Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30033655
Length (bp)1392
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30033655) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30033655) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033655

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033655SMESG000069980.1 dd_Smed_v4_9590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033655SMESG000069980.1 dd_Smed_v4_9590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033655SMESG000069980.1 dd_Smed_v4_9590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033655SMESG000069980.1 dd_Smed_v4_9590_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033655SMESG000069980.1 Contig51127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033655SMESG000069980.1 Contig51127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 281.567 bits (719), Expect = 2.556e-90
Identity = 138/344 (40.12%), Postives = 210/344 (61.05%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y SK+A +  F   +LLL W+GSIYK +  E  ++ VL   ISL++   LTG  +  FE    +C +    IPV  VLGFYVTLVV RW +QFV LPWPD L   +++ + G+ +  RL+RR++MRYV ++ +L + S+S+   + F T   +VE G +TT+E       ++   K++VP  W   L  KA+ E  + D+  +  L  E+N +R    +LF YDW+  PL+YTQ+  + +Y++F   + G+QF+      + H ++LY+P+F  L+F  Y GWLKVA+ LINPFG+D+DDFE +  I RN + S + VD+ H   P +++D+Y+    AR
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 280.026 bits (715), Expect = 1.318e-86
Identity = 138/344 (40.12%), Postives = 210/344 (61.05%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y SK+A +  F   +LLL W+GSIYK +  E  ++ VL   ISL++  L TG  +  FE    +C +    IPV  VLGFYVTLVV RW +QFV LPWPD L   +++ + G+ +  RL+RR++MRYV ++ +L + S+S+   + F T   +VE G +TT+E       ++   K++VP  W   L  KA+ E  + D+  +  L  E+N +R    +LF YDW+  PL+YTQ+  + +Y++F   + G+QF+      + H ++LY+P+F  L+F  Y GWLKVA+ LINPFG+D+DDFE +  I RN + S + VD+ H   P +++D+Y+    AR
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 271.166 bits (692), Expect = 8.530e-85
Identity = 139/344 (40.41%), Postives = 205/344 (59.59%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++    AL +   + LT   +  FE    +C +    IPV  VLGFYVTLVV RW  Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 271.166 bits (692), Expect = 8.530e-85
Identity = 139/344 (40.41%), Postives = 205/344 (59.59%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++    AL +   + LT   +  FE    +C +    IPV  VLGFYVTLVV RW  Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 271.166 bits (692), Expect = 8.530e-85
Identity = 139/344 (40.41%), Postives = 205/344 (59.59%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++    AL +   + LT   +  FE    +C +    IPV  VLGFYVTLVV RW  Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-4 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17205])

HSP 1 Score: 236.113 bits (601), Expect = 2.078e-71
Identity = 119/350 (34.00%), Postives = 214/350 (61.14%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTT--QSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDS 1074
            MTV+Y   +ATS  F   K+LL WKGS++K+I  EL I+++  +++S+++   L    R +FE  C+F    + FIPV  +LGFYV++V  RWT  F  + W D+ A+ +  +I G  +  RLIRR+ +RY+IV+Q++ +  +S   +R F T + L+  GLLT +EL+  +   +  +K++ PI W   LV  A+ E  + D+     L +++ EFR ++  L  +D +  PL+YTQ+  + + +YF+ ++FG+QF+ +      +   +++Y P+  +L+ +  +GWLKV++ ++NP G+D++DFE + II RN +  +  VDQ + + P L++D ++  +  + +D+
Sbjct:    1 MTVAYSLDVATSGLFTQIKVLLRWKGSVWKSIWSELLIWLLCYSILSVIYRILLNKAQREVFEQLCTFFDTFSVFIPVTFMLGFYVSIVYNRWTKVFDNVGWIDTSALTIAQYIRGTSEKARLIRRNCVRYMIVAQVMVFRDVSPAIRRRFPTIKHLIGAGLLTEDELTEFDAITSPQSKYWQPIQWLFSLVTVAKDEGLIADSYLYVDLIDKMREFRTKILNLVIFDMVPIPLVYTQVVNLAVRTYFVLALFGRQFLENNNNIPGAKWKIDIYFPIMTSLQIVFIVGWLKVSEVMLNPLGEDDEDFETNWIIERNLQVGYAVVDQAYGRYPTLKRDPFWEDETPQTMDT 350          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 233.032 bits (593), Expect = 2.524e-71
Identity = 111/337 (32.94%), Postives = 199/337 (59.05%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMY 1041
            ++ +Y   +ATS S  + +++  W+GS+++ +  EL ++I   +L+S+++ F LT   + IFE F  +C    G++P+  VLGF+  ++++RW   + +L   D++A++V+ ++ G  D  R IRR+I+RY ++SQ L +  I    +R F T + + + G++   EL +    ++   K++V   WA EL+  A+ EK +  +     +A E+++FR  L  +  YDW+  PL+Y Q+  + +++YF   IF +QF I     +   ++LY+P    +EFI YMGWLKVA  L+NPFG+D DDF+ + +I RN      +VD  + Q P ++ D++
Sbjct:   44 LSYNYNYDLATSKSLMIVRMIFKWRGSLWQAVYKELIVWICAYSLVSVIYRFALTRSQKDIFERFGEYCDARMGYLPLNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRGTDDRARQIRRNIIRYCVISQCLVFRDIHVGVRRRFPTLEAVAQAGIMLPHELEKFNSIKSRYQKYWVSFNWALELLNVAKTEKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGLTSVDDAYDQLPEVKPDVF 380          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-21 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q9NA59])

HSP 1 Score: 230.335 bits (586), Expect = 6.810e-71
Identity = 119/337 (35.31%), Postives = 202/337 (59.94%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVW--LLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQD 1035
            MTV+Y  ++++ NSF   KLL+TW+GSI+K++R EL ++++  A++ +++ Y +T   +  FE            IP+  +LGF+VT+VV RW   F  + + +++A+ V T + G     +++RR+I+RY+++SQ+L    IS + +R F T ++LV  G L  +EL R+ K +T  NK+++P  WA +LV KA  E   +D+ +    +L N + EFR  + +L  YDW+  P+ Y Q+  + +  YFI  +  +Q+++      A  +   VP+   L+F+ ++GW+KVA+ L+NP G+D+DDFE + +I RN       VD  H  CPPL+ D
Sbjct:    1 MTVNYNQEVSSVNSFTFVKLLMTWRGSIWKSVRWELTMWVIAFAVVQMVYRYLMTEDQQKFFEYSAIHLNVRLIHIPLTFMLGFFVTIVVDRWRSVFTNIGFIENVALSVGTLVAGTDHAAKVLRRTIIRYLVLSQVLVLRDISMRVRRRFPTMESLVSGGFLYRDELERMYKCDTMYNKYWLPTHWANQLVHKAMFETKNVDSVQSMNSVLMN-IKEFRQSMEMLTKYDWVPIPIAYPQVVFLAVRVYFIICLVSRQYLLSAPPTEAQSI---VPIMTILQFVFFVGWMKVAEALLNPLGEDDDDFECNWLIDRNMSTGIEIVDTCHDSCPPLKLD 333          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-7 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q18303])

HSP 1 Score: 226.868 bits (577), Expect = 5.830e-68
Identity = 114/338 (33.73%), Postives = 198/338 (58.58%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT +Y   +ATS    + KL+  WKGS++K I ++L ++    A IS+++ Y L    +  FE F  FC +   +IP+  +LGF+VT V+ RW  QF  L   D++A++ + ++ G  +  R++RRSI+R  ++SQ + +  I    ++ F T +T+V  G++T+ EL +  + E+   K+++   W   L+ +A++E  +        +A E+  FR  L +++ YDW+  PL+Y Q+  + ++ Y++  +  +QF+I+    +   ++L VP    +EFI YMGWLKVA  L+NPFG+DEDDF+ + +I RN   +   VD  H   P L++DM++
Sbjct:    1 MTYNYHYDLATSQRKVILKLIFKWKGSLWKAIYLDLIVWCFCYAFISVIYRYALDRSQQDTFERFMQFCNRRLDYIPINFMLGFFVTTVINRWMTQFANLGMIDNIALFTSMYLSGNDERGRILRRSIVRMCVMSQTMVFRDIHIGVRKRFPTLETMVAAGIMTSSELKKYNEVESRYAKYWLGFNWTFNLLNEARREGRIESAYTQNAIAEEIRTFRSGLSLIWTYDWVPIPLMYPQLVFMAIHCYYLVCLVSRQFVINSDAVNTTEIDLGVPFMTIIEFIFYMGWLKVAMDLLNPFGEDEDDFDCNFLIDRNLTVAMGIVDDSHDDGPILEKDMFW 338          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-24 (Bestrophin homolog 24 [Source:UniProtKB/Swiss-Prot;Acc:P34672])

