Alpha-latrocrustotoxin-Lt1a

Overview
NameAlpha-latrocrustotoxin-Lt1a
Smed IDSMED30033645
Length (bp)1965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-latrocrustotoxin-Lt1a (SMED30033645) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-latrocrustotoxin-Lt1a (SMED30033645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033645

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30033645SMESG000074643.1 SMESG000061279.1 SMESG000041409.1 SMESG000036685.1 SMESG000036629.1 Contig11535newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033645SMESG000074643.1 SMESG000061279.1 SMESG000041409.1 SMESG000036685.1 SMESG000036629.1 Contig11535uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Human
Match: ANKRD42 (ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:HGNC:26752])

HSP 1 Score: 176.792 bits (447), Expect = 1.133e-47
Identity = 112/342 (32.75%), Postives = 181/342 (52.92%), Query Frame = 1
Query:    4 SMLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDL----SLLHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            S  + E      ++++ F  I    DA     VK +  + +R   + + D+    + LHWAA  GS+  +++L   +   +D+ +     WTA+H+A I G+DAC+++LIM    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YAA+HGR+  ++LL++ G + +  D +G  P+HLAA EGHL   K FL        + L A ++NG   L LA+   K  I+++I+  E + +  E  + L +PGH+AA  GDL  ++ L+E G I +N+  + G T +HKA   GHI+ ++WL+  GA   I     E   D+ 
Sbjct:   10 STSSRETANPCSRKKVHFGSI---HDAVRAGDVKQLSEIVVRGASINELDVLHKFTPLHWAAHSGSLECLHWL---LWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQ-DDRGCTPLHLAATHGHSFTLQIM-----LRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFK-FLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Human
Match: ANKRD42 (ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:HGNC:26752])

HSP 1 Score: 176.407 bits (446), Expect = 2.291e-47
Identity = 112/342 (32.75%), Postives = 181/342 (52.92%), Query Frame = 1
Query:    4 SMLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDL----SLLHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            S  + E      ++++ F  I    DA     VK +  + +R   + + D+    + LHWAA  GS+  +++L   +   +D+ +     WTA+H+A I G+DAC+++LIM    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YAA+HGR+  ++LL++ G + +  D +G  P+HLAA EGHL   K FL        + L A ++NG   L LA+   K  I+++I+  E + +  E  + L +PGH+AA  GDL  ++ L+E G I +N+  + G T +HKA   GHI+ ++WL+  GA   I     E   D+ 
Sbjct:   10 STSSRETANPCSRKKVHFGSI---HDAVRAGDVKQLSEIVVRGASINELDVLHKFTPLHWAAHSGSLECLHWL---LWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQ-DDRGCTPLHLAATHGHSFTLQIM-----LRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFK-FLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Human
Match: ANKRD42 (ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:HGNC:26752])

HSP 1 Score: 175.637 bits (444), Expect = 4.379e-47
Identity = 111/341 (32.55%), Postives = 179/341 (52.49%), Query Frame = 1
Query:    4 SMLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDL----SLLHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            S  + E      ++++ F  I    DA     VK +  + +R   + + D+    + LHWAA  GS+  +++L   +   +D+ +     WTA+H+A I G+DAC+++LIM    +  + D RGCT LHLAA HG    +  +     L     +     +W P+ YAA+HGR+  ++LL++ G + +  D +G  P+HLAA EGHL   K FL        + L A ++NG   L LA+   K  I+++I+  E + +  E  + L +PGH+AA  GDL  ++ L+E G I +N+  + G T +HKA   GHI+ ++WL+  GA   I     E   D+ 
Sbjct:   10 STSSRETANPCSRKKVHFGSI---HDAVRAGDVKQLSEIVVRGASINELDVLHKFTPLHWAAHSGSLECLHWL---LWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQ-DDRGCTPLHLAATHGHSFTLQIM-----LRSGDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFK-FLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVA 337          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Human
Match: ANKRD42 (ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:HGNC:26752])

HSP 1 Score: 164.851 bits (416), Expect = 2.483e-44
Identity = 93/252 (36.90%), Postives = 142/252 (56.35%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            WTA+H+A I G+DAC+++LIM    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YAA+HGR+  ++LL++ G + +  D +G  P+HLAA EGHL   K FL        + L A ++NG   L LA+   K  I+++I+  E + +  E  + L +PGH+AA  GDL  ++ L+E G I +N+  + G T +HKA   GHI+ ++WL+  GA   I     E   D+ 
Sbjct:   66 WTASHIAAIRGQDACVQALIMNGANLTAQ-DDRGCTPLHLAATHGHSFTLQIM-----LRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFK-FLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVA 310          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Human
Match: ANKRD42 (ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:HGNC:26752])

HSP 1 Score: 90.1225 bits (222), Expect = 5.171e-20
Identity = 60/198 (30.30%), Postives = 103/198 (52.02%), Query Frame = 1
Query:    4 SMLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDL----SLLHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRN-MQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTP 579
            S  + E      ++++ F  I    DA     VK +  + +R   + + D+    + LHWAA  GS+  +++L   +   +D+ +     WTA+H+A I G+DAC+++LIM    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YAA+HGR+  ++LL++ G + +  D +G  P
Sbjct:   10 STSSRETANPCSRKKVHFGSI---HDAVRAGDVKQLSEIVVRGASINELDVLHKFTPLHWAAHSGSLECLHWL---LWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQ-DDRGCTPLHLAATHGHSFTLQIM-----LRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLP 195          

HSP 2 Score: 50.0618 bits (118), Expect = 2.856e-6
Identity = 46/144 (31.94%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  469 QWTPLMYAAWHGRISIVELLIRHGVATDVTDVD--GRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRG 891
            ++TPL +AA  G +  +  L+ HG   D+T V   G T  H+AA  G    V+  +  G +     LTA D+ G T L LA T      ++ +     DP    + D  ++ P H AA +G L  +Q LL K   ++ D D  G
Sbjct:   60 KFTPLHWAAHSGSLECLHWLLWHGA--DITHVTTRGWTASHIAAIRGQDACVQALIMNGAN-----LTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDP---SVTDKREWRPVHYAAFHGRLGCLQ-LLVKWGCSIEDVDYNG 192          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 77.0258 bits (188), Expect = 2.890e-14
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  316 IMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++R    IN  ++ G   LHLA+  G    +  L    +    +DA  R    T L  A+  G+  IV +L+ +G   +V  V+G TPL++AA E H  +VKY L+ G    ++ L+  D  GFT L +A  +  D +V  + + +   +       ++ P  HIAA   D      LL +     + T   G+T LH A   GH ++ + LL KGA++
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVREL---IKRQAQVDAATRKGN-TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGA---NQALSTED--GFTPLAVALQQGHDRVVAVLLENDSKGK-------VRLPALHIAAKKDD-TTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANV 253          

HSP 2 Score: 73.559 bits (179), Expect = 3.996e-13
Identity = 91/323 (28.17%), Postives = 140/323 (43.34%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH-DIHKCLTAVDNNGFTALKLAETKSKDEIVKY-IRDKEK-DPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDT-DN-------------------------------RGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            L+ LH AA  G   +V+ L+ +    S    N       H+A  G   DA    L  R P  ++       T LH+AA     HC H       L  + D   R +  +TPL  A    RI +VELL+++  A + T   G TPLH+AA  G + +V Y L++G + D+          G T L LA   ++ ++V+  IR+  K D +  E    LQ P HIA+  G+   +  LL+ G+ +   T DN                               +G+T LH A   G++++V+ LL +G  + I+   Q T + + 
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG--LAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAA-----HCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV------RGETPLHLAARANQTDVVRVLIRNGAKVDAQARE----LQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 3 Score: 72.7886 bits (177), Expect = 6.286e-13
Identity = 82/297 (27.61%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  151 DLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRG---CTLLHLAAAHGRYHCMHYLANFTRLL-----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK--YIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            + S LH AA +G   +   L+D     + L      +T  H+A   G    +  L+ R   V    D  G    T LH+AA        HY  +   +L      +  A  +N  +TPL  AA   ++ I   L++     +     G TPLHL+A EGH  +    +E G       + A  NNG TA+ L   +    + +  Y    E + +T   +  L    H+A   G L  ++ L+E G+  V +     YT LH+A   GH + V++LL  GAS   +T   +T + I 
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPV----DIEGKNQVTPLHVAA--------HYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-----VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPL----HVACHFGQLNMVKFLVENGA-DVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 68.9366 bits (167), Expect = 8.890e-12
Identity = 100/397 (25.19%), Postives = 145/397 (36.52%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYL-----------------------ANFT---RLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVD---------------------------------GRTPLHLAAAEGHLPLVKYFLEEGCH-DIH---------------------------KCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDP--RTWELFDDLQYP---GH---------------IAAVNG----------DLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G V +   L+D+   P+    N   +T  H+A    +   +E L+++    I      G T LH+AA  G  + + YL                       AN T   R+L      +DAQ R +Q TPL  A+  G   IV LL++ G  ++ T  D                                 G TPLHLA+  G+L +V+  LE G   DI                                A   NG+T L +A  K++ EI   +   + DP  ++   F  L      GH                 A NG          D + +  +L      +N   N GYT LH AC  G +++VK+L+  GA +  KT
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG--FTPLHIACKKNRIKVVE-LLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKT 752          

HSP 5 Score: 60.8474 bits (146), Expect = 3.098e-9
Identity = 72/265 (27.17%), Postives = 108/265 (40.75%), Query Frame = 1
Query:  328 PEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLA---------------ETKSKDEIVKYIR------------------DKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            P+V ++    G T LH+AA +G         N  +LL     N++ Q R+   +PL  A   GR ++  LL+  G   D    D  TPLH AA  GH  +V   + +G       ++A   NG   L +A                    D  V Y+                   D+  DP +  L  +   P HI A   + + +  LL K   A+  T   G T LH A   G I+IV +LL +GA+  ++T+  ET + + 
Sbjct:  220 PDVTSK---SGFTPLHIAAHYGH-------ENVGQLLLEKGANVNYQARH-NISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-----PISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRAL--NGFTPLHI-ACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 51.9878 bits (123), Expect = 1.677e-6
Identity = 49/195 (25.13%), Postives = 85/195 (43.59%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI-WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIR 744
            LH AA K  + I + L   ++F +D +  +   +T  H++   G    +  L++     +    + G T +HL A          L N       ++++  N  +TPL  A   G++++V+ L+ +G           TPLH AA +GH   V+Y LE G     +  T     G T L +A+      +V+ +R
Sbjct:  627 LHIAAKKNQMEIASTL---LQFKADPNAKSRAGFTPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKT-NAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT-----GQTPLSIAQRLGYVSVVETLR 808          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 77.0258 bits (188), Expect = 2.890e-14
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  316 IMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++R    IN  ++ G   LHLA+  G    +  L    +    +DA  R    T L  A+  G+  IV +L+ +G   +V  V+G TPL++AA E H  +VKY L+ G    ++ L+  D  GFT L +A  +  D +V  + + +   +       ++ P  HIAA   D      LL +     + T   G+T LH A   GH ++ + LL KGA++
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVREL---IKRQAQVDAATRKGN-TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGA---NQALSTED--GFTPLAVALQQGHDRVVAVLLENDSKGK-------VRLPALHIAAKKDD-TTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANV 253          

HSP 2 Score: 73.559 bits (179), Expect = 3.996e-13
Identity = 91/323 (28.17%), Postives = 140/323 (43.34%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH-DIHKCLTAVDNNGFTALKLAETKSKDEIVKY-IRDKEK-DPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDT-DN-------------------------------RGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            L+ LH AA  G   +V+ L+ +    S    N       H+A  G   DA    L  R P  ++       T LH+AA     HC H       L  + D   R +  +TPL  A    RI +VELL+++  A + T   G TPLH+AA  G + +V Y L++G + D+          G T L LA   ++ ++V+  IR+  K D +  E    LQ P HIA+  G+   +  LL+ G+ +   T DN                               +G+T LH A   G++++V+ LL +G  + I+   Q T + + 
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG--LAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAA-----HCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV------RGETPLHLAARANQTDVVRVLIRNGAKVDAQARE----LQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 3 Score: 72.7886 bits (177), Expect = 6.286e-13
Identity = 82/297 (27.61%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  151 DLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRG---CTLLHLAAAHGRYHCMHYLANFTRLL-----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK--YIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            + S LH AA +G   +   L+D     + L      +T  H+A   G    +  L+ R   V    D  G    T LH+AA        HY  +   +L      +  A  +N  +TPL  AA   ++ I   L++     +     G TPLHL+A EGH  +    +E G       + A  NNG TA+ L   +    + +  Y    E + +T   +  L    H+A   G L  ++ L+E G+  V +     YT LH+A   GH + V++LL  GAS   +T   +T + I 
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPV----DIEGKNQVTPLHVAA--------HYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-----VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPL----HVACHFGQLNMVKFLVENGA-DVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 68.9366 bits (167), Expect = 8.890e-12
Identity = 100/397 (25.19%), Postives = 145/397 (36.52%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYL-----------------------ANFT---RLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVD---------------------------------GRTPLHLAAAEGHLPLVKYFLEEGCH-DIH---------------------------KCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDP--RTWELFDDLQYP---GH---------------IAAVNG----------DLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G V +   L+D+   P+    N   +T  H+A    +   +E L+++    I      G T LH+AA  G  + + YL                       AN T   R+L      +DAQ R +Q TPL  A+  G   IV LL++ G  ++ T  D                                 G TPLHLA+  G+L +V+  LE G   DI                                A   NG+T L +A  K++ EI   +   + DP  ++   F  L      GH                 A NG          D + +  +L      +N   N GYT LH AC  G +++VK+L+  GA +  KT
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG--FTPLHIACKKNRIKVVE-LLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKT 752          

HSP 5 Score: 60.8474 bits (146), Expect = 3.098e-9
Identity = 72/265 (27.17%), Postives = 108/265 (40.75%), Query Frame = 1
Query:  328 PEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLA---------------ETKSKDEIVKYIR------------------DKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            P+V ++    G T LH+AA +G         N  +LL     N++ Q R+   +PL  A   GR ++  LL+  G   D    D  TPLH AA  GH  +V   + +G       ++A   NG   L +A                    D  V Y+                   D+  DP +  L  +   P HI A   + + +  LL K   A+  T   G T LH A   G I+IV +LL +GA+  ++T+  ET + + 
Sbjct:  220 PDVTSK---SGFTPLHIAAHYGH-------ENVGQLLLEKGANVNYQARH-NISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-----PISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRAL--NGFTPLHI-ACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 51.9878 bits (123), Expect = 1.677e-6
Identity = 49/195 (25.13%), Postives = 85/195 (43.59%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI-WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIR 744
            LH AA K  + I + L   ++F +D +  +   +T  H++   G    +  L++     +    + G T +HL A          L N       ++++  N  +TPL  A   G++++V+ L+ +G           TPLH AA +GH   V+Y LE G     +  T     G T L +A+      +V+ +R
Sbjct:  627 LHIAAKKNQMEIASTL---LQFKADPNAKSRAGFTPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKT-NAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT-----GQTPLSIAQRLGYVSVVETLR 808          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 77.0258 bits (188), Expect = 2.999e-14
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  316 IMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++R    IN  ++ G   LHLA+  G    +  L    +    +DA  R    T L  A+  G+  IV +L+ +G   +V  V+G TPL++AA E H  +VKY L+ G    ++ L+  D  GFT L +A  +  D +V  + + +   +       ++ P  HIAA   D      LL +     + T   G+T LH A   GH ++ + LL KGA++
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVREL---IKRQAQVDAATRKGN-TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGA---NQALSTED--GFTPLAVALQQGHDRVVAVLLENDSKGK-------VRLPALHIAAKKDD-TTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANV 253          

HSP 2 Score: 73.1738 bits (178), Expect = 4.594e-13
Identity = 85/275 (30.91%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH-DIHKCLTAVDNNGFTALKLAETKSKDEIVKY-IRDKEK-DPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            L+ LH AA  G   +V+ L+ +    S    N       H+A  G   DA    L  R P  ++       T LH+AA     HC H       L  + D   R +  +TPL  A    RI +VELL+++  A + T   G TPLH+AA  G + +V Y L++G + D+          G T L LA   ++ ++V+  IR+  K D +  E    LQ P HIA+  G+   +  LL+ G+ + N T    Y+ LH A   G  ++   LL   A
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG--LAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAA-----HCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV------RGETPLHLAARANQTDVVRVLIRNGAKVDAQARE----LQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIAAKEGQEEVAGILLDHNA 548          

HSP 3 Score: 72.7886 bits (177), Expect = 7.166e-13
Identity = 82/297 (27.61%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  151 DLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRG---CTLLHLAAAHGRYHCMHYLANFTRLL-----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK--YIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            + S LH AA +G   +   L+D     + L      +T  H+A   G    +  L+ R   V    D  G    T LH+AA        HY  +   +L      +  A  +N  +TPL  AA   ++ I   L++     +     G TPLHL+A EGH  +    +E G       + A  NNG TA+ L   +    + +  Y    E + +T   +  L    H+A   G L  ++ L+E G+  V +     YT LH+A   GH + V++LL  GAS   +T   +T + I 
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPV----DIEGKNQVTPLHVAA--------HYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-----VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPL----HVACHFGQLNMVKFLVENGA-DVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 68.9366 bits (167), Expect = 9.874e-12
Identity = 100/397 (25.19%), Postives = 145/397 (36.52%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYL-----------------------ANFT---RLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVD---------------------------------GRTPLHLAAAEGHLPLVKYFLEEGCH-DIH---------------------------KCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDP--RTWELFDDLQYP---GH---------------IAAVNG----------DLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G V +   L+D+   P+    N   +T  H+A    +   +E L+++    I      G T LH+AA  G  + + YL                       AN T   R+L      +DAQ R +Q TPL  A+  G   IV LL++ G  ++ T  D                                 G TPLHLA+  G+L +V+  LE G   DI                                A   NG+T L +A  K++ EI   +   + DP  ++   F  L      GH                 A NG          D + +  +L      +N   N GYT LH AC  G +++VK+L+  GA +  KT
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG--FTPLHIACKKNRIKVVE-LLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKT 752          

