRNDNSSRFGKYMDIHFDFKGDPVGGIMNNYLLEKSRVVMQQVGER
SFHSFYQLLYGAPSDRLKEFGLQNDPDKYCYINQGNNSKVPSINDKARYQ
EVIEAINAIGFTNLESKTIWNLVAAILHLGTVQFELNESSSQNSSIQGAT
ESVKITDSSMPSIKHMAELFDVSEAGLTKALSERAVAARGDVIMKGHTME
LATYARDAFAKAIYDRLFSWIFAKINEKIKISDKDSRENDLSSHNKFSVI
GVLDIYGFEIFENNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYMREGIK
WTNIEYFNNQEICDMVELPRLGIFAILDDNCIKPGRVTDQMFLEDLDSNL
QKKSFYKSRKLFPTEKTIEHERDFRIDHYAGQVTYNVNGFLEKNKDAFFE
DFKRLLYNSNNNTVKSMWLDGAKSVSETTQRPMSVGANFKTSIQKLVENL
AKKIPHYVRCIKPNGIKSPGRLDIELVQHQTRYLGLIENVRVRRAGFATR
MEYARFLQRFKMLSKKTWPSWNSNLKEGSKAIIDDMGISEDVQWGHTKIF
IRSAQSIFKLEQARTCAVDWIVVILQKRWRGVLARRLAKRIRAANKIINA
YRHYKIRSYIVKFVANFSSLKSRSDYGKELSWPQYRVPKPCIGLEAELKR
VFNRWRANKVLGIYPKAKWPEIRLKLVGTDILLQKGRSKFNIGRDWRGDY
LCQASDNPTNSLAYVNARDKIRGDRKVLFSGFASKLNKKGKTEIRAIIIT
DLYIHELTQCKAFKKGSSPVLLEKINSITVSKGTDQIIILHFLESKSDLV
FNFLTFGEDRIPELVAKLFLHCKDAFKKELTVDVVENDLNCKLRKKKCIL
RITNGVTYFSLQTGCDGFKPAVTFKLISKNLFSVEKFVEPPKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001609Myosin_head_motor_dom
IPR027417P-loop_NTPase
IPR010926Myosin_TH1
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003779actin binding
GO:0005516calmodulin binding
GO:0030898actin-dependent ATPase activity
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
GO:0005768endosome
GO:0005829cytosol
GO:0005903brush border
GO:0016323basolateral plasma membrane
GO:0030424axon
GO:0031410cytoplasmic vesicle
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043209myelin sheath
GO:0097440apical dendrite
Vocabulary: biological process
TermDefinition
GO:0010923negative regulation of phosphatase activity
GO:0051641cellular localization
GO:0061502early endosome to recycling endosome transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 399..427
score: 77.5
coord: 96..121
score: 52.98
coord: 144..171
score: 71.91
coord: 452..480
score: 23.26
coord: 40..59
score: 60.11
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 4..716
e-value: 0.0
score: 1124.7
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 14..702
e-value: 3.6E-231
score: 769.1
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 10..715
score: 239.438
NoneNo IPR availableGENE3DG3DSA:3.30.70.3240coord: 647..717
e-value: 1.0E-8
score: 37.2
NoneNo IPR availableGENE3DG3DSA:1.10.10.820coord: 200..257
e-value: 2.2E-217
score: 725.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.530coord: 411..603
e-value: 2.2E-217
score: 725.2
NoneNo IPR availableGENE3DG3DSA:1.20.120.720coord: 258..378
e-value: 2.2E-217
score: 725.2
NoneNo IPR availablePANTHERPTHR13140:SF713MYOSIN-IAcoord: 10..1003
NoneNo IPR availablePANTHERPTHR13140MYOSINcoord: 10..1003
IPR010926Class I myosin tail homology domainPFAMPF06017Myosin_TH1coord: 834..997
e-value: 7.1E-28
score: 97.6
IPR010926Class I myosin tail homology domainPROSITEPS51757TH1coord: 835..1038
score: 18.76
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 14..646
e-value: 2.2E-217
score: 725.2
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 721..746
score: 7.272
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 8..763