HSP 1 Score: 225.713 bits (574), Expect = 8.181e-67
Identity = 108/341 (31.67%), Postives = 205/341 (60.12%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQK 1053
            MT++Y   ++TS  + +FKLLL W+GSI+K + +EL +++VL  ++S+++   L    +  FE    +C     +IP+  +LGF+VT VV RWT  +  + + D++ +    ++ G  +  R+ RR+I+RY  ++Q+L +  IS + +R F T  T+V  G +   E  R ++ +   +K++VP  WA  L  +A+K+  +  +    ++ +E+ +FR  L  +  YDW+  P++Y Q+  + +++YF+  +  +Q+++     +   ++LY P+   L+FI YMGW+KVA+ ++NPFG+D+DDFE + +I RN     + VDQ + + P L++D ++ ++
Sbjct:    1 MTINYNLAVSTSKPWTLFKLLLKWRGSIWKAVILELAVWLVLYGILSVIYRTALNPGQQRTFERIVQYCDSRLSYIPLNFMLGFFVTAVVNRWTYLYQIIGFIDNIGLMAAEYVRGRTEQARMYRRNIVRYCELAQVLVFRDISMRTRRRFPTLDTVVAAGFMMPHEKDRFDEIQYKYSKYWVPFQWAFSLTYEARKKGLIESDYYQVVVQDEIKKFRTGLAWICNYDWVPIPIMYPQLVCLAVHTYFLVCLLARQYVVSEHADNKTEIDLYFPIMSTLQFIFYMGWMKVAEAMLNPFGEDDDDFECNALIDRNITMVLMMVDQGYDRAPDLKRDDFWDEE 341          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best4 (gene:FBgn0036491 transcript:FBtr0113172)

HSP 1 Score: 276.559 bits (706), Expect = 4.104e-87
Identity = 134/342 (39.18%), Postives = 215/342 (62.87%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVF-KLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYY-RLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFE---TTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y S+++TS+    F  LL+ W+GSIYK I ++L ++  L  L+++ +  L     +  FE+  S+C K    IP+  VLGF+V +V+ RW DQ+ T+PWPD +A+ ++T I G+ D  R++RR+I+RYV + Q++ ++ IS + KR F T   ++E G L   E   +E  +    +  KH++PI WA  +V++A++E  + D+  V  + +ELN+ R     L  YDWI+ PL+YTQ+  +  YS+F+FS+ G+Q+    + +    +  + P+   L+F  YMGWLKVA+ LINPFG+D+DDFE++ II RN   S+  VD+ HQ+ P L +D Y+
Sbjct:    1 MTVTYTSRVSTSSVLSNFLGLLVRWRGSIYKLIWLDLIVFFGLYCLLAITYRLLVNEEGKRFFEAIMSYCEKNGSLIPLSFVLGFFVRIVMNRWWDQYTTIPWPDGIAILISTSIHGSDDRARVMRRTILRYVCLCQVIVFTMISPRVKRRFPTYTQIIEAGFLLENEKKIIEAMDQAFPSYPKHWMPIVWAASIVMRARRENKIRDDYAVKTIIDELNQLRGNCGFLLYYDWISVPLVYTQVVTVATYSFFLFSVLGQQWNESHSDEDGTRIRRWFPILTVLQFFFYMGWLKVAETLINPFGEDDDDFELNWIIDRNLTVSYCIVDEMHQEHPELVKDQYW 342          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best3 (gene:FBgn0036492 transcript:FBtr0075618)