HSP 5 Score: 60.4622 bits (145), Expect = 3.874e-9
Identity = 72/265 (27.17%), Postives = 108/265 (40.75%), Query Frame = 1
Query:  328 PEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLA---------------ETKSKDEIVKYIR------------------DKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            P+V ++    G T LH+AA +G         N  +LL     N++ Q R+   +PL  A   GR ++  LL+  G   D    D  TPLH AA  GH  +V   + +G       ++A   NG   L +A                    D  V Y+                   D+  DP +  L  +   P HI A   + + +  LL K   A+  T   G T LH A   G I+IV +LL +GA+  ++T+  ET + + 
Sbjct:  220 PDVTSK---SGFTPLHIAAHYGH-------ENVGQLLLEKGANVNYQARH-NISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-----PISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRAL--NGFTPLHI-ACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 51.9878 bits (123), Expect = 1.638e-6
Identity = 49/195 (25.13%), Postives = 85/195 (43.59%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI-WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIR 744
            LH AA K  + I + L   ++F +D +  +   +T  H++   G    +  L++     +    + G T +HL A          L N       ++++  N  +TPL  A   G++++V+ L+ +G           TPLH AA +GH   V+Y LE G     +  T     G T L +A+      +V+ +R
Sbjct:  627 LHIAAKKNQMEIASTL---LQFKADPNAKSRAGFTPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKT-NAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT-----GQTPLSIAQRLGYVSVVETLR 808          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 77.0258 bits (188), Expect = 2.999e-14
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  316 IMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++R    IN  ++ G   LHLA+  G    +  L    +    +DA  R    T L  A+  G+  IV +L+ +G   +V  V+G TPL++AA E H  +VKY L+ G    ++ L+  D  GFT L +A  +  D +V  + + +   +       ++ P  HIAA   D      LL +     + T   G+T LH A   GH ++ + LL KGA++
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVREL---IKRQAQVDAATRKGN-TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGA---NQALSTED--GFTPLAVALQQGHDRVVAVLLENDSKGK-------VRLPALHIAAKKDD-TTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANV 253          

HSP 2 Score: 73.1738 bits (178), Expect = 4.594e-13
Identity = 85/275 (30.91%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH-DIHKCLTAVDNNGFTALKLAETKSKDEIVKY-IRDKEK-DPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            L+ LH AA  G   +V+ L+ +    S    N       H+A  G   DA    L  R P  ++       T LH+AA     HC H       L  + D   R +  +TPL  A    RI +VELL+++  A + T   G TPLH+AA  G + +V Y L++G + D+          G T L LA   ++ ++V+  IR+  K D +  E    LQ P HIA+  G+   +  LL+ G+ + N T    Y+ LH A   G  ++   LL   A
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG--LAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAA-----HCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETV------RGETPLHLAARANQTDVVRVLIRNGAKVDAQARE----LQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIAAKEGQEEVAGILLDHNA 548          

HSP 3 Score: 72.7886 bits (177), Expect = 7.166e-13
Identity = 82/297 (27.61%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  151 DLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRG---CTLLHLAAAHGRYHCMHYLANFTRLL-----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK--YIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            + S LH AA +G   +   L+D     + L      +T  H+A   G    +  L+ R   V    D  G    T LH+AA        HY  +   +L      +  A  +N  +TPL  AA   ++ I   L++     +     G TPLHL+A EGH  +    +E G       + A  NNG TA+ L   +    + +  Y    E + +T   +  L    H+A   G L  ++ L+E G+  V +     YT LH+A   GH + V++LL  GAS   +T   +T + I 
Sbjct:  524 NYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG--FTPLHLASKYGNLEVVRLLLERGTPV----DIEGKNQVTPLHVAA--------HYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD-----VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPL----HVACHFGQLNMVKFLVENGA-DVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 68.9366 bits (167), Expect = 9.874e-12
Identity = 100/397 (25.19%), Postives = 145/397 (36.52%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYL-----------------------ANFT---RLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVD---------------------------------GRTPLHLAAAEGHLPLVKYFLEEGCH-DIH---------------------------KCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDP--RTWELFDDLQYP---GH---------------IAAVNG----------DLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G V +   L+D+   P+    N   +T  H+A    +   +E L+++    I      G T LH+AA  G  + + YL                       AN T   R+L      +DAQ R +Q TPL  A+  G   IV LL++ G  ++ T  D                                 G TPLHLA+  G+L +V+  LE G   DI                                A   NG+T L +A  K++ EI   +   + DP  ++   F  L      GH                 A NG          D + +  +L      +N   N GYT LH AC  G +++VK+L+  GA +  KT
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG--FTPLHIACKKNRIKVVE-LLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKT 752          

HSP 5 Score: 60.4622 bits (145), Expect = 3.874e-9
Identity = 72/265 (27.17%), Postives = 108/265 (40.75%), Query Frame = 1
Query:  328 PEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLA---------------ETKSKDEIVKYIR------------------DKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            P+V ++    G T LH+AA +G         N  +LL     N++ Q R+   +PL  A   GR ++  LL+  G   D    D  TPLH AA  GH  +V   + +G       ++A   NG   L +A                    D  V Y+                   D+  DP +  L  +   P HI A   + + +  LL K   A+  T   G T LH A   G I+IV +LL +GA+  ++T+  ET + + 
Sbjct:  220 PDVTSK---SGFTPLHIAAHYGH-------ENVGQLLLEKGANVNYQARH-NISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-----PISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRAL--NGFTPLHI-ACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 51.9878 bits (123), Expect = 1.638e-6
Identity = 49/195 (25.13%), Postives = 85/195 (43.59%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI-WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIR 744
            LH AA K  + I + L   ++F +D +  +   +T  H++   G    +  L++     +    + G T +HL A          L N       ++++  N  +TPL  A   G++++V+ L+ +G           TPLH AA +GH   V+Y LE G     +  T     G T L +A+      +V+ +R
Sbjct:  627 LHIAAKKNQMEIASTL---LQFKADPNAKSRAGFTPLHLSAQEGHKE-ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKT-NAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTAT-----GQTPLSIAQRLGYVSVVETLR 808          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 77.0258 bits (188), Expect = 3.267e-14
Identity = 70/228 (30.70%), Postives = 109/228 (47.81%), Query Frame = 1
Query:  262 TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVK 942
            TA H+A   G    L  L+++    +N     G   LHLAA HG    ++ L         L+A   + Q T L +AA  G++++ + L+  G   +  D  G+TPLHLAA      +VK FL+   ++    LTA+D+NGFT   +A  K    +V+ +   +K          L+    H+AA  G    ++ LLE G+ A  D ++ G T LH    +G I I++
Sbjct:  922 TALHLAAFNGH-LSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHG--AALEAITLDNQ-TALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNN-RSVLTAIDHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGANA-EDENSHGMTALHLGAKNGFISILE 1143          

HSP 2 Score: 72.4034 bits (176), Expect = 7.735e-13
Identity = 80/292 (27.40%), Postives = 126/292 (43.15%), Query Frame = 1
Query:  166 HWAALKGSVVIVN--FLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQC-RNMQWTPLMYAAWHGRISIVELLIRHGVAT--------------DVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI---RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            H AA+KGS+ +V    +IDK           E  T  H+A  GG  A +  +++         +S G T LHL A +G    +  L  F ++L     +C R      L  AA++G    V  +++H  AT              + +   G TPLHLAA  GH  LV+  L +G   +    T ++      L LA  +    +V  +     +++  + W      + P H+AA NG    +  L+ +GS  +N  D  G+T LH A  +GH+ +VK  +   A    +T
Sbjct: 1062 HIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEA-TTLHMAAAGGH-ANIVKILLENGANAEDENSHGMTALHLGAKNG---FISILEAFDKILWK---RCSRKTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQ-VDATSTTMN---VIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRG----RTPLHLAAQNGHYEMVSLLIAQGS-NINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAET 1336          

HSP 3 Score: 68.5514 bits (166), Expect = 1.296e-11
Identity = 70/229 (30.57%), Postives = 103/229 (44.98%), Query Frame = 1
Query:  289 GKDACLESLIMRKPEVINRPD-SRGCTLLHLAAAHGRYHCMHYLAN-----FTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLAETKSKDEIVKY-IRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLL 951
            G+DA L +L++    ++  P  +   T +H+AA  G    +  + N       +++ N   Q +N  W+PL+ A   G   +  +L++H    DV D  GRT LHLAA  GHL LV   L+      HK  + +    G   L LA      ++V   ++D         L  D Q   H AA  G L   Q LL  G+   N  D++G T LH A  +   D+VK  L
Sbjct:  824 GEDAKLVNLLIDYGGMVEMPSLNANETAMHMAARSGNQAVLLAMVNKIGAGAVQIVQN--KQSKN-GWSPLLEACARGHSGVANILLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQ------HKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITL--DNQTALHFAAKFGQLAVSQTLLALGA-NPNARDDKGQTPLHLAAENDFPDVVKLFL 1040          

HSP 4 Score: 62.7734 bits (151), Expect = 8.335e-10
Identity = 85/353 (24.08%), Postives = 136/353 (38.53%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSD---LDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA-------------------------HGRYHCMHYLA-----NFTRLLPNLD------AQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYF---------LEEGCHDIHKCLTAVDNN----------------------------------GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            LH AA  G V +VN L+       +   LDN     TA H A   G+ A  ++L+       N  D +G T LHLAA                          H  + C H  A        R L  +D      A+ + ++ T L  AA  G  +IV++L+ +G   +  +  G T LHL A  G + +++ F          + G + +H  + A   N                                  GFT L LA     D +V+ + ++           ++  P H+AA  G +  +  LL + +   +  D RG T LH A  +GH ++V  L+++G++I +
Sbjct:  957 LHLAAQHGHVKVVNVLVQDHGAALEAITLDNQ----TALHFAAKFGQLAVSQTLLALGANP-NARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAIDHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGANAEDENSHGMTALHLGAKNGFISILEAFDKILWKRCSRKTGLNALH--IAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNV-IPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINV 1301          

HSP 5 Score: 62.3882 bits (150), Expect = 9.969e-10
Identity = 63/231 (27.27%), Postives = 100/231 (43.29%), Query Frame = 1
Query:  148 TDLSLLHWAALKGSVVIVNFLIDKMEF-----PSDLDN--NAEI-----WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW---TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY 795
            T L+ LH AA  G+   VN ++  ++      P   ++  N E      +T  H+A   G D+ +  L+ +  +V     +     LHLAA  G      ++A    LL     Q     W   TPL  AA +G   +V LLI  G   +V D +G T LH A   GHL +VK F++     +     A    G   L  A   +  E ++++  ++ D  T +L +D ++
Sbjct: 1157 TGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQG------HIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPL-----AETKEGKVPLCFAAAHNHIECLRFLLKQKHD--THQLMEDRKF 1374          

HSP 6 Score: 55.4546 bits (132), Expect = 1.314e-7
Identity = 52/172 (30.23%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  478 PLMYAAWHGRISIVELLIRHGVATDVT---DVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNN-GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEK--GSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            P+  A   G ++IVELL+  G + + T   D +G T LHLAA  G++  V+  +  GC + +     V N  G T L          ++K +     D    +  D  + P H+AA  GD   ++ L++K  GSI     D  G T+LH A  SGH       L +G  +++
Sbjct:  460 PIHLAFKFGNVNIVELLLS-GPSDEQTRKADGNGDTLLHLAARSGNIEAVRTAIAAGCDNAN-----VQNRVGRTPLHEVAEVGDQNMLKIMFKLRADANIHDKED--KTPVHVAAERGDTSMVESLIDKFGGSIRARTRD--GSTLLHIAACSGHTSTALAFLKRGVPLFM 621          

HSP 7 Score: 51.9878 bits (123), Expect = 1.689e-6
Identity = 45/131 (34.35%), Postives = 57/131 (43.51%), Query Frame = 1
Query:  262 TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIH 654
            T  HVA   G  + +ESLI +    I      G TLLH+AA  G  H    LA   R +P      +      L  AA  G   +V++LI  G   DV   D  T LH+A   G   +V+  L  G  DIH
Sbjct:  561 TPVHVAAERGDTSMVESLIDKFGGSIRARTRDGSTLLHIAACSG--HTSTALAFLKRGVPLFMPNKKGALG--LHSAAAAGFNDVVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLLGSGA-DIH 686          

HSP 8 Score: 50.0618 bits (118), Expect = 6.476e-6
Identity = 75/297 (25.25%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAA----AHGRYHCMHYLANFTRL-LPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEE-----GCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDD----LQYPG--------HIAAVNGDLLNIQGLLEK-GSIAVNDTDNR----GYTMLHKACISGHIDIVKWLLSKGASI 969
            LH AA  G   +V  LI +    +++D    + +TA HVAV  GK + +E+L+    ++  +    G T LH+AA    A  R   M  L +  +  +  +D +      T L  AA  G   I+ LL+     + ++   G TPL +AA   +       L+          + + +    N+GFTAL  A    +    + +    +D +   L  D    ++ P         H+AA +G+   +  ++ K G+ AV    N+    G++ L +AC  GH  +   LL   A I
Sbjct:  630 LHSAAAAGFNDVVKMLIAR---GTNVDVRTRDNYTALHVAVQSGKASVVETLLGSGADIHVKGGELGQTALHIAASLNGAESRDCAMMLLKSGGQPDVAQMDGE------TCLHIAARSGNKDIMRLLLDENADSKISSKIGETPLQVAAKSCNFEAASMILKHLSEVLTQEQLKEHVNHRTNDGFTALHYAAEIEQ----RQLHFPGEDAKLVNLLIDYGGMVEMPSLNANETAMHMAARSGNQAVLLAMVNKIGAGAVQIVQNKQSKNGWSPLLEACARGHSGVANILLKHHARI 913          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Fly
Match: CG10011 (gene:FBgn0039590 transcript:FBtr0085319)

HSP 1 Score: 89.7373 bits (221), Expect = 4.409e-18
Identity = 87/293 (29.69%), Postives = 133/293 (45.39%), Query Frame = 1
Query:  139 MEDTDLSLLHWAALKGSVVIVNFLIDKMEFP--SDLDNNAEIW---TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCR-NMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVD---NNGFTALKLAETKSKDEIVKY-------IRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +++  +S L  ++ +G+  +   L++    P  +D      +W   TA H  V+         L++     I+  DS G T+L + AA G    +  L     L   LD   R N  WTPL YAA+ G   +   L+  G   D  D +G+T LHLAA EG L  V+  L     DIH     VD   ++G TA +LA  +   + V++       +  K+ D RT           +I A+   L  ++ LL+  ++ VN  D+ G T LH A   GH D+VK L+  GA +
Sbjct: 1448 LDNDGMSPLLVSSFEGNAEVCELLLENAADPDLADFMGRTPLWAACTAGHATVV--------KLLLFWGCGIDCMDSEGRTVLSIGAAQGNVETVRQL-----LDRGLDETHRDNAGWTPLHYAAFEGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALL-----DIHSSF--VDQKAHDGKTAFRLACLEGHMDTVEFLLKFCCDVNSKDADSRTTL---------YILALENKLEIVKYLLDMTNVDVNIPDSEGRTALHVAAWQGHADMVKTLIEAGADV 1711          

HSP 2 Score: 63.1586 bits (152), Expect = 8.091e-10
Identity = 56/202 (27.72%), Postives = 95/202 (47.03%), Query Frame = 1
Query:  172 AALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK----YIRDKEKDP 762
            A L+G +  V FL   ++F  D+++ +A+  T  ++  +  K   ++ L+      +N PDS G T LH+AA  G    +  L      + ++D + R    TPL   AW G   ++ +L+ +G   D     G T L ++A EGH   V   L+ G +         D+ G T +KLA   S+  I+K    Y +++  +P
Sbjct: 1625 ACLEGHMDTVEFL---LKFCCDVNSKDADSRTTLYILALENKLEIVKYLLDMTNVDVNIPDSEGRTALHVAAWQGHADMVKTLIEAGADVNSMDLEAR----TPLHSCAWQGNHDVMNILLYYGALADHACKQGATALGISAQEGHEKCVIALLQFGANPYKS-----DHCGRTPIKLAAKSSRTSILKIFESYTKNEASNP 1814          

HSP 3 Score: 59.3066 bits (142), Expect = 1.079e-8
Identity = 55/181 (30.39%), Postives = 83/181 (45.86%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTAL---KLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDI 1008
            T L  AAW G   I++LLI  G   +  D  GRT L  A+  GH  +V+  LE G +  H     +D +G +AL    L  +    +++  + D   +  T +L +D   P  +++  G+    + LLE  +   +  D  G T L  AC +GH  +VK LL  G  I        TV+ I
Sbjct: 1352 TALRAAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGANVNH-----LDLDGRSALCVAALCGSSGYSKVISTLLDHGAN--TDQLDNDGMSPLLVSSFEGNAEVCELLLENAADP-DLADFMGRTPLWAACTAGHATVVKLLLFWGCGIDCMDSEGRTVLSI 1524          

HSP 4 Score: 55.8398 bits (133), Expect = 1.472e-7
Identity = 53/220 (24.09%), Postives = 87/220 (39.55%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW------------------------------TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIV 732
            LH+AA +G   +   L++      + DN  E  TA H+A   G+  C+++L+      +++    G T   LA   G    + +L  F   + + DA  R   +                              T L  AAW G   +V+ LI  G   +  D++ RTPLH  A +G+  ++   L  G    H C       G TAL ++  +  ++ V
Sbjct: 1555 LHYAAFEGFHEVCLQLLESGAKIDECDN--EGKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHDGKTAFRLACLEGHMDTVEFLLKFCCDVNSKDADSRTTLYILALENKLEIVKYLLDMTNVDVNIPDSEGRTALHVAAWQGHADMVKTLIEAGADVNSMDLEARTPLHSCAWQGNHDVMNILLYYGALADHAC-----KQGATALGISAQEGHEKCV 1767          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344222)

HSP 1 Score: 88.5817 bits (218), Expect = 9.808e-18
Identity = 89/282 (31.56%), Postives = 128/282 (45.39%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKP--EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G   +V+ L+++    S    N       H+A  G   DA    L  R P  EV         T+ +L A H   HC H       L  N DA  R +  +TPL  A    R+ +VELL+RHG +   T   G TPLH+AA  G + +V Y L+   HD    +  V   G T L LA   ++ +I++ +     + D R  E     Q P HIA+  G++  +  LL+ G+  V+ T    YT LH A   G  ++   L+  GA++   T
Sbjct:  272 LTPLHCAARSGHEQVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEV---------TVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ---HDASPDVPTV--RGETPLHLAARANQTDIIRILLRNGAQVDARARE----QQTPLHIASRLGNVDIVMLLLQHGA-QVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT 532          

HSP 2 Score: 84.3445 bits (207), Expect = 2.209e-16
Identity = 75/274 (27.37%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            LH A+  G+V IV  L   ++  + +D    +++TA H+A   G+D  + ++++     ++    +G T LHL A +G       L        ++DAQ +N   TPL  A  +    +  LL+  G +   T  +G TPLH+AA +  + +    LE G         A    GFT L L+  +   EI   +   E          +   P H+ A   D +N+  +LEK    ++     GYT LH A   G  ++V++LL  GA++   T
Sbjct:  473 LHIASRLGNVDIVMLL---LQHGAQVDATTKDMYTALHIAAKEGQDE-VAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKN-GVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGA-----LANAESKAGFTPLHLSSQEGHAEISNLLI--EHKAAVNHPAKNGLTPMHLCA-QEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT 730          

HSP 3 Score: 75.485 bits (184), Expect = 1.171e-13
Identity = 76/271 (28.04%), Postives = 115/271 (42.44%), Query Frame = 1
Query:  244 NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH---------------DIHKCLTAVDNN---------GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKG-SIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            +NA    A H+A   G    +  L +R+  +++    +G T LH+A+  G+   +  L        +++ Q +N  +TPL  AA     ++V LL+ +G    +   DG TPL +A  +GH  +V   LE                   D+      +DN+         GFT L +A       I   +  K  D   +    ++  P H+AA  G    +  LLEKG +I     D  G T LH A  SGH  +V  LL +GA I  KT
Sbjct:   40 SNANGLNALHLASKDGHIHVVSEL-LRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNA---SVNVQSQN-GFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD-VNYSAKHNIS-PLHVAAKWGKTNMVSLLLEKGGNIEAKTRD--GLTPLHCAARSGHEQVVDMLLERGAPISAKT 301          

HSP 4 Score: 74.3294 bits (181), Expect = 2.547e-13
Identity = 74/275 (26.91%), Postives = 119/275 (43.27%), Query Frame = 1
Query:  145 DTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++ L+ LH AA  G + IV +L+     P       E  T  H+A    +   +  L+    +V  R   +  T LH+A+  G    +  L         +DA  ++M +T L  AA  G+  +  +LI +G A D     G TPLHL A  GH+ + +  L++        + A   NG T L +A   +  ++   + +K   P       +   P HIAA    +     LLE G++A N     G+T LH +   GH +I   L+   A++
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQ-TPLHIASRLGNVDIVMLLLQHGA---QVDATTKDM-YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD-----VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT--AKNGHTPLHIAARKNQMDIATTLLEYGALA-NAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV 660          

HSP 5 Score: 73.559 bits (179), Expect = 5.310e-13
Identity = 85/294 (28.91%), Postives = 130/294 (44.22%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAE-IWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI-RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +   +  + LH A+  G+  I N LI K    +D++ +A+   +  HVA   GK   + SL++ K   I      G T LH AA  G    +  L    R  P + A+ +N    PL  AA    +    +L+ H    D   VD  T LH+AA  GH+ + K  L+       + L     NGFT L +A  K++ ++V+ + R       T E       P H+AA  G  +NI   L +   + +    RG T LH A  +   DI++ LL  GA +  +   Q+T + I 
Sbjct:  200 VTSKSGFTPLHIASHYGNQNIANLLIQKG---ADVNYSAKHNISPLHVAAKWGKTNMV-SLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML--LERGAP-ISAKTKN-GLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL-----NGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMG-CMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 6 Score: 72.7886 bits (177), Expect = 7.473e-13
Identity = 63/217 (29.03%), Postives = 101/217 (46.54%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVND-----TDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            IN  ++ G   LHLA+  G    +H ++   R    +D+  +    T L  A+  G+  +V+LL+ H  + +V   +G TPL++AA E H  +V+  L  G +      +    +GFT L +A  +  D++V  +   E D R       ++ P  HIAA   D+     LL+      ND     T   G+T LH A   G+ +I   L+ KGA +
Sbjct:   37 INTSNANGLNALHLASKDGH---IHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ-----SLATEDGFTPLAVAMQQGHDKVVAVLL--ESDTR-----GKVRLPALHIAAKKDDVKAATLLLD------NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV 231          

HSP 7 Score: 56.6102 bits (135), Expect = 8.636e-8
Identity = 53/185 (28.65%), Postives = 79/185 (42.70%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI---WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLA 705
            LH AA K  + I   L++          NAE    +T  H++   G  A + +L++     +N P   G T +HL A     +    L        N+D   +   +TPL  A+  G+ ++V  L+++G   D     G TPLH  A +GH  +V   LE      HK    A   NG T L +A
Sbjct:  605 LHIAARKNQMDIATTLLEYGAL-----ANAESKAGFTPLHLSSQEGH-AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGA---NIDMATK-AGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLE------HKANANAQTVNGQTPLHIA 773          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 88.5817 bits (218), Expect = 1.104e-17
Identity = 89/282 (31.56%), Postives = 128/282 (45.39%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKP--EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G   +V+ L+++    S    N       H+A  G   DA    L  R P  EV         T+ +L A H   HC H       L  N DA  R +  +TPL  A    R+ +VELL+RHG +   T   G TPLH+AA  G + +V Y L+   HD    +  V   G T L LA   ++ +I++ +     + D R  E     Q P HIA+  G++  +  LL+ G+  V+ T    YT LH A   G  ++   L+  GA++   T
Sbjct:  272 LTPLHCAARSGHEQVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEV---------TVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ---HDASPDVPTV--RGETPLHLAARANQTDIIRILLRNGAQVDARARE----QQTPLHIASRLGNVDIVMLLLQHGA-QVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT 532          

HSP 2 Score: 84.3445 bits (207), Expect = 2.464e-16
Identity = 75/274 (27.37%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            LH A+  G+V IV  L   ++  + +D    +++TA H+A   G+D  + ++++     ++    +G T LHL A +G       L        ++DAQ +N   TPL  A  +    +  LL+  G +   T  +G TPLH+AA +  + +    LE G         A    GFT L L+  +   EI   +   E          +   P H+ A   D +N+  +LEK    ++     GYT LH A   G  ++V++LL  GA++   T
Sbjct:  473 LHIASRLGNVDIVMLL---LQHGAQVDATTKDMYTALHIAAKEGQDE-VAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKN-GVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGA-----LANAESKAGFTPLHLSSQEGHAEISNLL--IEHKAAVNHPAKNGLTPMHLCA-QEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT 730          

HSP 3 Score: 75.485 bits (184), Expect = 1.209e-13
Identity = 76/271 (28.04%), Postives = 115/271 (42.44%), Query Frame = 1
Query:  244 NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH---------------DIHKCLTAVDNN---------GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKG-SIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            +NA    A H+A   G    +  L +R+  +++    +G T LH+A+  G+   +  L        +++ Q +N  +TPL  AA     ++V LL+ +G    +   DG TPL +A  +GH  +V   LE                   D+      +DN+         GFT L +A       I   +  K  D   +    ++  P H+AA  G    +  LLEKG +I     D  G T LH A  SGH  +V  LL +GA I  KT
Sbjct:   40 SNANGLNALHLASKDGHIHVVSEL-LRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNA---SVNVQSQN-GFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD-VNYSAKHNIS-PLHVAAKWGKTNMVSLLLEKGGNIEAKTRD--GLTPLHCAARSGHEQVVDMLLERGAPISAKT 301          

HSP 4 Score: 74.3294 bits (181), Expect = 2.991e-13
Identity = 74/275 (26.91%), Postives = 119/275 (43.27%), Query Frame = 1
Query:  145 DTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++ L+ LH AA  G + IV +L+     P       E  T  H+A    +   +  L+    +V  R   +  T LH+A+  G    +  L         +DA  ++M +T L  AA  G+  +  +LI +G A D     G TPLHL A  GH+ + +  L++        + A   NG T L +A   +  ++   + +K   P       +   P HIAA    +     LLE G++A N     G+T LH +   GH +I   L+   A++
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQ-TPLHIASRLGNVDIVMLLLQHGA---QVDATTKDM-YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD-----VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT--AKNGHTPLHIAARKNQMDIATTLLEYGALA-NAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV 660          

HSP 5 Score: 73.1738 bits (178), Expect = 5.924e-13
Identity = 85/294 (28.91%), Postives = 130/294 (44.22%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAE-IWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI-RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +   +  + LH A+  G+  I N LI K    +D++ +A+   +  HVA   GK   + SL++ K   I      G T LH AA  G    +  L    R  P + A+ +N    PL  AA    +    +L+ H    D   VD  T LH+AA  GH+ + K  L+       + L     NGFT L +A  K++ ++V+ + R       T E       P H+AA  G  +NI   L +   + +    RG T LH A  +   DI++ LL  GA +  +   Q+T + I 
Sbjct:  200 VTSKSGFTPLHIASHYGNQNIANLLIQKG---ADVNYSAKHNISPLHVAAKWGKTNMV-SLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML--LERGAP-ISAKTKN-GLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL-----NGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMG-CMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 6 Score: 72.7886 bits (177), Expect = 7.719e-13
Identity = 63/217 (29.03%), Postives = 101/217 (46.54%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVND-----TDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            IN  ++ G   LHLA+  G    +H ++   R    +D+  +    T L  A+  G+  +V+LL+ H  + +V   +G TPL++AA E H  +V+  L  G +      +    +GFT L +A  +  D++V  +   E D R       ++ P  HIAA   D+     LL+      ND     T   G+T LH A   G+ +I   L+ KGA +
Sbjct:   37 INTSNANGLNALHLASKDGH---IHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ-----SLATEDGFTPLAVAMQQGHDKVVAVLL--ESDTR-----GKVRLPALHIAAKKDDVKAATLLLD------NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV 231          

HSP 7 Score: 56.225 bits (134), Expect = 9.471e-8
Identity = 53/185 (28.65%), Postives = 79/185 (42.70%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI---WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLA 705
            LH AA K  + I   L++          NAE    +T  H++   G  A + +L++     +N P   G T +HL A     +    L        N+D   +   +TPL  A+  G+ ++V  L+++G   D     G TPLH  A +GH  +V   LE      HK    A   NG T L +A
Sbjct:  605 LHIAARKNQMDIATTLLEYGAL-----ANAESKAGFTPLHLSSQEGH-AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGA---NIDMATK-AGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLE------HKANANAQTVNGQTPLHIA 773          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303123)

HSP 1 Score: 88.5817 bits (218), Expect = 1.291e-17
Identity = 89/282 (31.56%), Postives = 128/282 (45.39%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKP--EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G   +V+ L+++    S    N       H+A  G   DA    L  R P  EV         T+ +L A H   HC H       L  N DA  R +  +TPL  A    R+ +VELL+RHG +   T   G TPLH+AA  G + +V Y L+   HD    +  V   G T L LA   ++ +I++ +     + D R  E     Q P HIA+  G++  +  LL+ G+  V+ T    YT LH A   G  ++   L+  GA++   T
Sbjct:  272 LTPLHCAARSGHEQVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEV---------TVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ---HDASPDVPTV--RGETPLHLAARANQTDIIRILLRNGAQVDARARE----QQTPLHIASRLGNVDIVMLLLQHGA-QVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT 532          

HSP 2 Score: 83.9593 bits (206), Expect = 3.024e-16
Identity = 76/277 (27.44%), Postives = 126/277 (45.49%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE---KDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            LH A+  G+V IV  L   ++  + +D    +++TA H+A   G+D  + ++++     ++    +G T LHL A +G       L    +   ++DAQ +N   TPL  A  +    +  LL+  G +   T  +G TPLH+AA +  + +    LE G         A    GFT L L+  +   EI   + + +     P    L      P H+ A   D +N+  +LEK    ++     GYT LH A   G  ++V++LL  GA++   T
Sbjct:  473 LHIASRLGNVDIVMLL---LQHGAQVDATTKDMYTALHIAAKEGQDE-VAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL---LQKEADVDAQGKN-GVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGA-----LANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGL-----TPMHLCA-QEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT 730          

HSP 3 Score: 75.485 bits (184), Expect = 1.329e-13
Identity = 76/271 (28.04%), Postives = 116/271 (42.80%), Query Frame = 1
Query:  244 NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH---------------DIHKCLTAVDNN---------GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKG-SIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            +NA    A H+A   G    + S ++R+  +++    +G T LH+A+  G+   +  L        +++ Q +N  +TPL  AA     ++V LL+ +G    +   DG TPL +A  +GH  +V   LE                   D+      +DN+         GFT L +A       I   +  K  D   +    ++  P H+AA  G    +  LLEKG +I     D  G T LH A  SGH  +V  LL +GA I  KT
Sbjct:   40 SNANGLNALHLASKDGHIHVV-SELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNA---SVNVQSQN-GFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD-VNYSAKHNIS-PLHVAAKWGKTNMVSLLLEKGGNIEAKTRD--GLTPLHCAARSGHEQVVDMLLERGAPISAKT 301          

HSP 4 Score: 73.1738 bits (178), Expect = 6.124e-13
Identity = 65/217 (29.95%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVND-----TDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            IN  ++ G   LHLA+  G    +H ++   R    +D+  +    T L  A+  G+  +V+LL+ H  + +V   +G TPL++AA E H  +V+  L  G    ++ L   D  GFT L +A  +  D++V  +   E D R       ++ P  HIAA   D+     LL+      ND     T   G+T LH A   G+ +I   L+ KGA +
Sbjct:   37 INTSNANGLNALHLASKDGH---IHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATED--GFTPLAVAMQQGHDKVVAVLL--ESDTR-----GKVRLPALHIAAKKDDVKAATLLLD------NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV 231          

HSP 5 Score: 72.7886 bits (177), Expect = 7.776e-13
Identity = 74/275 (26.91%), Postives = 119/275 (43.27%), Query Frame = 1
Query:  145 DTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++ L+ LH AA  G + IV +L+     P       E  T  H+A    +   +  L+    +V  R   +  T LH+A+  G    +  L         +DA  ++M +T L  AA  G+  +  +LI +G A D     G TPLHL A  GH+ + +  L++        + A   NG T L +A   +  ++   + +K   P       +   P HIAA    +     LLE G++A N     G+T LH +   GH +I   L+   A++
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQ-QTPLHIASRLGNVDIVMLLLQHGA---QVDATTKDM-YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD-----VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT--AKNGHTPLHIAARKNQMDIATTLLEYGALA-NAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV 660          

HSP 6 Score: 72.4034 bits (176), Expect = 1.066e-12
Identity = 85/294 (28.91%), Postives = 130/294 (44.22%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAE-IWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI-RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +   +  + LH A+  G+  I N LI K    +D++ +A+   +  HVA   GK   + SL++ K   I      G T LH AA  G    +  L    R  P + A+ +N    PL  AA    +    +L+ H    D   VD  T LH+AA  GH+ + K  L+       + L     NGFT L +A  K++ ++V+ + R       T E       P H+AA  G  +NI   L +   + +    RG T LH A  +   DI++ LL  GA +  +   Q+T + I 
Sbjct:  200 VTSKSGFTPLHIASHYGNQNIANLLIQKG---ADVNYSAKHNISPLHVAAKWGKTNMV-SLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML--LERGAP-ISAKTKN-GLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL-----NGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMG-CMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 7 Score: 57.7658 bits (138), Expect = 4.128e-8
Identity = 53/185 (28.65%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI---WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLA 705
            LH AA K  + I   L++          NAE    +T  H++   G  A + +L++     +N P   G T +HL A     +    L    +   N+D   +   +TPL  A+  G+ ++V  L+++G   D     G TPLH  A +GH  +V   LE      HK    A   NG T L +A
Sbjct:  605 LHIAARKNQMDIATTLLEYGAL-----ANAESKAGFTPLHLSSQEGH-AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILE---KNGANIDMATK-AGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLE------HKANANAQTVNGQTPLHIA 773          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303113)

HSP 1 Score: 88.1965 bits (217), Expect = 1.399e-17
Identity = 89/282 (31.56%), Postives = 128/282 (45.39%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGK-DACLESLIMRKP--EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G   +V+ L+++    S    N       H+A  G   DA    L  R P  EV         T+ +L A H   HC H       L  N DA  R +  +TPL  A    R+ +VELL+RHG +   T   G TPLH+AA  G + +V Y L+   HD    +  V   G T L LA   ++ +I++ +     + D R  E     Q P HIA+  G++  +  LL+ G+  V+ T    YT LH A   G  ++   L+  GA++   T
Sbjct:  272 LTPLHCAARSGHEQVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEV---------TVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ---HDASPDVPTV--RGETPLHLAARANQTDIIRILLRNGAQVDARARE----QQTPLHIASRLGNVDIVMLLLQHGA-QVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT 532          

HSP 2 Score: 83.9593 bits (206), Expect = 3.192e-16
Identity = 76/277 (27.44%), Postives = 126/277 (45.49%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE---KDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            LH A+  G+V IV  L   ++  + +D    +++TA H+A   G+D  + ++++     ++    +G T LHL A +G       L    +   ++DAQ +N   TPL  A  +    +  LL+  G +   T  +G TPLH+AA +  + +    LE G         A    GFT L L+  +   EI   + + +     P    L      P H+ A   D +N+  +LEK    ++     GYT LH A   G  ++V++LL  GA++   T
Sbjct:  473 LHIASRLGNVDIVMLL---LQHGAQVDATTKDMYTALHIAAKEGQDE-VAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL---LQKEADVDAQGKN-GVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGA-----LANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGL-----TPMHLCA-QEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT 730          