HSP 1 Score: 270.781 bits (691), Expect = 8.322e-85
Identity = 138/342 (40.35%), Postives = 214/342 (62.57%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVF-KLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKH---FVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTVSY +++AT + F  F KLL+ W+ SIYK I ++L  ++     +++++ Y L    + +FE    +C   +  IP+  VLGFYV ++++RW +Q++T+PWPD LAVYV+  + G  +  RL+RR+IMRYV ++  +  S IS   KR F T   L+E GLL   E + ++  +    KH   ++PI WA  +V +A+KE  + D+  +  + +ELN+FR    +L  YD I+ PL+YTQ+  + +YSYF+ SIFG Q+I        + ++ Y P+F  LEF  +MGWLKVA+ LI PFGDD+DDFE++ +I RN + S++ VD+ H   P L +D Y+
Sbjct:    1 MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVIYRYALRDVDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQDEHGRLMRRTIMRYVCLALTMVLSMISPVIKRRFPTYDQLIEVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQLVRDQYW 342          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 266.159 bits (679), Expect = 4.068e-81
Identity = 132/345 (38.26%), Postives = 217/345 (62.90%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVF-KLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETT---SNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFI---IHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT++Y  ++AT   F  F KLLL W+GSIYK + ++L  ++ +   I++++ F L    +  FE+   +C      IP+  VLGFYV++V+ RW +Q+ ++PWPD +AV+V++ + G  +  R++RR+IMRYV +   +  +++S + K+ F     LVE GLL   E + +E         +KH++PI WA  ++ +A+KE  + D+  V  + +ELN+FR +  +L +YD I+ PL+YTQ+  + +YSYF+    G+Q+    + G T   + ++LY PVF  L+F  YMGWLKVA+ LINPFG+D+DDFE++ ++ RN + S++ VD+ H   P L +D Y+
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYW 345          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 266.159 bits (679), Expect = 5.855e-81
Identity = 132/345 (38.26%), Postives = 217/345 (62.90%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVF-KLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETT---SNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFI---IHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT++Y  ++AT   F  F KLLL W+GSIYK + ++L  ++ +   I++++ F L    +  FE+   +C      IP+  VLGFYV++V+ RW +Q+ ++PWPD +AV+V++ + G  +  R++RR+IMRYV +   +  +++S + K+ F     LVE GLL   E + +E         +KH++PI WA  ++ +A+KE  + D+  V  + +ELN+FR +  +L +YD I+ PL+YTQ+  + +YSYF+    G+Q+    + G T   + ++LY PVF  L+F  YMGWLKVA+ LINPFG+D+DDFE++ ++ RN + S++ VD+ H   P L +D Y+
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYW 345          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 265.388 bits (677), Expect = 1.660e-80
Identity = 132/345 (38.26%), Postives = 217/345 (62.90%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVF-KLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETT---SNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFI---IHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT++Y  ++AT   F  F KLLL W+GSIYK + ++L  ++ +   I++++ F L    +  FE+   +C      IP+  VLGFYV++V+ RW +Q+ ++PWPD +AV+V++ + G  +  R++RR+IMRYV +   +  +++S + K+ F     LVE GLL   E + +E         +KH++PI WA  ++ +A+KE  + D+  V  + +ELN+FR +  +L +YD I+ PL+YTQ+  + +YSYF+    G+Q+    + G T   + ++LY PVF  L+F  YMGWLKVA+ LINPFG+D+DDFE++ ++ RN + S++ VD+ H   P L +D Y+
Sbjct:    1 MTITYTGEVATCRGFGCFLKLLLRWRGSIYKLVWLDLLAFLTIYYAINMVYRFGLNPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERGRMMRRTIMRYVCLCLTMVLANVSPRVKKRFPGLNNLVEAGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVGNTTYLNKVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIVDEMHHDHPELLKDQYW 345          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 289.271 bits (739), Expect = 6.373e-94
Identity = 142/342 (41.52%), Postives = 213/342 (62.28%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKN 1056
            MTVSY  K+A +      KLL  WKGSIYK +  E  ++ +L   IS+L+   L    + IF      C K    IP+  VLGFYVT   QRW  Q+ + P PD+L + V+  + G  +  RL+RR++MRY  +S +L   SIS++ ++ F+T + +VE G +TT+EL +L    +  NK+++P+AW   L  +A+KE  + D+  + LL +ELN +R +  +LF YDWI+ PL+YTQ+  + +YS+F FS+ G+QF+      S   ++LY+P+F  LEF  Y GWLKV + +INPFG+D+DDFE +Q+I RN + S + VD  HQ  PPL++D Y++ K 
Sbjct:    1 MTVSYTLKVANAKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAGFMTTDELRKLNHLYSDFNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFV--KPASSEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWVDKG 340          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 281.567 bits (719), Expect = 2.746e-87
Identity = 140/338 (41.42%), Postives = 213/338 (63.02%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y  ++A +     ++LLL WKGSIYK +  EL I+ V+  +IS+ +   LT   R +FE    +C +    IPV  VLGFYVTLVV RW  QF ++PWPD L+  V+  + GA +  RLIRRS+MRY  +S IL Y S+S+   + F T   LV+ GL+T EEL +L++  +  NK +VP  W   L ++A+ E  + ++  +  + NELN  R +   L+ YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H ++ Y+PVF  L+F  Y+GWLKVA+ LINPFG+D+DDFE + ++ RN + S ++VD+ +   P +++D Y+
Sbjct:    1 MTVTYSRRVADARLGTFYRLLLRWKGSIYKLLYRELLIFTVMYCIISITYRCVLTEEQRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRGADEGARLIRRSLMRYANLSGILIYRSVSTAVYKRFPTMSHLVQAGLMTAEELRQLQELPSPHNKFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYW 338          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 262.307 bits (669), Expect = 6.525e-84
Identity = 131/316 (41.46%), Postives = 197/316 (62.34%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFE 978
            MTVSY  K+A +      KLL  WKGSIYK +  E  ++ +L   IS+L+   L    + IF      C K    IP+  VLGFYVT   QRW  Q+ + P PD+L + V+  + G  +  RL+RR++MRY  +S +L   SIS++ ++ F+T + +VE G +TT+EL +L    +  NK+++P+AW   L  +A+KE  + D+  + LL +ELN +R +  +LF YDWI+ PL+YTQ+  + +YS+F FS+ G+QF+      S   ++LY+P+F  LEF  Y GWLKV + +INPFG+D+DDFE +Q+I RN +
Sbjct:    1 MTVSYTLKVANAKFGGFSKLLFRWKGSIYKLLYREFLVFCLLYTFISILYRCVLNNNQQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFTTLEDIVEAGFMTTDELRKLNHLYSDFNKYWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFTFSLIGRQFV--KPASSEEHLDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQ 314          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 264.233 bits (674), Expect = 2.958e-83
Identity = 133/346 (38.44%), Postives = 203/346 (58.67%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLG--FYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      KLLL WKGSIYK +  E   +  +   IS+ + +FL    +  FE    +C      IP+  VLG  FYVTLVV RW  Q+ ++P PD +   ++  + G+ +  RL+RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   +  NK+++P  W   L   A+ E  + D+    LL  ELN FR +  +LF YD I+ PL+YTQ+  + +YS+F+  + G+QF+  G     H ++LYVP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +   P +++D Y+   N R
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWKGSIYKVLYKEFLAFFAMYTAISITYRFFLVDGQKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQGSDERGRLLRRTLMRYSSLSALLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFESLHSPYNKYWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMYGDLPMMERDRYWNDSNPR 346          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 149.828 bits (377), Expect = 7.770e-41
Identity = 68/177 (38.42%), Postives = 114/177 (64.41%), Query Frame = 1
Query:  514 LLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            L+T EEL +L++  +  NK +VP  W   L ++A+ E  + ++  +  + NELN  R +   L+ YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H ++ Y+PVF  L+F  Y+GWLKVA+ LINPFG+D+DDFE + ++ RN + S ++VD+ +   P +++D Y+
Sbjct:    2 LMTAEELRQLQELPSPHNKFWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYW 178          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 275.404 bits (703), Expect = 4.768e-88
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTG-YYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y +++A +      +LLL W+GSIYK +  E  I+I    +IS+ + FL     R+ FE    +C      IPV  VLGFYVTLVV RW  Q+ ++PWPD L   V++ + G  +  R++RR++MRY  ++ +L   S+S+     F T Q +V  G +T  E S+ +   ++ NK +VP  W   L V A+ E  + DN  + L+  ELN  R +   L+ YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+LYVPVF  L+F  Y GWLKVA+ LINPFG D+DDFE + +I RN + S + VD+ HQ  PPL++D+Y+
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYW 338          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 275.018 bits (702), Expect = 6.558e-88
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTG-YYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y +++A +      +LLL W+GSIYK +  E  I+I    +IS+ + FL     R+ FE    +C      IPV  VLGFYVTLVV RW  Q+ ++PWPD L   V++ + G  +  R++RR++MRY  ++ +L   S+S+     F T Q +V  G +T  E S+ +   ++ NK +VP  W   L V A+ E  + DN  + L+  ELN  R +   L+ YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+LYVPVF  L+F  Y GWLKVA+ LINPFG D+DDFE + +I RN + S + VD+ HQ  PPL++D+Y+
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYW 338          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: cyp2b6 (cytochrome P450 family 2 subfamily B member 6 [Source:Xenbase;Acc:XB-GENE-5779150])

HSP 1 Score: 278.485 bits (711), Expect = 1.334e-87
Identity = 138/343 (40.23%), Postives = 213/343 (62.10%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNA 1059
            MTVSY  K+A ++    FKLL  WKGSIYK +  E  ++  L A++S+ +   L    +  F     +C + T  IPV  VLGFYVTL+V RW  Q+  +P PD L   V++ + G  +  RL+RR++MRY  +S +L   S+S++  + F T + +VE G +T EEL + E   +  NK+++P  W   L  +A+++  + D+  + LL +ELN++R +  +LF YDWI+ PL+YTQ+  I +YS+F   I G+QF+     +    ++LYVP+F  L+F  Y GWLKVAQ +INPFG+D+DDFE +++I RN + S ++VD  +Q  PPL++D Y+  + A
Sbjct:    1 MTVSYTLKVANASFGCFFKLLFRWKGSIYKLLYKEFIVFCCLYAMLSVTYRCLLNEKQKSEFAQLARYCNQYTDLIPVSFVLGFYVTLIVNRWWAQYTNIPLPDQLMCVVSSNVHGGDERGRLLRRTMMRYANLSSVLILRSVSTRVLKRFPTMEHIVEAGFMTREELKKYECLFSDYNKYWIPCVWFTNLAAQARRDGRVRDDVALKLLMDELNKYRAKCSMLFHYDWISVPLVYTQVVTIAVYSFFGVCIIGRQFLEPELEEEKPNIDLYVPIFTLLQFFFYSGWLKVAQQIINPFGEDDDDFETNRLIDRNLQVSLLSVDDMYQNLPPLEKDKYWDDQTA 343          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 274.633 bits (701), Expect = 2.251e-87
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTG-YYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y +++A +      +LLL W+GSIYK +  E  I+I    +IS+ + FL     R+ FE    +C      IPV  VLGFYVTLVV RW  Q+ ++PWPD L   V++ + G  +  R++RR++MRY  ++ +L   S+S+     F T Q +V  G +T  E S+ +   ++ NK +VP  W   L V A+ E  + DN  + L+  ELN  R +   L+ YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+LYVPVF  L+F  Y GWLKVA+ LINPFG D+DDFE + +I RN + S + VD+ HQ  PPL++D+Y+
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYW 338          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 275.404 bits (703), Expect = 3.696e-87
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTG-YYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y +++A +      +LLL W+GSIYK +  E  I+I    +IS+ + FL     R+ FE    +C      IPV  VLGFYVTLVV RW  Q+ ++PWPD L   V++ + G  +  R++RR++MRY  ++ +L   S+S+     F T Q +V  G +T  E S+ +   ++ NK +VP  W   L V A+ E  + DN  + L+  ELN  R +   L+ YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+LYVPVF  L+F  Y GWLKVA+ LINPFG D+DDFE + +I RN + S + VD+ HQ  PPL++D+Y+
Sbjct:    1 MTVTYSNRVADARLGTFSRLLLRWRGSIYKLLYREFLIFISCYFIISVTYRFLLNEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERGRMLRRTLMRYANLTGLLILRSVSTAVYMRFPTLQHVVNAGFMTPTERSKFDGLVSSHNKFWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPGHDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVSLLAVDEMHQDVPPLEKDIYW 338          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 271.937 bits (694), Expect = 1.834e-86
Identity = 141/345 (40.87%), Postives = 203/345 (58.84%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYYR--------LIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT++Y +K+A +       LLL W+GSIYK +  E  ++I        L+Y + G YR        L+FE    +C      IP+  VLGFYVTLVV RW  Q+  LPWPD L + V++F+ G  +  RL+RR+++RY I+ Q+L   SIS+   + F T   LV  G +T  E  +L+K     N  +VP  W   L +KA     + D   +  L NE+   R +   L+AYDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+L VPVF  L+F+ YMGWLKVA+ LINPFG+D+DDFE + II RN + S ++VD  HQ  PP+++DMY+
Sbjct:    1 MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFI-------FLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYW 338          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best3 (bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298])