HSP 3 Score: 75.485 bits (184), Expect = 1.344e-13
Identity = 76/271 (28.04%), Postives = 116/271 (42.80%), Query Frame = 1
Query:  244 NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH---------------DIHKCLTAVDNN---------GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKG-SIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            +NA    A H+A   G    + S ++R+  +++    +G T LH+A+  G+   +  L        +++ Q +N  +TPL  AA     ++V LL+ +G    +   DG TPL +A  +GH  +V   LE                   D+      +DN+         GFT L +A       I   +  K  D   +    ++  P H+AA  G    +  LLEKG +I     D  G T LH A  SGH  +V  LL +GA I  KT
Sbjct:   40 SNANGLNALHLASKDGHIHVV-SELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNA---SVNVQSQN-GFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD-VNYSAKHNIS-PLHVAAKWGKTNMVSLLLEKGGNIEAKTRD--GLTPLHCAARSGHEQVVDMLLERGAPISAKT 301          

HSP 4 Score: 73.1738 bits (178), Expect = 6.352e-13
Identity = 65/217 (29.95%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVND-----TDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            IN  ++ G   LHLA+  G    +H ++   R    +D+  +    T L  A+  G+  +V+LL+ H  + +V   +G TPL++AA E H  +V+  L  G    ++ L   D  GFT L +A  +  D++V  +   E D R       ++ P  HIAA   D+     LL+      ND     T   G+T LH A   G+ +I   L+ KGA +
Sbjct:   37 INTSNANGLNALHLASKDGH---IHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGA---NQSLATED--GFTPLAVAMQQGHDKVVAVLL--ESDTR-----GKVRLPALHIAAKKDDVKAATLLLD------NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV 231          

HSP 5 Score: 72.7886 bits (177), Expect = 8.417e-13
Identity = 74/275 (26.91%), Postives = 119/275 (43.27%), Query Frame = 1
Query:  145 DTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++ L+ LH AA  G + IV +L+     P       E  T  H+A    +   +  L+    +V  R   +  T LH+A+  G    +  L         +DA  ++M +T L  AA  G+  +  +LI +G A D     G TPLHL A  GH+ + +  L++        + A   NG T L +A   +  ++   + +K   P       +   P HIAA    +     LLE G++A N     G+T LH +   GH +I   L+   A++
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQ-QTPLHIASRLGNVDIVMLLLQHGA---QVDATTKDM-YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD-----VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT--AKNGHTPLHIAARKNQMDIATTLLEYGALA-NAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV 660          

HSP 6 Score: 72.4034 bits (176), Expect = 1.144e-12
Identity = 85/294 (28.91%), Postives = 130/294 (44.22%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAE-IWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI-RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +   +  + LH A+  G+  I N LI K    +D++ +A+   +  HVA   GK   + SL++ K   I      G T LH AA  G    +  L    R  P + A+ +N    PL  AA    +    +L+ H    D   VD  T LH+AA  GH+ + K  L+       + L     NGFT L +A  K++ ++V+ + R       T E       P H+AA  G  +NI   L +   + +    RG T LH A  +   DI++ LL  GA +  +   Q+T + I 
Sbjct:  200 VTSKSGFTPLHIASHYGNQNIANLLIQKG---ADVNYSAKHNISPLHVAAKWGKTNMV-SLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML--LERGAP-ISAKTKN-GLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL-----NGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMG-CMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 7 Score: 57.7658 bits (138), Expect = 3.998e-8
Identity = 53/185 (28.65%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEI---WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLA 705
            LH AA K  + I   L++          NAE    +T  H++   G  A + +L++     +N P   G T +HL A     +    L    +   N+D   +   +TPL  A+  G+ ++V  L+++G   D     G TPLH  A +GH  +V   LE      HK    A   NG T L +A
Sbjct:  605 LHIAARKNQMDIATTLLEYGAL-----ANAESKAGFTPLHLSSQEGH-AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILE---KNGANIDMATK-AGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLE------HKANANAQTVNGQTPLHIA 773          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 98.9821 bits (245), Expect = 6.041e-21
Identity = 84/268 (31.34%), Postives = 117/268 (43.66%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRH-GVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVD-------------------------------NNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            +T  H A   G +A L  L++ +   IN  D++G T  H+A  HG+ + +  L     L    D   +    WT L  AAW G + IV+LL++  G   D    DGR+PLHLA+  G   + +  +E G  ++H  LT+ D                                NG TAL LA  K     VK +  +  DP +  +  DL+ P H+AA NG    ++ LL   S   N  D  G T LH A   GH D +  LL  GA
Sbjct:  502 YTPLHFAAQNGDEA-LTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVL-----LSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGA-NVH--LTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPES--VNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGA 758          

HSP 2 Score: 66.6254 bits (161), Expect = 6.127e-11
Identity = 66/241 (27.39%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTP---------------------------------LHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            N  +++G T LH AA          L   +R   N++A+  + Q+TPL +AA +G  ++  LL+    + + TD  GRTP                                 LHLAA +GHL +VK  +++   D+        ++G + L LA  + +  + + +   E         DDL  P H+AA  G   +   LL K    +      G T LH A   GH+  VK LL++GA
Sbjct:  461 NLANAQGATPLHQAAEKRLKGVSEIL--LSRKTTNVNAKDED-QYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADV----DGQTSDGRSPLHLASQRGQYRVARIL--VELGANVHLTSDDLYAPLHVAAETGH-TSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGA 691          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 98.5969 bits (244), Expect = 6.998e-21
Identity = 84/268 (31.34%), Postives = 117/268 (43.66%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRH-GVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVD-------------------------------NNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            +T  H A   G +A L  L++ +   IN  D++G T  H+A  HG+ + +  L     L    D   +    WT L  AAW G + IV+LL++  G   D    DGR+PLHLA+  G   + +  +E G  ++H  LT+ D                                NG TAL LA  K     VK +  +  DP +  +  DL+ P H+AA NG    ++ LL   S   N  D  G T LH A   GH D +  LL  GA
Sbjct:  517 YTPLHFAAQNGDEA-LTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVL-----LSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGA-NVH--LTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPES--VNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGA 773          

HSP 2 Score: 66.6254 bits (161), Expect = 7.465e-11
Identity = 66/241 (27.39%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTP---------------------------------LHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            N  +++G T LH AA          L   +R   N++A+  + Q+TPL +AA +G  ++  LL+    + + TD  GRTP                                 LHLAA +GHL +VK  +++   D+        ++G + L LA  + +  + + +   E         DDL  P H+AA  G   +   LL K    +      G T LH A   GH+  VK LL++GA
Sbjct:  476 NLANAQGATPLHQAAEKRLKGVSEIL--LSRKTTNVNAKDED-QYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADV----DGQTSDGRSPLHLASQRGQYRVARIL--VELGANVHLTSDDLYAPLHVAAETGH-TSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGA 706          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 98.5969 bits (244), Expect = 7.860e-21
Identity = 84/268 (31.34%), Postives = 117/268 (43.66%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRH-GVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVD-------------------------------NNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            +T  H A   G +A L  L++ +   IN  D++G T  H+A  HG+ + +  L     L    D   +    WT L  AAW G + IV+LL++  G   D    DGR+PLHLA+  G   + +  +E G  ++H  LT+ D                                NG TAL LA  K     VK +  +  DP +  +  DL+ P H+AA NG    ++ LL   S   N  D  G T LH A   GH D +  LL  GA
Sbjct:  474 YTPLHFAAQNGDEA-LTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVL-----LSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGA-NVH--LTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPES--VNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGA 730          

HSP 2 Score: 66.2402 bits (160), Expect = 8.071e-11
Identity = 66/241 (27.39%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTP---------------------------------LHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            N  +++G T LH AA          L   +R   N++A+  + Q+TPL +AA +G  ++  LL+    + + TD  GRTP                                 LHLAA +GHL +VK  +++   D+        ++G + L LA  + +  + + +   E         DDL  P H+AA  G   +   LL K    +      G T LH A   GH+  VK LL++GA
Sbjct:  433 NLANAQGATPLHQAAEKRLKGVSEIL--LSRKTTNVNAKDED-QYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADV----DGQTSDGRSPLHLASQRGQYRVARIL--VELGANVHLTSDDLYAPLHVAAETGH-TSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGA 663          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 92.8189 bits (229), Expect = 2.772e-19
Identity = 85/280 (30.36%), Postives = 126/280 (45.00%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH  A  G   +V  L+D+      L       +  H+A  G    C++ LI  +  V +  +    T LH+AA     HC HY     ++L     N +A+  N  +TPL  A    RI ++ELL++HG +       G TP+H+AA  GH  +V      G          ++  G TAL +A    +  +VK++     D        D Q P HI++  G    +Q LL+ G++  + T   GYT LH A   GH D+   LL  GAS+ I T
Sbjct:  301 LTPLHCGARSGHEQVVEMLLDR--GAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDY-LTALHVAA-----HCGHY--KVAKVLVDKRANPNAKALN-GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGA-----SPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKA--KDDQTPLHISSRLGKPDIVQQLLQHGALP-DSTTTSGYTPLHLAARDGHKDVASILLDNGASLGITT 561          

HSP 2 Score: 69.707 bits (169), Expect = 6.446e-12
Identity = 56/180 (31.11%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  472 WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +TPL  AA +G I++  LL+  G A D    +  TPLH+A+  G+  +V+  LE G       + A   +G T L        +++V+ + D+   P   +  + L  P H+ A  GD LN   LL    + V+D  N   T LH A   GH  + K L+ K A+   K L   T + I 
Sbjct:  235 FTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGAR-----IDARTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLS-PLHM-ATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIA 406          

HSP 3 Score: 68.9366 bits (167), Expect = 9.699e-12
Identity = 60/216 (27.78%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNR-GYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            IN  +  G   LHLA+  G    +  +    +L   +DA  +    T L  A+  G+  +V+ L+ +G   +    +G TPL++AA E HL +VK+ L+ G        +    +GFT L +A  +  D++V  + + +   +       ++ P  HIAA   D      LL+    A  D +++ G+T LH A   G+I++   LL++GA++  K
Sbjct:   66 INICNQNGLNALHLASKEGH---VEVVTELIKLGATVDAATKKGN-TALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGS-----SQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGK-------VRLPALHIAARKDDTKAAALLLQNDHNA--DIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFK 263          

HSP 4 Score: 63.5438 bits (153), Expect = 5.207e-10
Identity = 65/218 (29.82%), Postives = 95/218 (43.58%), Query Frame = 1
Query:  358 GCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            G T LH+AA +G  +    L N    +   D + RN   TPL  A+  G  ++V LL+  G   D    DG TPLH  A  GH  +V+  L+ G   + K       NG + L +A        V+ +   E      ++ +D     H+AA  G     + L++K +   N     G+T LH AC    I +++ LL  GASI   T    T I + 
Sbjct:  234 GFTPLHIAAHYGNINVATLLLNRGAAV---DFKARN-DITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-----KNGLSPLHMATQGDHLNCVQLLIHHEVP--VDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANP-NAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVA 439          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 92.8189 bits (229), Expect = 2.850e-19
Identity = 85/280 (30.36%), Postives = 126/280 (45.00%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH  A  G   +V  L+D+      L       +  H+A  G    C++ LI  +  V +  +    T LH+AA     HC HY     ++L     N +A+  N  +TPL  A    RI ++ELL++HG +       G TP+H+AA  GH  +V      G          ++  G TAL +A    +  +VK++     D        D Q P HI++  G    +Q LL+ G++  + T   GYT LH A   GH D+   LL  GAS+ I T
Sbjct:  273 LTPLHCGARSGHEQVVEMLLDR--GAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDY-LTALHVAA-----HCGHY--KVAKVLVDKRANPNAKALN-GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGA-----SPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKA--KDDQTPLHISSRLGKPDIVQQLLQHGALP-DSTTTSGYTPLHLAARDGHKDVASILLDNGASLGITT 533          

HSP 2 Score: 69.3218 bits (168), Expect = 7.478e-12
Identity = 56/180 (31.11%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  472 WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +TPL  AA +G I++  LL+  G A D    +  TPLH+A+  G+  +V+  LE G       + A   +G T L        +++V+ + D+   P   +  + L  P H+ A  GD LN   LL    + V+D  N   T LH A   GH  + K L+ K A+   K L   T + I 
Sbjct:  207 FTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGAR-----IDARTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLS-PLHM-ATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIA 378          

HSP 3 Score: 68.9366 bits (167), Expect = 8.902e-12
Identity = 60/216 (27.78%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNR-GYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            IN  +  G   LHLA+  G    +  +    +L   +DA  +    T L  A+  G+  +V+ L+ +G   +    +G TPL++AA E HL +VK+ L+ G        +    +GFT L +A  +  D++V  + + +   +       ++ P  HIAA   D      LL+    A  D +++ G+T LH A   G+I++   LL++GA++  K
Sbjct:   38 INICNQNGLNALHLASKEGH---VEVVTELIKLGATVDAATKKGN-TALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGS-----SQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGK-------VRLPALHIAARKDDTKAAALLLQNDHNA--DIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFK 235          

HSP 4 Score: 63.1586 bits (152), Expect = 5.349e-10
Identity = 65/218 (29.82%), Postives = 94/218 (43.12%), Query Frame = 1
Query:  358 GCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            G T LH+AA +G  +    L N    +   D + RN   TPL  A+  G  ++V LL+  G   D    DG TPLH  A  GH  +V+  L+ G   + K       NG + L +A        V+ +   E      ++ +D     H+AA  G     + L++K     N     G+T LH AC    I +++ LL  GASI   T    T I + 
Sbjct:  206 GFTPLHIAAHYGNINVATLLLNRGAAV---DFKARN-DITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-----KNGLSPLHMATQGDHLNCVQLLIHHEVP--VDDVTNDYLTALHVAAHCGHYKVAKVLVDK-RANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVA 411          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE-5741151])

HSP 1 Score: 176.022 bits (445), Expect = 9.148e-48
Identity = 107/305 (35.08%), Postives = 165/305 (54.10%), Query Frame = 1
Query:   97 AVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
             + D DP+            + LHWAA  GS+  +++L+      SD+      WTAAH+A I G+DAC+++LI+   ++  + D R C   HLAAAHG       L +  R   ++++  R   W P+ YAA+HGR+  ++LL R G   +  D++G  P HLAA EGHL  +K+ + +    + + L A + NG T   LA    KD IV+YI   E +    +  ++L +P H+AA  GDL+ ++ L+E G I +N+ D++G T LHKA   G ++ ++WLL  GA   I     ET  D+ 
Sbjct:   13 GINDPDPLH---------KFTPLHWAAHSGSLECLHWLLWHGADVSDVTTRG--WTAAHLAAIRGQDACMQALIVNGADLSAK-DDRHCCPAHLAAAHGHSFT---LQSVLRSGVDINSSDRT-GWKPVHYAAFHGRLGCLQLLFRWGATLEDADLNGNIPAHLAAMEGHLHCLKFLVSKAS-SVTRVLEATNMNGETPKDLARKLYKDNIVQYIDGVEYERDHPDEQENLAFPAHVAAFKGDLVTLRKLVESGIININERDDKGATPLHKAAGQGQLECLQWLLEMGADYNITNEAGETPKDVA 300          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE-5741151])

HSP 1 Score: 176.022 bits (445), Expect = 1.207e-47
Identity = 107/305 (35.08%), Postives = 165/305 (54.10%), Query Frame = 1
Query:   97 AVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
             + D DP+            + LHWAA  GS+  +++L+      SD+      WTAAH+A I G+DAC+++LI+   ++  + D R C   HLAAAHG       L +  R   ++++  R   W P+ YAA+HGR+  ++LL R G   +  D++G  P HLAA EGHL  +K+ + +    + + L A + NG T   LA    KD IV+YI   E +    +  ++L +P H+AA  GDL+ ++ L+E G I +N+ D++G T LHKA   G ++ ++WLL  GA   I     ET  D+ 
Sbjct:   13 GINDPDPLH---------KFTPLHWAAHSGSLECLHWLLWHGADVSDVTTRG--WTAAHLAAIRGQDACMQALIVNGADLSAK-DDRHCCPAHLAAAHGHSFT---LQSVLRSGVDINSSDRT-GWKPVHYAAFHGRLGCLQLLFRWGATLEDADLNGNIPAHLAAMEGHLHCLKFLVSKAS-SVTRVLEATNMNGETPKDLARKLYKDNIVQYIDGVEYERDHPDEQENLAFPAHVAAFKGDLVTLRKLVESGIININERDDKGATPLHKAAGQGQLECLQWLLEMGADYNITNEAGETPKDVA 300          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE-5741151])

HSP 1 Score: 175.637 bits (444), Expect = 2.968e-47
Identity = 109/314 (34.71%), Postives = 170/314 (54.14%), Query Frame = 1
Query:   97 AVKDIDPVEIRKIIMEDTDL---------SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            AV+  D  ++  I+   T +         + LHWAA  GS+  +++L+      SD+      WTAAH+A I G+DAC+++LI+   ++  + D R C   HLAAAHG       L +  R   ++++  R   W P+ YAA+HGR+  ++LL R G   +  D++G  P HLAA EGHL  +K+ + +    + + L A + NG T   LA    KD IV+YI   E +    +  ++L +P H+AA  GDL+ ++ L+E G I +N+ D++G T LHKA   G ++ ++WLL  GA   I     ET  D+ 
Sbjct:   25 AVRGGDVEQLAAIVQSGTGINDPDPLHKFTPLHWAAHSGSLECLHWLLWHGADVSDVTTRG--WTAAHLAAIRGQDACMQALIVNGADLSAK-DDRHCCPAHLAAAHGHSFT---LQSVLRSGVDINSSDRT-GWKPVHYAAFHGRLGCLQLLFRWGATLEDADLNGNIPAHLAAMEGHLHCLKFLVSKAS-SVTRVLEATNMNGETPKDLARKLYKDNIVQYIDGVEYERDHPDEQENLAFPAHVAAFKGDLVTLRKLVESGIININERDDKGATPLHKAAGQGQLECLQWLLEMGADYNITNEAGETPKDVA 330          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE-5741151])

HSP 1 Score: 175.252 bits (443), Expect = 4.240e-47
Identity = 109/314 (34.71%), Postives = 170/314 (54.14%), Query Frame = 1
Query:   97 AVKDIDPVEIRKIIMEDTDL---------SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            AV+  D  ++  I+   T +         + LHWAA  GS+  +++L+      SD+      WTAAH+A I G+DAC+++LI+   ++  + D R C   HLAAAHG       L +  R   ++++  R   W P+ YAA+HGR+  ++LL R G   +  D++G  P HLAA EGHL  +K+ + +    + + L A + NG T   LA    KD IV+YI   E +    +  ++L +P H+AA  GDL+ ++ L+E G I +N+ D++G T LHKA   G ++ ++WLL  GA   I     ET  D+ 
Sbjct:   25 AVRGGDVEQLAAIVQSGTGINDPDPLHKFTPLHWAAHSGSLECLHWLLWHGADVSDVTTRG--WTAAHLAAIRGQDACMQALIVNGADLSAK-DDRHCCPAHLAAAHGHSFT---LQSVLRSGVDINSSDRT-GWKPVHYAAFHGRLGCLQLLFRWGATLEDADLNGNIPAHLAAMEGHLHCLKFLVSKAS-SVTRVLEATNMNGETPKDLARKLYKDNIVQYIDGVEYERDHPDEQENLAFPAHVAAFKGDLVTLRKLVESGIININERDDKGATPLHKAAGQGQLECLQWLLEMGADYNITNEAGETPKDVA 330          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE-5741151])

HSP 1 Score: 120.939 bits (302), Expect = 1.362e-28
Identity = 78/224 (34.82%), Postives = 120/224 (53.57%), Query Frame = 1
Query:   97 AVKDIDPVEIRKIIMEDTDL---------SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI 741
            AV+  D  ++  I+   T +         + LHWAA  GS+  +++L+      SD+      WTAAH+A I G+DAC+++LI+   ++  + D R C   HLAAAHG       L +  R   ++++  R   W P+ YAA+HGR+  ++LL R G   +  D++G  P HLAA EGHL  +K+ + +    + + L A + NG T   LA    KD IV+YI
Sbjct:   25 AVRGGDVEQLAAIVQSGTGINDPDPLHKFTPLHWAAHSGSLECLHWLLWHGADVSDVTTRG--WTAAHLAAIRGQDACMQALIVNGADLSAK-DDRHCCPAHLAAAHGHSFT---LQSVLRSGVDINSSDRT-GWKPVHYAAFHGRLGCLQLLFRWGATLEDADLNGNIPAHLAAMEGHLHCLKFLVSKAS-SVTRVLEATNMNGETPKDLARKLYKDNIVQYI 240          

HSP 2 Score: 51.9878 bits (123), Expect = 2.312e-6
Identity = 53/178 (29.78%), Postives = 79/178 (44.38%), Query Frame = 1
Query:  469 QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGR--TPLHLAAAEGHLPLVKYFLEEGC-----HDIHKC---LTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRT-WELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++TPL +AA  G +  +  L+ HG   DV+DV  R  T  HLAA  G    ++  +  G       D H C   L A   + FT            +++   D     RT W+       P H AA +G L  +Q L   G+  + D D  G    H A + GH+  +K+L+SK +S+
Sbjct:   52 KFTPLHWAAHSGSLECLHWLLWHGA--DVSDVTTRGWTAAHLAAIRGQDACMQALIVNGADLSAKDDRHCCPAHLAAAHGHSFTL---------QSVLRSGVDINSSDRTGWK-------PVHYAAFHGRLGCLQLLFRWGAT-LEDADLNGNIPAHLAAMEGHLHCLKFLVSKASSV 210          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Mouse
Match: Ankrd42 (ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MGI:1921095])

HSP 1 Score: 182.185 bits (461), Expect = 2.456e-51
Identity = 112/336 (33.33%), Postives = 178/336 (52.98%), Query Frame = 1
Query:   19 EYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTD----LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            E  + S ++++ F+ I    DA     VK +  +  R   + + D     + LHWAA  GS+  +++L+               WTAAH+A I G+DACL++LI+    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YA++HGR+  ++LL++ G   +  D +G  P+HLAA EGHL  +K+ L    +   + L A ++NG   L LA+   K  +V++I+  + +    +  DDL +PGH+AA  GDL  ++ L+  G I +N+ D+ G T +HKA   GHID ++WL+  GA   I     ET  D+ 
Sbjct:   15 ETADSSSRKKVHFSSI---HDAVRAGDVKQLSDIVERGANLNEVDALHQFTPLHWAAHSGSLECLHWLL--WSGADATQTTTRGWTAAHIAAIRGQDACLQALIINGANLATQ-DDRGCTPLHLAATHGHSFSLQIM-----LRSGVDPSVTDKREWKPVHYASFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCLKFLLSR-MNSATQALKAFNDNGENVLDLAQRFLKQNVVEFIQGAQYEGSHPDDHDDLAFPGHVAAFKGDLEVLKKLIGDGVINLNERDDNGSTPMHKAAGQGHIDCLQWLIEMGAESNITNKAGETPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Mouse
Match: Ankrd42 (ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MGI:1921095])

HSP 1 Score: 181.8 bits (460), Expect = 5.373e-51
Identity = 112/336 (33.33%), Postives = 178/336 (52.98%), Query Frame = 1
Query:   19 EYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTD----LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            E  + S ++++ F+ I    DA     VK +  +  R   + + D     + LHWAA  GS+  +++L+               WTAAH+A I G+DACL++LI+    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YA++HGR+  ++LL++ G   +  D +G  P+HLAA EGHL  +K+ L    +   + L A ++NG   L LA+   K  +V++I+  + +    +  DDL +PGH+AA  GDL  ++ L+  G I +N+ D+ G T +HKA   GHID ++WL+  GA   I     ET  D+ 
Sbjct:   15 ETADSSSRKKVHFSSI---HDAVRAGDVKQLSDIVERGANLNEVDALHQFTPLHWAAHSGSLECLHWLL--WSGADATQTTTRGWTAAHIAAIRGQDACLQALIINGANLATQ-DDRGCTPLHLAATHGHSFSLQIM-----LRSGVDPSVTDKREWKPVHYASFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCLKFLLSR-MNSATQALKAFNDNGENVLDLAQRFLKQNVVEFIQGAQYEGSHPDDHDDLAFPGHVAAFKGDLEVLKKLIGDGVINLNERDDNGSTPMHKAAGQGHIDCLQWLIEMGAESNITNKAGETPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Mouse
Match: Ankrd42 (ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MGI:1921095])

HSP 1 Score: 185.267 bits (469), Expect = 9.361e-51
Identity = 112/336 (33.33%), Postives = 178/336 (52.98%), Query Frame = 1
Query:   19 EYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTD----LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            E  + S ++++ F+ I    DA     VK +  +  R   + + D     + LHWAA  GS+  +++L+               WTAAH+A I G+DACL++LI+    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YA++HGR+  ++LL++ G   +  D +G  P+HLAA EGHL  +K+ L    +   + L A ++NG   L LA+   K  +V++I+  + +    +  DDL +PGH+AA  GDL  ++ L+  G I +N+ D+ G T +HKA   GHID ++WL+  GA   I     ET  D+ 
Sbjct:   15 ETADSSSRKKVHFSSI---HDAVRAGDVKQLSDIVERGANLNEVDALHQFTPLHWAAHSGSLECLHWLL--WSGADATQTTTRGWTAAHIAAIRGQDACLQALIINGANLATQ-DDRGCTPLHLAATHGHSFSLQIM-----LRSGVDPSVTDKREWKPVHYASFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCLKFLLSR-MNSATQALKAFNDNGENVLDLAQRFLKQNVVEFIQGAQYEGSHPDDHDDLAFPGHVAAFKGDLEVLKKLIGDGVINLNERDDNGSTPMHKAAGQGHIDCLQWLIEMGAESNITNKAGETPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Mouse
Match: Ankrd42 (ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MGI:1921095])

HSP 1 Score: 185.267 bits (469), Expect = 1.104e-50
Identity = 112/336 (33.33%), Postives = 178/336 (52.98%), Query Frame = 1
Query:   19 EYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTD----LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            E  + S ++++ F+ I    DA     VK +  +  R   + + D     + LHWAA  GS+  +++L+               WTAAH+A I G+DACL++LI+    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YA++HGR+  ++LL++ G   +  D +G  P+HLAA EGHL  +K+ L    +   + L A ++NG   L LA+   K  +V++I+  + +    +  DDL +PGH+AA  GDL  ++ L+  G I +N+ D+ G T +HKA   GHID ++WL+  GA   I     ET  D+ 
Sbjct:   15 ETADSSSRKKVHFSSI---HDAVRAGDVKQLSDIVERGANLNEVDALHQFTPLHWAAHSGSLECLHWLL--WSGADATQTTTRGWTAAHIAAIRGQDACLQALIINGANLATQ-DDRGCTPLHLAATHGHSFSLQIM-----LRSGVDPSVTDKREWKPVHYASFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCLKFLLSR-MNSATQALKAFNDNGENVLDLAQRFLKQNVVEFIQGAQYEGSHPDDHDDLAFPGHVAAFKGDLEVLKKLIGDGVINLNERDDNGSTPMHKAAGQGHIDCLQWLIEMGAESNITNKAGETPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 93.5893 bits (231), Expect = 2.456e-19
Identity = 90/294 (30.61%), Postives = 137/294 (46.60%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC---------LTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG----HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI-----WIKT 981
            LH AA  G + +V  L++      ++D  N    TA H+A   G+DA +  LI     V N+P++ G T LH AAA  HG   C+  L N      +++ Q ++ + +PL   A HGR +  + LI++G   D  D DG TPLH+AA  GH  L+   +  G  D  KC         L A++ +     KL  +  K  IV    ++      +E+ D     G    H AA  G++  I+ LL+      +  D  G T LH A  + H   +K L++ GA++     W +T
Sbjct:    7 LHAAASNGQISVVKHLLN---LGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANV-NQPNNSGFTPLHFAAASTHGAL-CLELLVNNG---ADVNIQSKDGK-SPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGA-DTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGFEI-DTPDTFGRTCLHAAAAGGNVECIK-LLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRT 288          

HSP 2 Score: 71.633 bits (174), Expect = 1.968e-12
Identity = 79/278 (28.42%), Postives = 125/278 (44.96%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHG---VATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE-----KDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVND-----TDNRGYTMLHKACISGHIDIVKWLLSK 957
            +H+AA  G    +  L+++     +  +   + +  H+A   G    LE L+    ++  R D +G T L+LAA  G   C+  L N    +   D      + TPL  +  +G    + LL+         DV D  G+TPL LA A GH+  V   LE+  +     + AVD  G TAL        +E V+ + ++E     KD R        + P H AA  G    +  LL+   IA+++      DN+GYT LH AC +G+ + ++ LL +
Sbjct:  351 IHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIR-DEKGRTALYLAAFKGHTECVEALVNQGASIFVKD---NVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEAN-----VDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRG-------RTPLHYAAARGHATWLNELLQ---IALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQ 609          

HSP 3 Score: 69.707 bits (169), Expect = 8.014e-12
Identity = 79/286 (27.62%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKME--FPSDLDNNAEIWTAAHVAVIGGKDACLESLI--MRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSI---AVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            I ++   + L+ AA KG    V  L+++    F  D   N    T  H +VI G   CL  L+     PEV++  D++G T L LA A+G    +  L      +  +D     +  T L      G    V++L+    +    D  GRTPLH AAA GH   +   L+    +   CL   DN G+T L  A     +  ++ + ++    + +  F    + P H A +NG       LL  G+I    V+  D++G T LH A    H + ++ LL   A +
Sbjct:  410 IRDEKGRTALYLAAFKGHTECVEALVNQGASIFVKD---NVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDI----VGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLK--DNQGYTPLHWACYNGNENCIEVLLEQ----KCFRKFIGNPFTPLHCAIINGHESCASLLL--GAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQV 680          

HSP 4 Score: 67.781 bits (164), Expect = 2.745e-11
Identity = 76/261 (29.12%), Postives = 114/261 (43.68%), Query Frame = 1
Query:  232 SDLDNNAEIWTAAH--------VAVIGGKDA--CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDN-NGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            SD+D N  I   AH           +  KDA  CLE L+        R D  G   +H AAA+G   C+  L    R     +        +PL  AA++G    +E+L++  V  D+ D  GRT L+LAA +GH   V+  + +G     K     DN    T L  +        ++ + +   +P   ++ D   Q P  +A   G +  +  LLEK    V+  D  G T LH+  ++GH + V+ LL + ASI  K
Sbjct:  296 SDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIR-DKEGYNSIHYAAAYGHRQCLELL--LERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVK-----DNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEK-EANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCK 547          

HSP 5 Score: 65.855 bits (159), Expect = 1.371e-10
Identity = 49/165 (29.70%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  472 WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEI-VKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            +TPL  AA +G+IS+V+ L+  GV  D  +V G T LH+A   G   +V   ++ G +     +   +N+GFT L  A   +   + ++ + +   D        D + P H+ AV+G     Q L++ G   ++  D  G T LH A   GH  ++  L++ GA
Sbjct:    4 YTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGAN-----VNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQS--KDGKSPLHMTAVHGRFTRSQTLIQNGG-EIDCVDKDGNTPLHVAARHGHELLINTLITSGA 160          

HSP 6 Score: 65.0846 bits (157), Expect = 2.398e-10
Identity = 71/240 (29.58%), Postives = 106/240 (44.17%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDL---DNNAEIWTAAHVAVIGGKDACLESLIMRKP--EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHG-RISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDD-LQYPGHIAAVNGDLLNIQGLLEKGS 861
            LH+AA +G    +N L+       D    DN    +T  H A   G + C+E L+ +K   + I  P     T LH A  +G   C   L     + P++   CR+ +    ++AA  G     ++LL+RH    +  D  G+T L +AA  G    V   +     D    LT  D +  T L LA +K  ++    I DK +D       +  LQ P HIAA NG  + ++ LL KG+
Sbjct:  555 LHYAAARGHATWLNELLQIALSEEDCCLKDNQG--YTPLHWACYNGNENCIEVLLEQKCFRKFIGNP----FTPLHCAIINGHESCASLL--LGAIDPSI-VSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQAD----LTVKDKDLNTPLHLAISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGA 781          

HSP 7 Score: 62.7734 bits (151), Expect = 1.260e-9
Identity = 65/239 (27.20%), Postives = 103/239 (43.10%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHK---------------CL----------TAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            I+ PD+ G T LH AAA G   C+  L +        D   R    TPL YAA +     ++ L+  G   + TD  GRT LH AAA   +   K  L    HD  +               CL          +  D  G+ ++  A      + ++ + ++            L+ P H+AA NG    ++ LL+   + ++  D +G T L+ A   GH + V+ L+++GASI++K
Sbjct:  213 IDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGR----TPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASD-MDRNKMILGNA-HDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQS-LVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVK 444          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. UniProt/SwissProt
Match: sp|Q3V096|ANR42_MOUSE (Ankyrin repeat domain-containing protein 42 OS=Mus musculus OX=10090 GN=Ankrd42 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 7.724e-50
Identity = 112/336 (33.33%), Postives = 178/336 (52.98%), Query Frame = 1
Query:   19 EYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTD----LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            E  + S ++++ F+ I    DA     VK +  +  R   + + D     + LHWAA  GS+  +++L+               WTAAH+A I G+DACL++LI+    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YA++HGR+  ++LL++ G   +  D +G  P+HLAA EGHL  +K+ L    +   + L A ++NG   L LA+   K  +V++I+  + +    +  DDL +PGH+AA  GDL  ++ L+  G I +N+ D+ G T +HKA   GHID ++WL+  GA   I     ET  D+ 
Sbjct:   15 ETADSSSRKKVHFSSI---HDAVRAGDVKQLSDIVERGANLNEVDALHQFTPLHWAAHSGSLECLHWLL--WSGADATQTTTRGWTAAHIAAIRGQDACLQALIINGANLATQ-DDRGCTPLHLAATHGHSFSLQIM-----LRSGVDPSVTDKREWKPVHYASFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCLKFLLSR-MNSATQALKAFNDNGENVLDLAQRFLKQNVVEFIQGAQYEGSHPDDHDDLAFPGHVAAFKGDLEVLKKLIGDGVINLNERDDNGSTPMHKAAGQGHIDCLQWLIEMGAESNITNKAGETPSDVA 338          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. UniProt/SwissProt
Match: sp|Q8N9B4|ANR42_HUMAN (Ankyrin repeat domain-containing protein 42 OS=Homo sapiens OX=9606 GN=ANKRD42 PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 1.192e-43
Identity = 93/252 (36.90%), Postives = 142/252 (56.35%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            WTA+H+A I G+DAC+++LIM    +  + D RGCT LHLAA HG    +  +     L   +D    +  +W P+ YAA+HGR+  ++LL++ G + +  D +G  P+HLAA EGHL   K FL        + L A ++NG   L LA+   K  I+++I+  E + +  E  + L +PGH+AA  GDL  ++ L+E G I +N+  + G T +HKA   GHI+ ++WL+  GA   I     E   D+ 
Sbjct:   66 WTASHIAAIRGQDACVQALIMNGANLTAQ-DDRGCTPLHLAATHGHSFTLQIM-----LRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFK-FLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVA 310          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. UniProt/SwissProt
Match: sp|Q54KA7|SECG_DICDI (Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.485e-19
Identity = 90/304 (29.61%), Postives = 130/304 (42.76%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDK--MEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRK--PEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEG----CHDI-------HKCLTA-----------------VDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            L WA+ +G +  +  L++K  ++  +  D N    T  H A +     C+  L+  K  P  +    + G T LH A+A G   C+  L      +  +D  C     TPL  A++ G  S V LL++ G   D  D+ G +PLH AA+ G++  V+  +  G    C DI       H C                    VD  G T L  A      E+ +Y+     DP   +  D  Q    H+AA NG LL++  LL +    +N  D  G T LHKA  +GH    K L+ KGA I I
Sbjct:  106 LQWASSRGHLECIKLLVEKGGVDVNTKDDKNG---TPLHKASLFASAECVLYLLNGKADPRAVT---TNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDC----ITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLL--YLDPTMIDCRDSRQSTSLHLAAFNG-LLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICI 396          