HSP 1 Score: 277.715 bits (709), Expect = 6.964e-86
Identity = 143/364 (39.29%), Postives = 216/364 (59.34%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR------LIDSC-NRFIGGSI 1101
            MTV+Y SK+A +  F   +LLL W+GSIYK +  E  ++ VL   ISL++  L TG  +  FE    +C +    IPV  VLGFYVTLVV RW +QFV LPWPD L + +++ + G+    RL+RR++MRYV ++ +L + S+S+   + F T   +VE G +T +E    +  ++   K++VP  W   L  KA+ E  + D+  +  L  E+N +R    +LF YDW+  PL+YTQ+  + +Y++F   + G+QF+        H ++LYVP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE +  I RN + S + VD+ H   P +++D+Y+    AR        D C   F+G +I
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTI 364          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 271.166 bits (692), Expect = 4.140e-85
Identity = 139/344 (40.41%), Postives = 206/344 (59.88%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++ L  AL +   + L    +  FE    +C +    IPV  VLGFYVTLVV RW +Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 271.166 bits (692), Expect = 4.140e-85
Identity = 139/344 (40.41%), Postives = 206/344 (59.88%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++ L  AL +   + L    +  FE    +C +    IPV  VLGFYVTLVV RW +Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 271.166 bits (692), Expect = 4.140e-85
Identity = 139/344 (40.41%), Postives = 206/344 (59.88%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++ L  AL +   + L    +  FE    +C +    IPV  VLGFYVTLVV RW +Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8N1M1|BEST3_HUMAN (Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 6.328e-86
Identity = 138/344 (40.12%), Postives = 210/344 (61.05%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y SK+A +  F   +LLL W+GSIYK +  E  ++ VL   ISL++  L TG  +  FE    +C +    IPV  VLGFYVTLVV RW +QFV LPWPD L   +++ + G+ +  RL+RR++MRYV ++ +L + S+S+   + F T   +VE G +TT+E       ++   K++VP  W   L  KA+ E  + D+  +  L  E+N +R    +LF YDW+  PL+YTQ+  + +Y++F   + G+QF+      + H ++LY+P+F  L+F  Y GWLKVA+ LINPFG+D+DDFE +  I RN + S + VD+ H   P +++D+Y+    AR
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGVQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6H1V1|BEST3_MOUSE (Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.871e-85
Identity = 143/364 (39.29%), Postives = 216/364 (59.34%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR------LIDSC-NRFIGGSI 1101
            MTV+Y SK+A +  F   +LLL W+GSIYK +  E  ++ VL   ISL++  L TG  +  FE    +C +    IPV  VLGFYVTLVV RW +QFV LPWPD L + +++ + G+    RL+RR++MRYV ++ +L + S+S+   + F T   +VE G +T +E    +  ++   K++VP  W   L  KA+ E  + D+  +  L  E+N +R    +LF YDW+  PL+YTQ+  + +Y++F   + G+QF+        H ++LYVP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE +  I RN + S + VD+ H   P +++D+Y+    AR        D C   F+G +I
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFLGSTI 364          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.194e-84
Identity = 139/344 (40.41%), Postives = 206/344 (59.88%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++ L  AL +   + L    +  FE    +C +    IPV  VLGFYVTLVV RW +Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU1|BEST2_HUMAN (Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 4.096e-84
Identity = 139/344 (40.41%), Postives = 205/344 (59.59%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVL-NALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      +LLL W+GSIYK +  EL  ++    AL +   + LT   +  FE    +C +    IPV  VLGFYVTLVV RW  Q++ +P PD+L   V   + G  D  RL RR++MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   ++ NK++VP  W   L  +A++E  + DN  + LL  ELN FR +  +LF YDWI+ PL+YTQ+  I +YSYF+  + G+QF+        H ++L VP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +     L++D+Y+    AR
Sbjct:    1 MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEAR 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|O88870|BEST1_MOUSE (Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=2 SV=3)