HSP 2 Score: 84.7297 bits (208), Expect = 1.361e-15
Identity = 58/165 (35.15%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            TPL +AA+ G  + V  L+      ++ D  G TPL  A++ GHL  +K  +E+G  D++   T  D NG T L  A   +  E V Y+ + + DPR   +  + + P H A+  G+   ++ LL K    VN  DN   T LH+A  SGH   V  LL KGA +
Sbjct:   71 TPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVN---TKDDKNG-TPLHKASLFASAECVLYLLNGKADPRA--VTTNGETPLHHASAGGNPQCVE-LLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKV 228          

HSP 3 Score: 77.0258 bits (188), Expect = 3.491e-13
Identity = 96/306 (31.37%), Postives = 133/306 (43.46%), Query Frame = 1
Query:   88 FKRAVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDE-IVKYIRDKEKDPRTWELFDDL-QYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQET 996
             K+  K +DP +I  I       S LH AA  G V  V  L+   E  + +D   E  T  H     G     + LI    + IN  D  G T LH AA +G      YL     L P +   CR+  Q T L  AA++G + +V+LLIR+    ++ D +G TPLH A+  GH    K  +++G       +  VD+ G T L  A    + + +   IR   +     E+ D     P H AA NG     + LL+KG+  VN  D    T LH A  +G  D V  L+   A I  K    +T
Sbjct:  222 LKKGAK-VDPRDIHGI-------SPLHNAASAGYVDCVEQLVRNGENINCVD--IEGVTPLHHTCFNGNLQLTKRLIELGAK-INMVDEMGETPLHKAAFNGHKEVCEYL---LYLDPTM-IDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAP-----ICIVDSQGATPLHKAAFNGRSKCLATLIRSGAE----LEVKDSQGGTPLHNAAYNGHSDCCRILLKKGA-NVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKT 502          

HSP 4 Score: 58.151 bits (139), Expect = 2.206e-7
Identity = 57/207 (27.54%), Postives = 89/207 (43.00%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH-DIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE 753
            I ++   + LH A+  G       L+DK      +D  ++  T  H A   G+  CL +LI    E +   DS+G T LH AA +G   C   L      +  +D        TPL  A+  G    V++LI+     D  +  G+TPL  A  + H  + +  +  G   D     ++VD   FT  K   T++ DEI + +  +E
Sbjct:  363 IKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVD--SQGATPLHKAAFNGRSKCLATLIRSGAE-LEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSS----TPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGADLDQVSLRSSVD---FT--KTFGTENHDEIYQIVNKRE 557          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. UniProt/SwissProt
Match: sp|Q5F478|ANR44_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus OX=9031 GN=ANKRD44 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.081e-18
Identity = 90/286 (31.47%), Postives = 133/286 (46.50%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFL------IDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI-----WIKT 981
            LH AA  G + IV  L      ID+M    +        TA H+A   G+D+ +  LI     V N+P++ G T LH AAA  HG   C+  L N      +++ Q ++ + +PL   A HGR +  + LI++G   D  D DG TPLH+AA  GH  L+   +  G  D  KC     +N F  L LA   +  +  + +     +  T + F       H AA  G++  I+ LL+      N  D RG T LH A  + H   ++ L++ GA+I     W +T
Sbjct:  210 LHAAASNGQINIVKHLLNLGVEIDEMNIYGN--------TALHIACYNGQDSVVNELIDYGANV-NQPNNNGFTPLHFAAASTHGAL-CLELLVNNG---ADVNIQSKDGK-SPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGA-DTAKCGI---HNMFP-LHLAALNAHSDCCRKLLSSGFEIDTPDSFGRTCL--HAAAAGGNVECIK-LLQSSGADFNKKDKRGRTPLHYAAANCHFHCIETLVTTGANINETDDWGRT 473          

HSP 2 Score: 78.1814 bits (191), Expect = 1.430e-13
Identity = 81/284 (28.52%), Postives = 127/284 (44.72%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE-----KDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVND-----TDNRGYTMLHKACISGHIDIVKWLLSK 957
            I +    + +H+AA  G    +  L++K     +  +++   +  H+A   G    LE L+    + ++  D +G T L LAA  G   C+  L +    +   D      + TPL  +  +G    + LL+      DVTD  G+TPL LA A GH+  V   LE+        + A D  G TAL        +E V+ + +KE     KD R        + P H AA  G    +  LL+   IA+++      DN+GYT LH AC +GH + ++ LL +
Sbjct:  527 IQDKEGYNTVHYAAAYGHRQCLELLLEKNSNMFEESDSSATKSPLHLAAYNGHHQALEVLLQSLVD-LDIKDEKGRTALDLAAFKGHAECVEALISQGASVTVKD---NVTKRTPLHASVINGHTPCLRLLLEVADNPDVTDAKGQTPLMLAVAYGHIDAVSLLLEK-----EASVDAADLLGCTALHRGIMTGHEECVQMLLEKEVSILCKDARG-------RTPLHFAAARGHATWLSELLQ---IALSEEDCSLKDNQGYTPLHWACYNGHENCIEVLLEQ 791          

HSP 3 Score: 75.0998 bits (183), Expect = 1.281e-12
Identity = 93/371 (25.07%), Postives = 143/371 (38.54%), Query Frame = 1
Query:   55 FAYITADDDARFKRAVKDIDPVEIRKIIMEDTDLSLL--------HWAALKGSVVIVNFLI---------DKM---------------------EFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEG-----------------CH-----------DIHKCLTAVDNNGFTALKLAETKSKDEI-VKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
             A +   D     +A+   DP EIR +I +  D++ L        H A+  G   I+  LI         D M                     +  +D++   + W T  HVA       C E +I+     +N  D  G T LH AA +G    ++ L      +   D + R      L +AA+ G + +V LLI HG      D  G TPLH AA+ G + +VK+ L  G                 C+           D    +   +NNGFT L  A   +   + ++ + +   D        D + P H+ AV+G     Q L++ G   ++  D  G T LH A   GH  ++  L++ GA
Sbjct:    1 MAVLKLADQPPLVQAIFSGDPEEIRMLIYKTEDVNALDAEKRTPLHVASFLGDADIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKALKCAE-IIIPMLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRR----ALHWAAYMGHLEVVALLINHGAEVTCKDKKGYTPLHAAASNGQINIVKHLLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQS--KDGKSPLHMTAVHGRFTRSQTLIQNGG-EIDCVDKDGNTPLHVAARYGHELLINTLITSGA 363          

HSP 4 Score: 73.1738 bits (178), Expect = 5.336e-12
Identity = 83/301 (27.57%), Postives = 125/301 (41.53%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAA---------------------------EGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDD--LQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            LH AA  G  +++N LI      +            H+A +     C   L+    E I+ PDS G T LH AAA G   C+  L +        D + R    TPL YAA +     +E L+  G   + TD  GRTPLH AAA                           E    L   FL +  +D +  +   D  G+  +  A      + ++ +   EK+   +E  D    + P H+AA NG    ++ LL+   + ++  D +G T L  A   GH + V+ L+S+GAS+ +K
Sbjct:  343 LHVAARYGHELLINTLITSGADTAKC--GIHNMFPLHLAALNAHSDCCRKLLSSGFE-IDTPDSFGRTCLHAAAAGGNVECIKLLQSSGADFNKKDKRGR----TPLHYAAANCHFHCIETLVTTGANINETDDWGRTPLHYAAASDMDRKKNILGNSHENAEELERTSEMKEKEAALCLEFLLQ--NDANPSIQ--DKEGYNTVHYAAAYGHRQCLELLL--EKNSNMFEESDSSATKSPLHLAAYNGHHQALEVLLQS-LVDLDIKDEKGRTALDLAAFKGHAECVEALISQGASVTVK 629          

HSP 5 Score: 71.2478 bits (173), Expect = 1.838e-11
Identity = 81/289 (28.03%), Postives = 125/289 (43.25%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPD---SRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFL-----EEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSI---AVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            I ++   + L  AA KG    V  LI +    + + +N    T  H +VI G   CL  L+    EV + PD   ++G T L LA A+G    +  L      +   D     +  T L      G    V++L+   V+    D  GRTPLH AAA GH   +   L     EE C       +  DN G+T L  A     +  ++ + +++      + + +   P H A +N D  N   +L  G+I    VN  D++G T LH A  + H++ ++ LLS  A +
Sbjct:  595 IKDEKGRTALDLAAFKGHAECVEALISQGASVT-VKDNVTKRTPLHASVINGHTPCLRLLL----EVADNPDVTDAKGQTPLMLAVAYGHIDAVSLLLEKEASVDAADL----LGCTALHRGIMTGHEECVQMLLEKEVSILCKDARGRTPLHFAAARGHATWLSELLQIALSEEDC-------SLKDNQGYTPLHWACYNGHENCIEVLLEQK---FFRKFYGNSFSPLHCAVIN-DHENCASML-IGAIDASIVNCKDDKGRTPLHAAAFADHVECLQLLLSHSAQV 862          

HSP 6 Score: 67.781 bits (164), Expect = 2.674e-10
Identity = 71/251 (28.29%), Postives = 118/251 (47.01%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFL--IDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ----WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDD-LQYPGHIAAVNGDLLNIQGLLEKGS--IAVNDTDNR 888
            LH+AA +G    ++ L  I   E    L +N + +T  H A   G + C+E L+ +K     +      + LH A  +   +C       + L+  +DA   N +     TPL  AA+   +  ++LL+ H    +  D  G+T L +AA  GH+  V + +     D    LT  D +  T+L LA +K  ++    I DK ++       ++ LQ P HIAA NG  + ++ LL KG+  +AV++  +R
Sbjct:  737 LHFAAARGHATWLSELLQIALSEEDCSLKDN-QGYTPLHWACYNGHENCIEVLLEQK--FFRKFYGNSFSPLHCAVINDHENCA------SMLIGAIDASIVNCKDDKGRTPLHAAAFADHVECLQLLLSHSAQVNAVDHAGKTALMMAAQNGHVGAVDFLVNIAKAD----LTLRDKDSNTSLHLASSKGHEKCALLILDKIQEQSLINAKNNSLQTPLHIAARNGLKMVVEELLAKGACVLAVDENVSR 974          

HSP 7 Score: 65.855 bits (159), Expect = 1.054e-9
Identity = 65/230 (28.26%), Postives = 103/230 (44.78%), Query Frame = 1
Query:  301 CLESLIMR--KPEVINRPDSRGCTLLHLAAAHGRYHCMHYL-ANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDN-NGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            CLE L+     P +    D  G   +H AAA+G   C+  L    + +    D+       +PL  AA++G    +E+L++  V  D+ D  GRT L LAA +GH   V+  + +G       +T  DN    T L  +        ++ + +   +P   +     Q P  +A   G +  +  LLEK   +V+  D  G T LH+  ++GH + V+ LL K  SI  K
Sbjct:  514 CLEFLLQNDANPSI---QDKEGYNTVHYAAAYGHRQCLELLLEKNSNMFEESDSSATK---SPLHLAAYNGHHQALEVLLQSLVDLDIKDEKGRTALDLAAFKGHAECVEALISQG-----ASVTVKDNVTKRTPLHASVINGHTPCLRLLLEVADNPDVTDAKG--QTPLMLAVAYGHIDAVSLLLEK-EASVDAADLLGCTALHRGIMTGHEECVQMLLEKEVSILCK 729          

HSP 8 Score: 62.7734 bits (151), Expect = 7.901e-9
Identity = 50/168 (29.76%), Postives = 81/168 (48.21%), Query Frame = 1
Query:  478 PLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDE----IVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            PL+ A + G    + +LI      +  D + RTPLH+A+  G   +++  +  G       + A DN   T L  A     +E    ++K+  D     + W      Q P H+AA N  L   + ++   S +VN +D  G T LH A ++GH+++V  LL+KGA+I
Sbjct:   11 PLVQAIFSGDPEEIRMLIYKTEDVNALDAEKRTPLHVASFLGDADIIELLILSGAR-----VNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNW------QTPLHVAAANKALKCAEIIIPMLS-SVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANI 166          

HSP 9 Score: 60.8474 bits (146), Expect = 3.388e-8
Identity = 63/220 (28.64%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  313 LIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +++ K E +N  D+   T LH+A+  G    +  L     +L       ++  W TPL  A        V++LI+H    +  D + +TPLH+AAA   L   +  +      +   +   D  G TAL  A      E+V  +  K  +   ++  D  +   H AA  G L  +  L+  G+  V   D +GYT LH A  +G I+IVK LL+ G  I
Sbjct:   26 MLIYKTEDVNALDAEKRTPLHVASFLGDADIIELL-----ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKALKCAEIIIP-----MLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKD--RRALHWAAYMGHLEVVALLINHGA-EVTCKDKKGYTPLHAAASNGQINIVKHLLNLGVEI 232          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. UniProt/SwissProt
Match: sp|Q5RF15|TNI3K_PONAB (Serine/threonine-protein kinase TNNI3K OS=Pongo abelii OX=9601 GN=TNNI3K PE=2 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 6.925e-18
Identity = 90/315 (28.57%), Postives = 133/315 (42.22%), Query Frame = 1
Query:  145 DTDLSLLHWAAL-KGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH-DIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNG------DLLNIQG------------------------------LLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +  LSLLH   +  G+   +  L+ K   PS L  N   +TA H+AV       + SL+    + I +    G T LH+A   G       L      +   DA    + +TPL  AA++G   +  LL++ G   +V+   G  PLHLA+A+G L + K  +EEG   D+     A DN     L         +IVKY+   D E  P    ++ D   P H+A  NG      +++ I G                              LL++  I +N     G+T LH AC  GHI +V++LL  GA +
Sbjct:   65 ENGLSLLHLCCICGGNKSHIRTLMLKGLRPSRLTRNG--FTALHLAVYKDNAELITSLLHGGAD-IQQVGYGGLTALHIATIAGHLEAADVLLQHGANVNIQDA----VFFTPLHIAAYYGHEQVTRLLLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADV----NAQDNEDHVPLHFCSRFGHHDIVKYLLQNDLEVQPHVVNIYGDT--PLHLACYNGKFEVAKEIIQISGTESLTKENIFSETAFHSACTYGKSIDLVKFLLDQNVININHQGRDGHTGLHSACYHGHIHLVQFLLDNGADM 366          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. TrEMBL
Match: A0A3M6T632 (ANK_REP_REGION domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00000898 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.017e-51
Identity = 113/319 (35.42%), Postives = 177/319 (55.49%), Query Frame = 1
Query:   82 ARFKRAVKDIDPVEIRKII-----MEDTD----LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            A    AV+  D +E++ ++     + D D     + LHWAA  GS+  +++L+         D   + WT +H+A I G+DACL++L     + +N  D+RGCT  HLAAAHG  +C+  +      +   D    NM WTP+  AA+HGR+  ++LL R G + D  D  G TP HLAA+EGHLP +K+ +  G   I   + A ++ G T   LA+   K + + Y+   E D    E  ++L +P H+AA NGDL  ++ L+E G ++VN+ D++G T  HKA  +GH+ +++WL+  GA++ I     ET  D+ 
Sbjct:    8 ANIHEAVRYGDVLELQSMVQRGAGINDADGKFKFTPLHWAAHHGSLECLHWLL--WHGADHSDKTPQGWTPSHLAAIRGQDACLQALAANGAD-LNDKDNRGCTAAHLAAAHGNSYCLQSILRHGVDINATD----NMGWTPVHCAAFHGRLGCLQLLSRWGASVDEVDHSGSTPAHLAASEGHLPCLKFIVCAGA-SIDHTMNARNDQGDTPKNLAQQFYKKDCIDYLNAVEYDLLHPEDEENLAFPAHVAAYNGDLAQLKMLIETGVVSVNERDDKGSTPAHKAAGNGHVQVLQWLVENGANLRIVNSAGETPKDVA 318          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. TrEMBL
Match: A0A5F8GMZ4 (Ankyrin repeat domain 42 OS=Monodelphis domestica OX=13616 GN=ANKRD42 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 9.602e-50
Identity = 105/283 (37.10%), Postives = 167/283 (59.01%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIR--DKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVID 1005
            LHWAA  GS+  +++L+        +  +   WTAAH+A I G+DAC+++LIM   + +  PD RGC+  HLAA HG  + +  +   + + PN+  +C    W P+ YA++HGR+  ++LL++ G A + TD +G  P+HLAA EGHL   K+ L      + + L   ++NG  A+ LA+   KD I+++I+  D E D R+ +  + L +PGH AA  GDL  ++ L+E G I +N+ D+   T+LHKA   GH++ ++WL+ KGA + I     E  +D
Sbjct:   49 LHWAAHSGSLECLHWLL--WHGADIMSVSPGGWTAAHIAAIKGQDACMQALIMNGAD-LTLPDDRGCSPSHLAATHGHSYTLQVMLR-SGVDPNVSDKC---DWKPVHYASFHGRLGCLQLLVKWGAAIEDTDQNGNLPVHLAAMEGHLYCFKFLLSR-MSSVRQTLKVFNDNGENAMDLAQRFFKDNIIQFIQGTDFEGDNRSDQ--ETLAFPGHAAAYKGDLEMLKKLVENGIININERDDSESTLLHKAAGQGHVECLQWLIEKGADVNITNKAGELAVD 321          