HSP 1 Score: 270.396 bits (690), Expect = 1.726e-83
Identity = 139/338 (41.12%), Postives = 203/338 (60.06%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLN-ALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT++Y +K+A +       LLL W+GSIYK +  E  ++I L  ++  L    L+   +L+FE    +C      IP+  VLGFYVTLVV RW  Q+  LPWPD L + V++F+ G  +  RL+RR+++RY I+ Q+L   SIS+   + F T   LV  G +T  E  +L+K     N  +VP  W   L +KA     + D   +  L NE+   R +   L+AYDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+L VPVF  L+F+ YMGWLKVA+ LINPFG+D+DDFE + II RN + S ++VD  HQ  PP+++DMY+
Sbjct:    1 MTITYTNKVANARLGSFSSLLLCWRGSIYKLLYGEFLVFIFLYYSIRGLYRMVLSSDQQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEGRLLRRTLIRYAILGQVLILRSISTSVYKRFPTLHHLVLAGFMTHGEHKQLQKLGLPHNTFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPGHEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMYW 338          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A504Z0E6 (Bestrophin homolog OS=Fasciola gigantica OX=46835 GN=FGIG_05512 PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 5.002e-95
Identity = 154/369 (41.73%), Postives = 229/369 (62.06%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNK-HFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY------LQKNARLIDSCNRFIGGSIGKANK 1116
            MTVSY S +AT+      +LL  WKGS+Y+ I  EL I+  + +++SL + FL TG  +  FE  C +C +    IPV  VLGFYV+LVV RW +QF++LPWPD LA+ +  +  G  + P  IRR++MRY  ++  +   +ISS+A+  F T + LV  GL+T EEL  L K E T  + +FVP+ WA  +V +A++E ++  ++ V +L  E+  FR +L  +FAYDWINPPL+YTQ+A I +YSYF+  +F  Q++        + +++YVPVFG L F  Y+GWLKVA+ LINPFG+D DDFE++ +I RN   S++ VD+ H + P L +D ++      L K+    +       G +G  +K
Sbjct:    1 MTVSYASIVATTTYSTFLRLLFLWKGSVYRLIWFELLIFTGIYSILSLTYRFLLTGMMKTYFEWLCLYCNQHNEMIPVPFVLGFYVSLVVTRWWEQFLSLPWPDQLALQMTAYCHGNDERPTRIRRTVMRYTNLAYCIALRAISSRARLRFPTAEHLVSAGLMTEEELDVLVKTEPTEYQLYFVPLVWALNIVSQARQEGHIRFDRAVEILTEEITSFRGKLGTIFAYDWINPPLVYTQMATIVVYSYFLACLFAWQYLDLSKGYPGYDIDIYVPVFGLLRFFFYIGWLKVAESLINPFGEDADDFEIEYLIERNLNVSYLIVDEMHHEHPELVRDAFWGTADFTLSKSNDFAEGDADTTTGGVGDGDK 369          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A4E0RID6 (Bestrophin homolog OS=Fasciola hepatica OX=6192 GN=D915_008570 PE=3 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.335e-94
Identity = 154/369 (41.73%), Postives = 228/369 (61.79%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNK-HFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY------LQKNARLIDSCNRFIGGSIGKANK 1116
            MTVSY S +AT+      +LL  WKGS+Y+ I  EL I+  + +++SL + FL TG  +  FE  C +C +    IPV  VLGFYV+LVV RW +QF++LPWPD LA+ +  +  G  + P  IRR++MRY  ++  +   +ISS+A+  F T + LV  GL+T EEL  L K E T  + +FVP+ WA  +V +A++E ++  ++ V +L  E+  FR +L  +FAYDWINPPL+YTQ+A I +YSYF+  +F  Q++        + +++YVPVFG L F  Y+GWLKVA+ LINPFG+D DDFE++ +I RN   S++ VD+ H + P L +D ++      L K+    +       G  G  +K
Sbjct:    1 MTVSYASIVATTTYSTFLRLLFLWKGSVYRLIWFELLIFTGIYSILSLTYRFLLTGMMKTYFEWLCLYCNQHNEMIPVPFVLGFYVSLVVTRWWEQFLSLPWPDQLALQMTAYCHGNDERPTRIRRTVMRYTNLAYCIALRAISSRARLRFPTAEHLVSAGLMTEEELDVLVKTEPTEYQLYFVPLVWALNIVSQARQEGHIRFDRAVEILTEEITTFRGKLGTIFAYDWINPPLVYTQMATIVVYSYFLACLFAWQYLDLSKGYPGYDIDIYVPVFGLLRFFFYIGWLKVAESLINPFGEDADDFEIEYLIERNLNVSYLIVDEMHHEHPELVRDAFWGTADFTLSKSNDFAEGDAETTTGGAGDGDK 369          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A553Q2K9 (Bestrophin homolog OS=Danionella translucida OX=623744 GN=DNTS_026057 PE=3 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 2.321e-93
Identity = 144/342 (42.11%), Postives = 215/342 (62.87%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKN 1056
            MTVSY  K+A +      KLL  W+GSIYK +  E  ++  L ALIS+L+   L    + +FE     C K    IP+  VLGFYVT   QRW  Q+ + P PD+L + ++  + G  +  RL+RR++MRY  +S +L   SIS++ ++ F +   +VE G +TTEEL RL    +  NK+++P+AW   L  +A+KE  + D+  + LL +ELN +R +  +LF YDWI+ PL+YTQ+  + +YS+F+FS+ G+QF+    ++    ++LYVPVF  LEF  Y GWLKV + +INPFG+D+DDFE +Q+I RN + S + VD  HQ  PPL++D Y++ K 
Sbjct:   16 MTVSYTLKVANATFGGFSKLLFRWRGSIYKLLYREFLVFCCLYALISVLYRCVLNASQQEMFEQLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVISGNVHGTDERGRLLRRTLMRYANLSSVLILRSISTRVRKRFPSLDDIVEAGFMTTEELKRLNHLCSDFNKYWMPLAWFSNLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSFFMFSLVGRQFLKGSPSEEHAHLDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWMDKG 357          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A3Q0KLS6 (Bestrophin homolog OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 3.425e-93
Identity = 144/362 (39.78%), Postives = 223/362 (61.60%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTS-NKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNRFIGGSIGKAN 1113
            MTV+Y S +AT+  +   +LL  WKGS+Y+ +  E  +++ + +++S+ + F L+   +  FE  C +C +    +PV  VLGFYV+L+VQRW +QF+ LPWPD LA+++  F  G  + P  IRR+I+RY+ +S  +   +ISS+A+  F T + LV  GL+T EEL      + +    +FVP+ WA ++V KA++E Y+  ++ V +L NE+  FR +L  +FAYDW+NPPL+YTQ   I +Y YF   +   Q++        H +++YVP+FG L F  Y+GWLKVA+ LINPFG+D DDFE++ +I RN + S++ VD  H + P L +D Y+   +  L D       G   +AN
Sbjct:    1 MTVTYSSVVATAKYWTFIRLLFMWKGSVYRLVWFEFLVFVGIYSVLSVTYRFILSATLKRYFELLCIYCGRYNETVPVAFVLGFYVSLIVQRWWEQFLALPWPDRLALFITAFCHGNAERPTRIRRNIVRYINLSYCIALRAISSRARLRFPTEEHLVSAGLMTQEELDIYRSTQPSEYTLYFVPLVWALDMVTKAREEGYIRFDRAVEILTNEITSFRGKLGTIFAYDWVNPPLVYTQTVTIAVYGYFGTCLLAWQYLDPSKKYEGHDVDIYVPIFGLLRFFFYIGWLKVAESLINPFGEDVDDFEIEYLIERNLQVSYLIVDGMHHEHPDLVRDAYWNTTDIILPDWTKMTTEGGAAEAN 362          
BLAST of Bestrophin homolog vs. TrEMBL
Match: C1L441 (Bestrophin homolog OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 6.430e-92
Identity = 142/362 (39.23%), Postives = 224/362 (61.88%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTS-NKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNRFIGGSIGKAN 1113
            MTV+Y S +AT+  +   +LL  WKGS+Y+ +  E  +++ + +++S+ + F L+   +  FE  C +C +    +PV  VLGFYV+L+VQRW +QF++LPWPD LA+++  F  G  + P  IRR+I+RY+ +S  +   +ISS+A+  F T + LV  GL+T EEL      + +    +FVP+ WA ++V KA++E Y+  ++ V +L +E+  FR +L  +FAYDW+NPPL+YTQ   I +Y YF   +   Q++        H +++YVP+FG L F  Y+GWLKVA+ LINPFG+D DDFE++ +I RN + S++ VD  H + P L +D ++   +  L D       G   +AN
Sbjct:    1 MTVTYSSIVATAKYWTFIRLLFMWKGSVYRLVWFEFLVFVGIYSVLSVTYRFILSATLKRYFEQLCIYCGRYNETVPVAFVLGFYVSLIVQRWWEQFLSLPWPDRLALFITAFCHGNAERPTRIRRNIVRYINLSYCIALRAISSRARLRFPTEEHLVSAGLMTQEELDIYRSTQPSQYTLYFVPLVWALDMVTKAREEGYIHFDRAVEILTDEITSFRSKLGTIFAYDWVNPPLVYTQTVTIAVYGYFGTCLLAWQYLDPSKKYEGHEIDIYVPIFGLLRFFFYIGWLKVAESLINPFGEDVDDFEIEYLIERNLQVSYLIVDGMHHEHPDLVRDAFWNTTDIVLPDWTKMATDGGSVEAN 362          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 279.641 bits (714), Expect = 2.904e-86
Identity = 142/338 (42.01%), Postives = 212/338 (62.72%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y  ++A +       LLL WKGSIYK +  EL I+ VL   IS+L+ FL     R +FE    +C +    IPV  VLGFYVTLVV RW  QF ++PWPD LA  V  ++ GA +  RLIRRS++RY  +S +L Y SIS+   + F T + LV+ GL+T EE  +L+   +  NK +VP  W   L ++A+ E  + ++  +  + NELN  R +   L++YDWI+ PL+YTQ+  + +YS+F+  + G+QF+      S H ++ Y+PVF  L+F  Y+GWLKVA+ LINPFG+D+DDFE + ++ RN + S ++VD+ +   P +++D Y+
Sbjct:    1 MTVTYSRRVADARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDLPSPHNKFWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYW 338          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 258.07 bits (658), Expect = 7.033e-82
Identity = 138/344 (40.12%), Postives = 208/344 (60.47%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQ-IAIITMYSYFIFSIFGKQFIIHGTTQSAH-GMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKN 1056
            MTVSY  ++A +      KLL  WKGSIYK +  E  ++  L +L SL++   LT   + +FE     C K    IP+  VL FYVT   QRW  Q+ + P PD+L + V+  + G+ +  RL+RR++MRY  +S +L   SIS++  + F T Q +V+   +T EE+  L+   +  NK+++P+ W   L  KA++E  + D+  + LL +ELN +R +  +LF YDWI+ PL+YTQ +  + +YS+F F + G+QF+           ++LYVPVF  LEF  Y GWLKV + +INPFG+D+DDFE +Q+I RN + S + VD  HQ  PPL++D Y+  K+
Sbjct:    1 MTVSYTLEVANARFAGFTKLLFRWKGSIYKLLYKEFLLFCFLYSLFSLIYRCVLTDGQQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGSDERGRLLRRTLMRYANLSSVLILRSISTRVHKRFPTLQHIVD-AFMTEEEMRTLDHLYSDFNKYWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVVTLAVYSFFAFCLIGRQFVKPERADELKVHVDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVSMLAVDDMHQNLPPLEKDKYWTDKS 342          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 266.159 bits (679), Expect = 9.417e-82
Identity = 131/344 (38.08%), Postives = 204/344 (59.30%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      KLLL W+GSIYK +  E+  + +L   IS+ + +FL    +  FE    +C      IP+  VLGFYVTL+V RW  Q+ ++P PDS+   ++  + G  +  RL+RR++MRY  ++ +L   S+S+   + F T   +VE G +T EE  + E   +  NK+++P  W   L   A+ E  + D+    LL  ELN+FR +  +LF YD I+ PL+YTQ+  + +YS+F+  + G+QF+        H ++LYVP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+     P +++D Y+   N R
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWRGSIYKVLYKEVLAFFILYTAISITYRFFLLDEQKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQGGDERGRLLRRTLMRYASLASLLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFESLHSPYNKYWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMFGDLPMMERDRYWNDSNPR 344          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 235.343 bits (599), Expect = 8.623e-70
Identity = 128/338 (37.87%), Postives = 193/338 (57.10%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFL-TGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y  ++A +       LLL WKGSIYK +  EL I+ VL   IS+L+ FL     R +FE    +C +    IPV  VLGFYVTLVV RW  QF ++PWPD LA  V  ++ GA +  RLIRRS++RY  +S +L Y SIS+   + F T + LV+ GL+T EE  +L+   +  NK +VP  W   L ++A+ E  + ++  +  + N                          +  + +YS+F+  + G+QF+      S H ++ Y+PVF  L+F  Y+GWLKVA+ LINPFG+D+DDFE + ++ RN + S ++VD+ +   P +++D Y+
Sbjct:    1 MTVTYSRRVADARLGTFSHLLLRWKGSIYKLLYRELLIFTVLYCTISVLYRFLLDNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEGARLIRRSLVRYANLSGVLIYRSISTAVYKRFPTIEHLVQAGLMTVEERRQLDDLPSPHNKFWVPCMWFVNLALRARTEGRINNDVALSAILN--------------------------VVTVAVYSFFLACLIGRQFLDPTQGYSGHDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVSLLSVDEMYDLVPLVERDKYW 312          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 157.918 bits (398), Expect = 8.869e-43
Identity = 103/344 (29.94%), Postives = 165/344 (47.97%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y SK+A +  F   +LLL W+GSIYK +  E   + +L +++SL++ + LT   R +FE    +C +    IPV  VLGF                  P+   ++ N            ++   ++Y I +  + +++++SKA++      ++  Q +LT  E++R                                   R W               LF YDW+  PL+YTQ+  + +Y++F  SI G+QF+        H ++LYVPVF  L+F  Y GWLKVA+ LINPFG+D+DDFE +  I RN + S + VD+ H   P + +D+Y+   + R
Sbjct:    1 MTVTYSSKVANATFFGFHRLLLRWRGSIYKLLYREFLFFALLYSILSLVYRWVLTDPQRRLFEKLSIYCDRYAEQIPVTFVLGFMT----------------PEEKKIFEN------------LKSPHLKYWIPT--VWFTNLASKARKDGRIQDSVDLQTILT--EMNRF----------------------------------RTW------------CSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVSLMAVDEMHMNIPRMTKDVYWNDPDVR 266          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 278.1 bits (710), Expect = 3.097e-90
Identity = 143/357 (40.06%), Postives = 211/357 (59.10%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLN-ALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNRFIGGSI 1101
            MTV+Y +K+A +      +LLL WKGSIYK +  E  I++VL   L S+  Y L    +  FE    +C K    IPV  VLGFYVTLVV RW  Q+ +LPWPD L   V   + GA +  RL+RR++MRY  +S +L   S+S+   + F T   +VE G +T  E  + +   +  NK +VP  W   L  +A+ E  ++DN  + L+ N+LN FR    +L++YDW++ PL+YTQ+  + +YS+F+  + G+QF +       H M+LY+PVF  L+F  Y GWLKVA+ LINPFG+D+DDFE +  + RN + S + VD+ ++  PPL+ D+Y+       I  C  + G S+
Sbjct:    1 MTVTYSNKVANARLGGFSQLLLRWKGSIYKLLYKEFCIFLVLFFTLSSVYRYMLQENQKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHGADERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTPAERRKFDGLRSPHNKFWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQF-LGPQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVSLMGVDEMYRDLPPLEHDVYWDD-----ISPCPPYTGASL 351          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 270.396 bits (690), Expect = 1.797e-85
Identity = 136/344 (39.53%), Postives = 204/344 (59.30%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      KLLL W+GSIYK +  E  IY ++ A +SL   F L+   + +FE    +C      IPV    GFYV LVV RW  Q+ ++P PD L   V   + G  +  RL+RR++MRY  +S +L   S+S+   + F T   +VE G +T +E  R +    + NK++VP  W   L  +A+ E  + D+  + LL +E+N +R    +LF YDWI+ PL+YTQ+  + +YS+F+  + G+QF+        H M+LY+PVF  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RN + S + VD+ +Q  P LQ+DMY+   + R
Sbjct:    1 MTVTYTNRVANARLCGFSKLLLQWRGSIYKLLYREFSIYFMMYAALSLTSRFALSEDQKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGVDERGRLLRRTLMRYANLSALLILRSVSTAVYKRFPTMDHVVEAGFMTRDERKRFDGLRCSYNKYWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGHDMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSMLAVDEMYQNLPLLQRDMYWNASDPR 344          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 275.404 bits (703), Expect = 2.094e-85
Identity = 134/344 (38.95%), Postives = 210/344 (61.05%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y SK+A +      +LLL W+GSIYK +  E  ++ +L  ++SL++   L+   + +FE    +C +    IPV  VLGFYVTLVV RW +QF+ LPWPD L  ++++ + G  +  RL+RR+++RY+ ++ +L + S+S+   + F T   +VE G +T EE    E   +   K+++P+ W   L  +A++E  + D   +  + NE+N FR     LF YDW+  PL+YTQ+  + +Y++F   I G+QF+        H ++LYVPVF  L+F  Y GWLKVA+ LINPFG+D+DDFE + II RN + S + VD+ H   P + +D+Y+   +AR
Sbjct:    1 MTVTYSSKVANATFLSFHRLLLRWRGSIYKLLYREFLLFALLYTILSLIYRLALSEQQKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGKDEYGRLLRRTLVRYINLTSLLIFRSVSTAVCKRFPTIDHVVEAGFMTPEERKVFENIRSPHLKYWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPGHDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAVDEMHMNLPHMTKDIYWNDSDAR 344          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 273.478 bits (698), Expect = 5.291e-84
Identity = 138/337 (40.95%), Postives = 208/337 (61.72%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MTV+Y  ++A +     F LLL WKGSIYK +  EL I+ +L   +SL++Y L    R +FE    +C +    IPV  VL FYVTLVV RW  QF  +PWPD LA  V   + G  +  RL RR++MRYV +S +L Y S+S+   + F T + LV Q L+T+EEL   E+  +  NK +VP  W   L ++A+ E  + ++  +  +  ELN  R +   L+ YDWI+ PL+YTQ+A + +YS+F+  + G+QF+        H ++ Y+PVF  L+F  Y+GWLKVA+ LINPFG+D+DDFE + ++ RN + S ++VD+ +   P +++D+Y+
Sbjct:    1 MTVTYSRRVADAGLGTFFHLLLRWKGSIYKLLYRELIIFTLLYYFLSLVYYMLDNDQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLAALVGGHVRGTDEASRLTRRALMRYVNLSGVLIYRSVSTAVYKRFPTTEHLV-QALMTSEELRHFEELPSPHNKFWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPGHDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVSLLSVDEMYDSLPLVEKDVYW 335          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 267.314 bits (682), Expect = 1.167e-82
Identity = 134/344 (38.95%), Postives = 205/344 (59.59%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH-YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNAR 1062
            MTV+Y +++A +      KLLL WKGSIYK +  E   + VL A IS+ + +FL    +  FE    +C      IP+  VLGFYVTL+V RW +Q+ ++P PD +   ++  + G  +  RL+RRS+MRY  +S +L   S+S+   + F T   +VE G +T EE  + E   +  NK+++P  W   L   A+ E  + D+  + LL  ELN FR +  +LF YD ++ PL+YTQ+  + +YS+F+  + G+QF+        H ++LYVP+F  L+F  Y GWLKVA+ LINPFG+D+DDFE + +I RNF+ S + VD+ +   P +++D Y+   N R
Sbjct:    1 MTVTYTARVANARFCGFSKLLLAWKGSIYKVLYKEFLAFFVLYAAISITYRFFLYEDQKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQGNDERGRLLRRSMMRYASLSALLILRSVSTAVFKRFPTMDHVVEAGFMTREERKKFEGLHSPYNKYWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQGYQGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAVDEMYGDLPVMERDRYWNDSNPR 344          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000069980.1 (SMESG000069980.1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 363/364 (99.73%), Postives = 364/364 (100.00%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNRFIGGSIGKANKINV 1125
            MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGT+QSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNRFIGGSIGKANKINV
Sbjct:    1 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTSQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNRFIGGSIGKANKINV 364          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000054993.1 (SMESG000054993.1)