HSP 2 Score: 62.3882 bits (150), Expect = 2.175e-6
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  469 QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++TPL +AA  G +  +  L+ HG         G T  H+AA +G    ++  +  G       LT  D+ G +   LA T      ++ +     DP   +  D    P H A+ +G L  +Q LL K   A+ DTD  G   +H A + GH+   K+LLS+ +S+
Sbjct:   45 KFTPLHWAAHSGSLECLHWLLWHGADIMSVSPGGWTAAHIAAIKGQDACMQALIMNGAD-----LTLPDDRGCSPSHLAATHGHSYTLQVMLRSGVDPNVSDKCD--WKPVHYASFHGRLGCLQ-LLVKWGAAIEDTDQNGNLPVHLAAMEGHLYCFKFLLSRMSSV 203          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. TrEMBL
Match: F6VRI7 (Ankyrin repeat domain 42 OS=Monodelphis domestica OX=13616 GN=ANKRD42 PE=4 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 1.289e-49
Identity = 105/283 (37.10%), Postives = 167/283 (59.01%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIR--DKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVID 1005
            LHWAA  GS+  +++L+        +  +   WTAAH+A I G+DAC+++LIM   + +  PD RGC+  HLAA HG  + +  +   + + PN+  +C    W P+ YA++HGR+  ++LL++ G A + TD +G  P+HLAA EGHL   K+ L      + + L   ++NG  A+ LA+   KD I+++I+  D E D R+ +  + L +PGH AA  GDL  ++ L+E G I +N+ D+   T+LHKA   GH++ ++WL+ KGA + I     E  +D
Sbjct:   49 LHWAAHSGSLECLHWLL--WHGADIMSVSPGGWTAAHIAAIKGQDACMQALIMNGAD-LTLPDDRGCSPSHLAATHGHSYTLQVMLR-SGVDPNVSDKC---DWKPVHYASFHGRLGCLQLLVKWGAAIEDTDQNGNLPVHLAAMEGHLYCFKFLLSR-MSSVRQTLKVFNDNGENAMDLAQRFFKDNIIQFIQGTDFEGDNRSDQ--ETLAFPGHAAAYKGDLEMLKKLVENGIININERDDSESTLLHKAAGQGHVECLQWLIEKGADVNITNKAGELAVD 321          

HSP 2 Score: 62.003 bits (149), Expect = 2.945e-6
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  469 QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            ++TPL +AA  G +  +  L+ HG         G T  H+AA +G    ++  +  G       LT  D+ G +   LA T      ++ +     DP   +  D    P H A+ +G L  +Q LL K   A+ DTD  G   +H A + GH+   K+LLS+ +S+
Sbjct:   45 KFTPLHWAAHSGSLECLHWLLWHGADIMSVSPGGWTAAHIAAIKGQDACMQALIMNGAD-----LTLPDDRGCSPSHLAATHGHSYTLQVMLRSGVDPNVSDKCD--WKPVHYASFHGRLGCLQ-LLVKWGAAIEDTDQNGNLPVHLAAMEGHLYCFKFLLSRMSSV 203          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. TrEMBL
Match: A0A2B4RXB3 (Ankyrin repeat domain-containing protein 42 OS=Stylophora pistillata OX=50429 GN=Ankrd42 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.386e-49
Identity = 104/286 (36.36%), Postives = 163/286 (56.99%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
             + LHWA+  GS+  +++L+         D   + WT +H+A I G+D+CL++L     + +N  D+RGCT  HLAAAHG  +C+  +      +   D    NM WTP+  AA+HGR+  ++LL R G + D  D  G TP HLAA+EGHLP +K+ +  G   I   + A ++ G T   LA+   K + + Y+   E D    E  ++L +P H+AA NGDL  ++ L+E G ++VN+ D++G T  HKA  +GH+ +++WL+  GA++ I     ET  D+ 
Sbjct:   17 FTPLHWASHHGSLECLHWLL--WHGADHSDKTPQGWTPSHLAAIRGQDSCLQALAANGAD-LNGKDNRGCTAAHLAAAHGNSYCLQSILRHGVDINATD----NMGWTPVHCAAFHGRLGCLQLLSRWGASVDEVDHSGSTPAHLAASEGHLPCLKFIVCAGA-SIDHTMNARNDQGDTPKNLAQQFYKKDCIDYLNAVEYDLLHPEDEENLAFPAHVAAYNGDLAQLKMLIETGVVSVNERDDKGSTPAHKAAGNGHVQVLQWLVENGANLRIVNSAGETPKDVA 294          

HSP 2 Score: 67.781 bits (164), Expect = 6.664e-8
Identity = 51/169 (30.18%), Postives = 77/169 (45.56%), Query Frame = 1
Query:  466 MQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
             ++TPL +A+ HG +  +  L+ HG         G TP HLAA  G    ++     G       L   DN G TA  LA        ++ I     D       D++ + P H AA +G L  +Q LL +   +V++ D+ G T  H A   GH+  +K+++  GASI
Sbjct:   15 FRFTPLHWASHHGSLECLHWLLWHGADHSDKTPQGWTPSHLAAIRGQDSCLQALAANGAD-----LNGKDNRGCTAAHLAAAHGNSYCLQSILRHGVDINA---TDNMGWTPVHCAAFHGRLGCLQ-LLSRWGASVDEVDHSGSTPAHLAASEGHLPCLKFIVCAGASI 174          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. TrEMBL
Match: A0A091IEY5 (Ankyrin repeat domain-containing protein 42 (Fragment) OS=Calypte anna OX=9244 GN=N300_01742 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.548e-49
Identity = 112/283 (39.58%), Postives = 160/283 (56.54%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            LHWAA  GS+  +++L+      +++      WTAAH+A I G+DACL++L +R        D RGCT  HLAAAHG+ +    L N  R   N++   RN  W P+ YAA+HGR+  ++LL+R G   D  D +G  P HLAA EGHL   K+ + +    IH  L A ++ G T   LAE   KD I++YI   EK+    E  + L +P H AA  GDLL ++ L++ G I +N+ D++G T++HKA   GHI  ++WL+  GA   I     ET  D+ 
Sbjct:   43 LHWAAHSGSLECLHWLLWHGADTTEV--TVRGWTAAHLAAIRGQDACLQAL-LRNGANAEAQDDRGCTASHLAAAHGQSYT---LQNILRSGVNVNVSDRN-DWKPVHYAAFHGRLGCLQLLVRWGACVDDVDNNGNLPAHLAAMEGHLHCFKFLVSKMASVIH-TLKARNDQGETPRDLAERFYKDNILQYIDSLEKEREHPESQEVLAFPAHSAAFKGDLLVLRSLVQSGVININERDDKGSTLMHKAAGQGHIHCLQWLIEMGADCDITNDAGETPKDVA 317          

HSP 2 Score: 67.3958 bits (163), Expect = 5.579e-8
Identity = 57/177 (32.20%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  469 QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE-----KDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTL 984
            ++TPL +AA  G +  +  L+ HG  T    V G T  HLAA  G    ++  L  G +       A D+ G TA  LA    +   ++ I          D   W+       P H AA +G L  +Q L+  G+  V+D DN G    H A + GH+   K+L+SK AS+ I TL
Sbjct:   39 KFTPLHWAAHSGSLECLHWLLWHGADTTEVTVRGWTAAHLAAIRGQDACLQALLRNGAN-----AEAQDDRGCTASHLAAAHGQSYTLQNILRSGVNVNVSDRNDWK-------PVHYAAFHGRLGCLQLLVRWGAC-VDDVDNNGNLPAHLAAMEGHLHCFKFLVSKMASV-IHTL 201          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 96.6709 bits (239), Expect = 3.170e-20
Identity = 86/282 (30.50%), Postives = 129/282 (45.74%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEK--DPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH  A  G   +V  L+D+      L       +  H+A  G    C++ L+  +  V +  +    T LH+AA     HC HY     +++     N +A+  N  +TPL  A    RI ++ELL++HG +       G TP+H+AA  GH  +V   +  G           +  G TAL +A    + E+VKY+       D ++     D Q P HI++  G    IQ LL+ G+   + T   GYT LH A   GH D+   LL +GAS+ I T
Sbjct:  249 LTPLHCGARSGHEQVVEMLLDRGA--PILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDY-LTALHVAA-----HCGHY--KVAKVIVDKKANPNAKALN-GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASP-----NTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKS----KDDQTPLHISSRLGKPEIIQQLLQHGACP-DSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITT 509          

HSP 2 Score: 83.9593 bits (206), Expect = 3.087e-16
Identity = 73/234 (31.20%), Postives = 103/234 (44.02%), Query Frame = 1
Query:  262 TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            T  HVA   G +  +  L M      N  + RG T LH+AA  G+   + YL      +   DA+ ++ Q TPL  ++  G+  I++ L++HG   D T   G TPLHLAA EGH  +    L++G       L      GFT L +A    K E+   +  K   P           P H+AA   +      LL++G+       N GYT LH A     ++I   LL  GA
Sbjct:  382 TPIHVAAFMGHENIVTQL-MNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYV---DAKSKDDQ-TPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGA-----SLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASG--KSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN-GYTPLHIAAKKNQMEIATTLLEYGA 602          

HSP 3 Score: 71.633 bits (174), Expect = 2.111e-12
Identity = 58/190 (30.53%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  442 NLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            N D + ++  +TPL  AA +G I++  LL+  G A D    +  TPLH+A+  G+  +VK  LE G       + A   +G T L        +++V+ + D+   P   +  + L  P H+ A  GD LN   LL    + V+D  N   T LH A   GH  + K ++ K A+   K L   T + I 
Sbjct:  174 NADVESKS-GFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGAR-----IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLS-PLHM-ATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 354          

HSP 4 Score: 70.8626 bits (172), Expect = 3.075e-12
Identity = 59/216 (27.31%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDTDNR-GYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            IN  +  G   LHLA+  G    +  +    ++   +DA  +    T L  A+  G+  +V+ L+ +G   +    +G TPL++AA E HL +V+Y L+ G        +    +GFT L +A  +  D++V  + + +   +       ++ P  HIAA   D      LL+    A  D +++ G+T LH A   G+I++   LL++GA++  K
Sbjct:   14 INICNQNGLNALHLASKEGH---VEVVTQLIKMGATVDAATKKGN-TALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQ-----SIATEDGFTPLAVALQQGHDQVVSLLLENDTKGK-------VRLPALHIAARKDDTKAAALLLQNDHNA--DVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFK 211          

HSP 5 Score: 66.6254 bits (161), Expect = 6.604e-11
Identity = 64/218 (29.36%), Postives = 96/218 (44.04%), Query Frame = 1
Query:  358 GCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            G T LH+AA +G  +    L N    +   D + RN   TPL  A+  G  ++V+LL+  G   D    DG TPLH  A  GH  +V+  L+ G   + K       NG + L +A        V+ +   E      ++ +D     H+AA  G     + +++K +   N     G+T LH AC    I +++ LL  GASI   T    T I + 
Sbjct:  182 GFTPLHIAAHYGNINVATLLLNRGAAV---DFKARN-DITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-----KNGLSPLHMATQGDHLNCVQLLLHHEVP--VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANP-NAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVA 387          

HSP 6 Score: 51.2174 bits (121), Expect = 3.524e-6
Identity = 44/165 (26.67%), Postives = 72/165 (43.64%), Query Frame = 1
Query:  148 TDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQ---CRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLE 633
            + L+ LH AA   +  +   L+D+   P     N   +T  H+A    +     +L+    +  N    +G + LHLA+  G         +   LL   DA    C     TPL  AA   ++++ E+L+ HG   D     G TPLH+A   G++ +V + L+
Sbjct:  544 SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMEIATTLLEYGADT-NAITRQGISPLHLASQEGN-------VDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLK 698          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Cavefish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 90.1225 bits (222), Expect = 2.816e-18
Identity = 89/284 (31.34%), Postives = 136/284 (47.89%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGC----HDIHKC----LTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG----HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            LH AA  G + +V  L++      ++D  NA   TA HVA   G+DA +  LI     V ++P+++G T LH AAA  HG   C+ +L N      +++ Q R+ + +PL   A HGR +  + LI++G   D  D DG TPLH+AA  GH  L+   +  G       +H      L A++ +     KL  +  +  I+  + +       +++ D     G    H AA  G++  ++ LL  GS   N TD  G T LH A  S H   ++ L+S G  I
Sbjct:  210 LHAAASNGQINVVKHLLN---LSVEIDEANAFGNTALHVACFNGQDAVVSELIDYGANV-SQPNNKGFTPLHFAAASTHGAL-CLEFLVNNG---ADVNVQSRDGK-SPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRRGVHGMFPLHLAALNAHADCCRKLLSSGRRYSIICPLSNDSVLCAGFQI-DTPDSLGRTCLHAAAAGGNVECVKLLLSSGSDH-NRTDKHGRTPLHYAAASRHFQCLETLVSCGTCI 482          

HSP 2 Score: 68.1662 bits (165), Expect = 1.958e-11
Identity = 82/304 (26.97%), Postives = 125/304 (41.12%), Query Frame = 1
Query:   76 DDARFKRAVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE-----KDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            D     +A+ + DP EIR +I +  D++ L                           +AE  T  H A   G    +E LI+    V N  D+   T LH A A      +  L   +      D   R+  W TPL  AA +  +   E++I    + +V+D  GRT LH AA  GH  +V   L +G +     + A D     AL  A      ++V  + D+      KD R +        P H AA NG +  ++ LL   S+ +++ +  G T LH AC +G   +V  L+  GA++
Sbjct:    8 DQPPLLQAIFNGDPEEIRMLIFKSEDINAL---------------------------DAEKRTPLHAAAFLGDAEIIELLILSGARV-NAKDNMWLTPLHRAVASRSEEAVRVLIRHSA-----DVNARDKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGAN-----INAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYT-------PLHAAASNGQINVVKHLLNL-SVEIDEANAFGNTALHVACFNGQDAVVSELIDYGANV 265          

HSP 3 Score: 68.1662 bits (165), Expect = 2.152e-11
Identity = 83/277 (29.96%), Postives = 121/277 (43.68%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDV---TDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG-HIAAVNGDLLNIQGLLEKGSIAVNDT------DNRGYTMLHKACISGHIDIVKWLLSK 957
            S +H+AA  G    +  L+++ E   D   ++   +  H+A   G    LE L+    EV ++ D  G T L LAA  G   C   L N      + D+       TP+  A  +G  S V LL+      D+    D  G+TPL LA   GH+  V   LE         +   D+ G TAL L     ++E V+ + ++E    +  L D       H+AA  G    +  LL   SIA ++       DN+GYT LH AC +GH   V+ LL +
Sbjct:  547 SAVHYAAAYGHRHCLELLLEREENHQDEMESSSTRSPLHLAAYHGHAQALEVLLQGHCEV-DQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDS---GRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLER-----EASVDTADHQGLTALHLGLLCGQEECVQCLLEQEA---SVLLGDSKGRTALHLAAARGHASWLSELL---SIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQ 808          

HSP 4 Score: 67.3958 bits (163), Expect = 3.956e-11
Identity = 74/288 (25.69%), Postives = 120/288 (41.67%), Query Frame = 1
Query:  130 KIIMEDTDL------------SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSK 957
            ++++ED+D             + L  A + G V  V+ L+++       D+     TA H+ ++ G++ C++ L+ ++  V+   DS+G T LHLAAA G    +  L +     P       N  +TPL +A ++G    VE+L+         D +  TPLH A    H       LE    +I  C  + D     A   A      +++    D   D         L     +AA  G +  ++ LL   S  ++ TD +G T LH AC  G  D    +L K
Sbjct:  664 RLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQG--LTALHLGLLCGQEECVQCLLEQEASVL-LGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQ-KGCRCFDGNPFTPLHCAVVNDHESCATLLLEAMGSEIVTCKDSRDRAPLHAAAFAGNVDCVQLL-LAHDAPVDAVDQSGRSALM----MAAERGAVGVVEALLTSASADLSLTDQKGNTALHLACSKGKEDCALLILEK 942          

HSP 5 Score: 66.2402 bits (160), Expect = 8.060e-11
Identity = 83/320 (25.94%), Postives = 129/320 (40.31%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSDLD---NNAEIWTA--AHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHD----------------IHKCLT-------------AVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKG-----------------SIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            + LH AAL G   +V+ L+ K    +  D     A  W A   H+ V+     CL  L+ +  EV  + D RG T LH AA++G+ + + +L N +  +   +A       T L  A ++G+ ++V  LI +G      +  G TPLH AAA  H  L   FL     D                +H   T             +VD +G T L +A     + ++  +     D     +     +P H+AA+N      + LL  G                    ++  D+ G T LH A   G+++ VK LLS G+
Sbjct:  142 TALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVV-----CL--LVDQGAEVSCK-DKRGYTPLHAAASNGQINVVKHLLNLSVEIDEANA----FGNTALHVACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADVNVQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRRGVHG--MFPLHLAALNAHADCCRKLLSSGRRYSIICPLSNDSVLCAGFQIDTPDSLGRTCLHAAAAGGNVECVKLLLSSGS 447          

HSP 6 Score: 65.4698 bits (158), Expect = 1.227e-10
Identity = 77/291 (26.46%), Postives = 119/291 (40.89%), Query Frame = 1
Query:  121 EIRKIIMEDTDLSLLHWAALKGSVVIVNFL--IDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQ---CRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            E   ++ +    + LH AA +G    ++ L  I   E P+    + + +T  H A   G + C+E L+ +K       D    T LH A  +    C       T LL  + ++   C++ +   PL  AA+ G +  V+LL+ H    D  D  GR+ L +AA  G + +V+  L     D    L+  D  G TAL LA +K K++    I +K  D                                 +  V  T++   T LH A  SG    VK LLS+GAS+ +
Sbjct:  739 EASVLLGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQKG--CRCFDGNPFTPLHCAVVNDHESCA------TLLLEAMGSEIVTCKDSRDRAPLHAAAFAGNVDCVQLLLAHDAPVDAVDQSGRSALMMAAERGAVGVVEALLTSASAD----LSLTDQKGNTALHLACSKGKEDCALLILEKLPD---------------------------------TTIVKATNSALQTPLHLAAHSGLKQTVKELLSRGASVQV 984          