HSP 1 Score: 324.709 bits (831), Expect = 2.094e-107
Identity = 163/338 (48.22%), Postives = 236/338 (69.82%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY 1044
            MT++Y++ +ATS  +   +LLL WKGSIYK I  E+ ++  L   +S L+ F L G Y+  FE FC+F  K    IPV  VLGFYVTLVV RW +QF+ +PWPDS+A+YV+TFILG  D   + RR+IMRY+ +S  + ++SISSKAKR+F   +TL+E GLLT +E   L ++ET + K+FVP  WA  LV +A+ EK  +  + V  L  E+ +FR  L +++ +DWINPPL+YTQIA I++++YF+  +F +QFI      S   +++YVP+FG L+F+ YMGWLKVA+ LINPFGDD+DDFE+D++I RN + S++ +D+ H   P L +D+++
Sbjct:    1 MTITYINTVATSKYWTFLRLLLRWKGSIYKIIWFEMIVFATLYTGLSCLYRFGLYGIYKKRFEEFCAFSKKNADMIPVPFVLGFYVTLVVSRWWNQFMEIPWPDSMAIYVSTFILGNDDKSVMYRRTIMRYLNLSFCMTFASISSKAKRMFPDLKTLIENGLLTKDEEKILNEYETNNAKYFVPALWASNLVYQAESEKMTIGERGVETLIEEIGKFRGSLGMIYCFDWINPPLVYTQIATISVHAYFMIFVFAEQFI------SKDKVDVYVPMFGFLQFVFYMGWLKVAESLINPFGDDDDDFEIDEMIHRNIKMSYLIIDEMHDSYPELDKDVFW 332          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000057100.1 (SMESG000057100.1)

HSP 1 Score: 263.462 bits (672), Expect = 2.021e-84
Identity = 128/346 (36.99%), Postives = 215/346 (62.14%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYFLTGYYR----LIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYV-PVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKN 1056
            MTV Y   +   + + VF +LL WKGS++K +R E  I+  +   +SL++ F+   Y      +F   C +C +    IPV  VLGFYV++V+  W++QF +LPWPD +A+ ++ F+ G  D   L+RR+I+RYV +  I+ +  IS    ++FST +++ + GL+   EL  L+  + + NK++VP+ WA  L+  A+++  + D++++ +L   L  FR  L  LF + WI+PPL+YTQ+A IT+Y YF+ ++   QFI         G + Y+ P FG L+F+ Y+GWLKVA+ L++PFG+ +DDF+M  +I RN + +++ VD  H+  P +++D+Y+  +N
Sbjct:    1 MTVIYSGSLGKVHFWTVFAILLRWKGSVFKLVRFEALIFFSIYGSLSLIYRFVLVPYHTKSEFVFSFMCQYCIEIMNRIPVAFVLGFYVSIVINWWSEQFKSLPWPDDIALQLSAFLQGETDEIVLLRRTIVRYVNMGMIIAFRGISKSTLKLFSTLESMKKAGLMNMSELKALQSIDRSYNKYYVPLVWAANLIRDARRKNLIKDDRQLDVLVETLTSFRGILCDLFVHQWISPPLVYTQVATITVYCYFLAALMAWQFI--------SGKDDYIFPFFGMLQFLFYVGWLKVAENLLDPFGEKDDDFDMTFLIERNVQMAYLIVDDMHRDIPEIKKDVYWKDEN 338          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000045575.1 (SMESG000045575.1)

HSP 1 Score: 262.307 bits (669), Expect = 1.180e-83
Identity = 135/335 (40.30%), Postives = 198/335 (59.10%), Query Frame = 1
Query:   34 MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLHYF-LTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQD 1035
            MTV Y  ++A+S  F+  ++L  WKGSIYK    EL  +  L A+ISL++ F L G Y+  FE FC FC     +IPV  ++GFYVT++ +RW  QF  +PWPD++A+ VN +I G+     +IRR+I+RY+ +S IL   SIS + K++    + L+   L  +EE    +K  ++ N++F+PI W+  LV K   E  +    R   L  E+  +R++L  LF YDW+NPPL+YTQ A I++Y YF+ S+F KQF+           + YVPVF   +   Y GWLKVA+ LINPFG+D+DDF+   +I RN    F  +       P + +D
Sbjct:    1 MTVDYNRRMASSKCFKFMQILFLWKGSIYKIAWFELIFFGSLYAIISLIYRFVLYGKYKENFEIFCIFCDSIDNYIPVAFIMGFYVTMIARRWWKQFYNIPWPDNVALLVNAYISGSDRRTVMIRRNIIRYINLSLILFLRSISPQTKKIIKEEEDLISYELFNSEEFKLFDKVSSSFNRYFIPILWSVNLVKKMFLEGRIKTEIRARNLIIEIIHYREKLNKLFCYDWVNPPLVYTQTATISVYIYFLTSLFSKQFLDPIKRYPNRHFDYYVPVFSIAQLFFYFGWLKVAEALINPFGEDDDDFDSIGLINRNLTSFFFFIRSKESLFPKIIKD 335          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000040095.1 (SMESG000040095.1)

HSP 1 Score: 246.128 bits (627), Expect = 9.816e-78
Identity = 122/327 (37.31%), Postives = 203/327 (62.08%), Query Frame = 1
Query:  136 ELFIYIVLNALISLLHY-FLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLPWPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVFSTNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYLMDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFSIFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDDEDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYY-LQKNARL---IDSCNRFIGGSI 1101
            EL ++ +L + IS+++   L+G Y+  FE FC +C     F+P+  +L FYVT++  RW +QF  +PWPD +A++VNT+I G      +++R+++RY+ +S +L   S+S + K+ F T  +L++  L    E +   + + T N+++VPI WA  L+ KA  +  +    R+  +  E+++FR+RL  LF+YDW+NPPL+YTQ A I +Y+YF+ S+F +QF+        H ++ YVPVF  ++ + Y GWLKVA+CLINPFG+D+DDF+   +I RN   +FI V    +  P L +D+++ ++   +L    D  N F+G  +
Sbjct:    5 ELVLFGILYSSISIMYRNLLSGLYKEQFERFCIYCDSIGNFMPIAFILSFYVTMIANRWWEQFNIIPWPDHVALFVNTYIPGNSVKLVMLKRNVVRYLNISLLLYLRSVSPQTKKRFPTEASLMDARLFNETEFNLFNQIDPTYNRYYVPIIWASNLIKKAFIDGDIKTEGRLNNIILEISQFRERLIKLFSYDWVNPPLVYTQTATIAVYTYFVTSLFSRQFLDPNKGYRNHNIDFYVPVFFLIQLVFYFGWLKVAECLINPFGEDDDDFDCLGLIERNITANFIFVKPLIEPHPVLMKDVFWDVESPIKLNNYKDDVNFFVGSMV 331          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST32.556e-9040.12bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST31.318e-8640.12bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST28.530e-8540.41bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST28.530e-8540.41bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST28.530e-8540.41bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-42.078e-7134.00Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-52.524e-7132.94Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
best-216.810e-7135.31Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
best-75.830e-6833.73Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
best-248.181e-6731.67Bestrophin homolog 24 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best44.104e-8739.18gene:FBgn0036491 transcript:FBtr0113172[more]
Best38.322e-8540.35gene:FBgn0036492 transcript:FBtr0075618[more]
Best14.068e-8138.26gene:FBgn0040238 transcript:FBtr0082183[more]
Best15.855e-8138.26gene:FBgn0040238 transcript:FBtr0337020[more]
Best11.660e-8038.26gene:FBgn0040238 transcript:FBtr0114590[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best46.373e-9441.52bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best12.746e-8741.42bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best46.525e-8441.46bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best22.958e-8338.44bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best17.770e-4138.42bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best14.768e-8840.83bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best16.558e-8840.83bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
cyp2b61.334e-8740.23cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
best12.251e-8740.83bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best13.696e-8740.83bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best11.834e-8640.87bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best36.964e-8639.29bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298][more]
Best24.140e-8540.41bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best24.140e-8540.41bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best24.140e-8540.41bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N1M1|BEST3_HUMAN6.328e-8640.12Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1... [more]
sp|Q6H1V1|BEST3_MOUSE4.871e-8539.29Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=... [more]
sp|Q8BGM5|BEST2_MOUSE2.194e-8440.41Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
sp|Q8NFU1|BEST2_HUMAN4.096e-8440.41Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1... [more]
sp|O88870|BEST1_MOUSE1.726e-8341.12Bestrophin-1 OS=Mus musculus OX=10090 GN=Best1 PE=... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z0E65.002e-9541.73Bestrophin homolog OS=Fasciola gigantica OX=46835 ... [more]
A0A4E0RID61.335e-9441.73Bestrophin homolog OS=Fasciola hepatica OX=6192 GN... [more]
A0A553Q2K92.321e-9342.11Bestrophin homolog OS=Danionella translucida OX=62... [more]
A0A3Q0KLS63.425e-9339.78Bestrophin homolog OS=Schistosoma mansoni OX=6183 ... [more]
C1L4416.430e-9239.23Bestrophin homolog OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best12.904e-8642.01bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best47.033e-8240.12bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best29.417e-8238.08bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best18.623e-7037.87bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST38.869e-4329.94bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best13.097e-9040.06bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best21.797e-8539.53bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BEST32.094e-8538.95bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best15.291e-8440.95bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
best21.167e-8238.95bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069980.10.000e+099.73SMESG000069980.1[more]
SMESG000054993.12.094e-10748.22SMESG000054993.1[more]
SMESG000057100.12.021e-8436.99SMESG000057100.1[more]
SMESG000045575.11.180e-8340.30SMESG000045575.1[more]
SMESG000040095.19.816e-7837.31SMESG000040095.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033655 ID=SMED30033655|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1392bp
TTTTATATGAAATTTTTTTCATTTAAATAAATAATGACAGTTTCATATGT
TTCAAAAATTGCTACCTCAAATAGTTTCCGAGTGTTCAAGCTTTTATTAA
CATGGAAAGGAAGTATTTATAAGACAATTCGAATCGAATTATTCATTTAT
ATCGTTTTAAATGCTCTGATTTCTCTGCTACATTATTTTCTCACTGGTTA
TTACAGATTAATATTTGAATCATTCTGTTCTTTCTGTGCAAAAGGAACAG
GATTTATCCCCGTTGGTCTAGTATTAGGGTTTTATGTAACGCTAGTTGTA
CAGCGGTGGACCGATCAGTTTGTCACATTGCCATGGCCAGATAGTTTAGC
AGTTTATGTCAATACTTTCATCCTGGGAGCTGGCGATACTCCTCGCCTCA
TTCGTCGCAGCATTATGAGATATGTCATTGTCAGTCAAATTCTGTGTTAC
TCCAGCATTTCTAGTAAAGCCAAAAGAGTTTTCTCCACAAATCAGACATT
AGTAGAACAAGGTTTGTTGACAACGGAAGAATTGAGTAGATTGGAAAAGT
TTGAAACAACAAGTAATAAGCATTTTGTACCGATTGCATGGGCTCAAGAG
CTAGTGGTGAAAGCTCAAAAAGAAAAATATTTGATGGACAATAAACGCGT
TTGGTTGCTTGCGAACGAATTGAATGAATTCCGAGATAGACTTCGCATTT
TATTTGCATATGATTGGATTAATCCCCCCCTCATATACACACAGATCGCC
ATTATCACAATGTACAGCTATTTTATATTCTCGATTTTCGGCAAGCAATT
CATCATTCATGGCACAACCCAATCTGCACATGGCATGAATCTCTACGTTC
CGGTTTTCGGGGCGCTAGAATTCATCAACTATATGGGATGGCTAAAGGTA
GCCCAATGTTTAATAAACCCATTCGGAGATGACGAAGACGATTTTGAAAT
GGATCAGATTATCTTGAGAAATTTTGAGTATTCTTTCATAACAGTAGACC
AATGGCACCAGCAATGCCCACCCCTGCAACAGGACATGTATTATCTCCAG
AAGAACGCCCGTTTGATCGATTCTTGCAATAGATTCATTGGAGGTTCAAT
TGGTAAAGCAAATAAAATAAATGTGTAACTTATTCACATTTTATCAATCG
AAACTAACATATCTTAATTATTCTCGGTGATCTGTGGAATTTATATGTGA
CTCTTTAGCTGTTTAATCTCAATCCAATCAAAAAGCCTGATTTGAAAGTG
GATGGATTTTATTTCTGCTTATTATTGAAATTATTACGGGTCAGTTAACT
AGCAATTATTAATTTTCACTTTAGATCTCACTCAATTGCTCAACTCGCTA
ATGTGAAGCGTTTTAAAAAGCTTATATTAAATTATTGTATGC
back to top

protein sequence of SMED30033655-orf-1

>SMED30033655-orf-1 ID=SMED30033655-orf-1|Name=SMED30033655-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MTVSYVSKIATSNSFRVFKLLLTWKGSIYKTIRIELFIYIVLNALISLLH
YFLTGYYRLIFESFCSFCAKGTGFIPVGLVLGFYVTLVVQRWTDQFVTLP
WPDSLAVYVNTFILGAGDTPRLIRRSIMRYVIVSQILCYSSISSKAKRVF
STNQTLVEQGLLTTEELSRLEKFETTSNKHFVPIAWAQELVVKAQKEKYL
MDNKRVWLLANELNEFRDRLRILFAYDWINPPLIYTQIAIITMYSYFIFS
IFGKQFIIHGTTQSAHGMNLYVPVFGALEFINYMGWLKVAQCLINPFGDD
EDDFEMDQIILRNFEYSFITVDQWHQQCPPLQQDMYYLQKNARLIDSCNR
FIGGSIGKANKINV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:0008150biological_process
GO:0015698inorganic anion transport
GO:0043271negative regulation of ion transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 9..314
e-value: 7.7E-83
score: 278.3
NoneNo IPR availablePANTHERPTHR10736:SF55BESTROPHIN 1, ISOFORM C-RELATEDcoord: 1..341
NoneNo IPR availableTMHMMTMhelixcoord: 228..250
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 72..89
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..341