HSP 7 Score: 65.0846 bits (157), Expect = 2.034e-10
Identity = 62/226 (27.43%), Postives = 98/226 (43.36%), Query Frame = 1
Query:  301 CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDL-QYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            CLE  +++     +  D +G + +H AAA+G  HC+       R   + D    +   +PL  AA+HG    +E+L++     D  D  GRT L LAA  GH       L  G     +        G T + LA        V+ + +        E  D   Q P  +A V G +  +  LLE+   +V+  D++G T LH   + G  + V+ LL + AS+ +
Sbjct:  527 CLE-FLLKSGATASLKDKQGYSAVHYAAAYGHRHCL--ELLLEREENHQDEMESSSTRSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSR----DSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLER-EASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLL 744          

HSP 8 Score: 60.077 bits (144), Expect = 6.935e-9
Identity = 79/274 (28.83%), Postives = 112/274 (40.88%), Query Frame = 1
Query:  181 KGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGC-TLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW-----TPLMYAAWHGRISIVELLIRHGVATDVTDVD-GRTPLHLAAAEGHLPLVKYFLEEG-CHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG----HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGAS 966
            K + + + FL+      S  D     ++A H A   G   CLE L+ R+    +  +S    + LHLAA HG    +  L         L   C   Q      T L  AA  G       L+ HG +    D   GRTP+HLA   GH   V+  LE+  C D+   + A D+ G T L LA      + V  + ++E         D   + G    H+  + G    +Q LLE+   +V   D++G T LH A   GH   +  LLS   S
Sbjct:  522 KEAALCLEFLLKSGATASLKDKQG--YSAVHYAAAYGHRHCLELLLEREENHQDEMESSSTRSPLHLAAYHGHAQALEVL---------LQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADL---VEAADSQGQTPLMLAVVGGHVDAVSLLLEREAS------VDTADHQGLTALHLGLLCGQEECVQCLLEQ-EASVLLGDSKGRTALHLAAARGHASWLSELLSIACS 774          

HSP 9 Score: 56.9954 bits (136), Expect = 6.640e-8
Identity = 88/340 (25.88%), Postives = 118/340 (34.71%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTR------LLPNLDAQCRNMQW--------TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDE-----------IVKYIRDKE---------KDPRTWELFDDLQY------------------------------------PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGAS 966
            S LH  A+ G       LI        +D +    T  H+A   G +  + +LI    +   R    G   LHLAA +    C   L +  R       L N    C   Q         T L  AA  G +  V+LL+  G   + TD  GRTPLH AAA  H   ++  +  G      C+ A D  G +AL  A     D             V+  ++KE         K   T  L D   Y                                    P H+AA +G    ++ LL+ G   V+  D  G T L  A + GH D    LL+ GAS
Sbjct:  308 SPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGN--TPLHIAARYGHELLINTLITSGADCTRR-GVHGMFPLHLAALNAHADCCRKLLSSGRRYSIICPLSNDSVLCAGFQIDTPDSLGRTCLHAAAAGGNVECVKLLLSSGSDHNRTDKHGRTPLHYAAASRHFQCLETLVSCG-----TCINATDQWGRSALHYAAASDLDRRRRVALEPESPGVQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHRHCLELLLEREENHQDEMESSSTRSPLHLAAYHGHAQALEVLLQ-GHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGAS 638          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Cavefish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:NCBI gene;Acc:103026486])

HSP 1 Score: 88.9669 bits (219), Expect = 9.057e-18
Identity = 83/272 (30.51%), Postives = 126/272 (46.32%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAE---IWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            ++L  A+ +G+V +V  L+D+      LD N      WT  H+A   G     ++L+ +     +  D+ G   L LAA  G Y C+  L      +       RN     L  AA  G   IVELL+ HG   D  D DGR  L++ A E  L + +YFLE G +     +   D  G TAL ++  +   E+V+ +     D  + +  ++ +     AA  G    +Q L++ G+  V+ T N+G T L  A   GHID+V+ LL  GA
Sbjct:  810 TVLSIASAQGNVEVVRTLLDR-----GLDENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARC-SEVDNDGRIPLILAAQEGHYDCVQILLENKSCIDQRGYDGRN----SLRVAALEGHRDIVELLLSHGADIDYNDADGRPTLYILALENQLAMAEYFLENGAN-----VETSDTEGRTALHVSCWQGHVEMVRLLISYHADVNSCD--NEKRSALQSAAWQGHSKVVQFLIDSGT-HVDHTCNQGATALGIAAQEGHIDVVRILLEHGA 1063          

HSP 2 Score: 80.4925 bits (197), Expect = 3.879e-15
Identity = 82/271 (30.26%), Postives = 125/271 (46.13%), Query Frame = 1
Query:  172 AALKGSVVIVNFLIDKMEFPS--DLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGY---TMLHKACISGHIDIVKWLLSKGASI 969
            AA  G   IV  L+D     +  D+D    +  AA         A + SL++ +   ++  D    T L +AA  G    +  L      + + D   R    TPL+ AA  G  S+V  L+  G A D  D +GRT L +A+A+G++ +V+  L+ G  + H+     D+ G+T L +A  +   ++   +   E+  R  E+ +D + P  +AA  G    +Q LLE  S      D RGY     L  A + GH DIV+ LLS GA I
Sbjct:  678 AAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDCMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGR----TPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHR-----DDAGWTPLHMAAFEGHRQVCDALL--EQGARCSEVDNDGRIPLILAAQEGHYDCVQILLENKSC----IDQRGYDGRNSLRVAALEGHRDIVELLLSHGADI 933          

HSP 3 Score: 79.337 bits (194), Expect = 7.320e-15
Identity = 81/265 (30.57%), Postives = 120/265 (45.28%), Query Frame = 1
Query:  193 VIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAA-----AHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +++N L    E  +  DN     TA   A   G    +E L+    EV N  D  G T L +AA     + G    +  L +    + + D  C     TPL+ AA+ G + +V+LL+  G   D TD +GRTPL  AA+ GH  +V   L  G       + ++D+ G T L +A  +   E+V+ + D+  D       DD  + P H+AA  G       LLE+G+   ++ DN G   L  A   GH D V+ LL   + I
Sbjct:  653 IVLNLLQHGAEV-NKADNEGR--TALIAAAYMGHREIVEHLLDHGAEV-NHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDC----MTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGA-----AVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENH---RDDAGWTPLHMAAFEGHRQVCDALLEQGA-RCSEVDNDGRIPLILAAQEGHYDCVQILLENKSCI 900          

HSP 4 Score: 68.9366 bits (167), Expect = 1.471e-11
Identity = 67/227 (29.52%), Postives = 97/227 (42.73%), Query Frame = 1
Query:  310 SLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRD-------KEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +L++ +   +   D+ G T L LAA  G    ++ L      + + D    +  WT L  AAW G   +V  L+  G   D  D D RT L  AA  GH  +V   L+ G       +   DN G TAL  A      EIV+++ D       ++ D RT      L  P    A  G    +  L+++G+  V+  D    T L  A   GH+D+V  LL  GA +
Sbjct:  556 NLLISRGANMELQDNHGQTPLTLAARQGHTKVVNCLIGCDSNINHTD----HDGWTALRSAAWGGHSEVVSALLYAGAKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAE-----VNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVP----ASKGHASVVSLLIDRGA-EVDHCDKDCMTPLLVAAYEGHVDVVDLLLEGGADV 768          

HSP 5 Score: 64.6994 bits (156), Expect = 2.808e-10
Identity = 60/172 (34.88%), Postives = 82/172 (47.67%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK---YIRDK----EKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            T L  AA+ G + +V LLI  G   ++ D  G+TPL LAA +GH  +V   +  GC      +   D++G+TAL+ A      E+V    Y   K    + D RT        + GH   V    LN   LL+ G+  VN  DN G T L  A   GH +IV+ LL  GA +
Sbjct:  541 TLLGNAAYSGNLDVVNLLISRGANMELQDNHGQTPLTLAARQGHTKVVNCLI--GC---DSNINHTDHDGWTALRSAAWGGHSEVVSALLYAGAKVDCADADSRT--ALRAAAWGGHEDIV----LN---LLQHGA-EVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEV 697          

HSP 6 Score: 60.8474 bits (146), Expect = 3.765e-9
Identity = 58/197 (29.44%), Postives = 86/197 (43.65%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDA---QCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI 741
            L  AAL+G   IV  L   +   +D+D N+A+     ++  +  + A  E  +     V    D+ G T LH++       C        RLL +  A    C N + + L  AAW G   +V+ LI  G   D T   G T L +AA EGH+ +V+  LE G    H      D  G TA+++A       I+K +
Sbjct:  911 LRVAALEGHRDIVELL---LSHGADIDYNDADGRPTLYILALENQLAMAEYFLENGANV-ETSDTEGRTALHVS-------CWQGHVEMVRLLISYHADVNSCDNEKRSALQSAAWQGHSKVVQFLIDSGTHVDHTCNQGATALGIAAQEGHIDVVRILLEHGADPNH-----ADQFGRTAMRVAAKGGHSGIIKLL 1091          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 83.5741 bits (205), Expect = 1.025e-17
Identity = 58/179 (32.40%), Postives = 90/179 (50.28%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            T L +A   G  +IV+ L+  G   D+ D    TPLH+AA+ G   +V+  + +G       L +V+ NG T L  A +K++ EI   + +   DP   +  +    P H A+  G+   IQ LL K S + N  D+ G T LH AC    ++  K L+  GASI+I+   ++T + I 
Sbjct:   42 TALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQ-----LNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLES--TPLHRASAKGNYRLIQ-LLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIA 212          

HSP 2 Score: 81.2629 bits (199), Expect = 5.314e-17
Identity = 58/183 (31.69%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  121 EIRKIIMED------TDL---SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYH-CMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEG 639
            E++K ++ D      TD    + LHWA   G   IV FL+D +    DL ++A  WT  H+A   G++  + SLI +  + +N  +  GCT LH AA+  +Y   +  L N     PN   +   ++ TPL  A+  G   +++LL++   +T++ D +G T LHLA  E  +   K  +E G
Sbjct:   21 ELKKCVLSDRAQASRTDQDHRTALHWACSAGHANIVQFLLD-VGAEVDLKDDAS-WTPLHIAASAGREEIVRSLISKGAQ-LNSVNQNGCTPLHYAASKNQYEIALLLLENGAD--PNATDK---LESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHG 195          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 88.1965 bits (217), Expect = 1.081e-17
Identity = 71/235 (30.21%), Postives = 114/235 (48.51%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRH-GVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSK 957
            +T  H A   G +A L  L++ +   +N  D++G T +H+A  HGR + +  L     L    DA  R   +WT L  AAW G + IV+LL++  GV  D   VDGR PLHLA+  G   + +  ++ G  D+      +      A +   T +   ++K+  D +   RT +       P H+AA  G    ++ LLE+G+   +DT++   T  H A   GH  +++ LL +
Sbjct:  492 YTPLHFAAQNGDEA-LTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVL-----LSRGADAHARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVDGRAPLHLASQRGQYRVARVLVDLGA-DVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQS--RTAQGL----TPLHLAAWKGHQATVRMLLEEGANP-HDTEHLLRTPCHLAAEGGHCQVMEELLQR 712          

HSP 2 Score: 85.8853 bits (211), Expect = 5.196e-17
Identity = 87/295 (29.49%), Postives = 118/295 (40.00%), Query Frame = 1
Query:  262 TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAA----------------------AHGR----YHCMHYLANFTRLL--PNLDAQCRNM-QWTPLMYAAWHGRISIVELLIRH-GVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDI---HKCLT--------------------------AVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            T  H+AV     +  E L+ RK   +N  D    T LH AA                      A GR      C H   N  R+L     DA  R   +WT L  AAW G + IV+LL++  GV  D   VDGR PLHLA+  G   + +  ++ G  D+     CL+                          +    G T L LA  K     V+ + ++  +P   E    L+ P H+AA  G    ++ LL++   AV   D  G T LH A   G+ D +  LLS GA I
Sbjct:  459 TPLHLAVEKRLKSVAEILLGRKSTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVDGRAPLHLASQRGQYRVARVLVDLGA-DVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQSRTAQGLTPLHLAAWKGHQATVRMLLEEGANPHDTEHL--LRTPCHLAAEGGHCQVMEELLQRWPEAVATPDESGLTPLHIAVRGGYRDAICLLLSHGADI 750          

HSP 3 Score: 70.0922 bits (170), Expect = 5.167e-12
Identity = 67/214 (31.31%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            N PDSRG T LHLA           L    R   N++A+  + Q+TPL +AA +G  ++  LL+      +  D  GRTP+H+A   G   +V+  L  G  D H    A   + +TAL LA  +    IVK +  +       +  D  + P H+A+  G     + L++ G+  V+ T     T LH A  +GH    + LL  GA I  +T
Sbjct:  451 NLPDSRGSTPLHLAVEKRLKSVAEIL--LGRKSTNVNAKDED-QYTPLHFAAQNGDEALTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVLLSRGA-DAH----ARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVDG-RAPLHLASQRGQYRVARVLVDLGA-DVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQSRT 654          

HSP 4 Score: 52.373 bits (124), Expect = 1.274e-6
Identity = 55/195 (28.21%), Postives = 79/195 (40.51%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSD---LDNNAEI--------WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLA 705
            + LH AA +G + IV  L+ +     D   +D  A +        +  A V V  G D  + S  +  P             LH+AA  G     H   +   L    D Q R  Q  TPL  AAW G  + V +L+  G     T+   RTP HLAA  GH  +++  L+       + +   D +G T L +A
Sbjct:  559 TALHLAAWQGHLGIVKLLVKQAGVNVDGQTVDGRAPLHLASQRGQYRVARVLVDLGADVSITSACLSTP-------------LHVAAETG-----HTSTSRLLLKHGADIQSRTAQGLTPLHLAAWKGHQATVRMLLEEGANPHDTEHLLRTPCHLAAEGGHCQVMEELLQR----WPEAVATPDESGLTPLHIA 731          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.192e-19
Identity = 84/279 (30.11%), Postives = 127/279 (45.52%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            L+ LH AA  G   +V  L+++      L       +  H+A  G    C++ L+  +  V +       TL +L A H   HC HY      L    +   R +  +TPL  A    RI ++ELL+++G + +     G TP+H++A  G+L +V   L+ G         A +  G TAL +A    + E+V+ +     + D +  E     Q P HIAA  G L  +Q LL+  +     T N GYT LH A   GH D+   LL  GAS+ + T
Sbjct:    7 LTPLHCAARSGHEQVVEILLEQGA--PILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDD------ITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASP-----NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKARE----EQTPLHIAARLGKLEIVQLLLQHMASPDAATSN-GYTPLHVAAREGHEDVTAILLEHGASLAVTT 267          

HSP 2 Score: 80.1073 bits (196), Expect = 9.935e-16
Identity = 67/208 (32.21%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            N  + RG T LH+AA  G+   +  L    R    +DA+ R  Q TPL  AA  G++ IV+LL++H  + D    +G TPLH+AA EGH  +    LE G       L      GFT L +A    K E+   +  +   P       +   P H+A+   +      LL++G+ + + T   GYT LH A     ++I   LL  GA
Sbjct:  165 NATNVRGETALHMAARAGQTEVVRSL---LRNGAQVDAKAREEQ-TPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGA-----SLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAG--KNGLTPLHVASHYDNQKVALLLLDQGA-SPHATAKNGYTPLHIAAKKDQLEIATTLLEYGA 360          

HSP 3 Score: 67.0106 bits (162), Expect = 1.020e-11
Identity = 81/314 (25.80%), Postives = 121/314 (38.54%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYL---------ANFTRLLP---------------------NLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVN-GDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            LH AA  G + IV  L+  M  P    +N   +T  HVA   G +  + ++++     +     +G T LH+A+ +G+      L         A    L P                     +  A  +N  +TPL  AA   ++ I   L+ +G  T+     G  PLHL A EGH  +    L       H        +G + L LA  + K  + + +    K          L Y   I A + G++  +  LL+ G+  VN     GYT LH+A   GH  IV  LL  GA     T+   T + I 
Sbjct:  208 LHIAARLGKLEIVQLLLQHMASPDAATSNG--YTPLHVAAREGHED-VTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKN-GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNH-----ATKSGLSPLHLAAQEDKVNVAEILV---KHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGA-DVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIA 508          

HSP 4 Score: 52.7582 bits (125), Expect = 2.246e-7
Identity = 46/137 (33.58%), Postives = 63/137 (45.99%), Query Frame = 1
Query:  565 DGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEK--DPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            DG TPLH AA  GH  +V+  LE+G   + K       NG + L +A      E V+ +       D  T +    L    H+AA  G     + LL+KG+   N     G+T LH AC    I +++ LL  GASI
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAK-----TKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTAL----HVAAHCGHYRTAKVLLDKGANP-NVRALNGFTPLHIACKKNRIRVMELLLKYGASI 131          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 2.337e-16
Identity = 84/293 (28.67%), Postives = 137/293 (46.76%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +   +  + LH AA  G++ +   L++     + +D  A    T  HVA   G +  ++ L+ R  + I+     G T LH AA  G    +  L    R  P L A+ +N   +PL  A     ++ V+LL+      D   +D  TPLH+AA  GH  + K  L+ G     + L     NGFT L +A  K++ ++++ +        T    +    P H+A+  G L  +Q LL+ G+ + N T+ RG T LH A  +G +++VK LL  GA + +K    +T + I 
Sbjct:  200 VTSKSGFTPLHIAAHYGNMNVATLLLN---LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAK-IDTKTRDGLTPLHCAARSGHEKVIEML--LERDAPIL-AKTKN-GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARAL-----NGFTPLHIACKKNRIKVMELLLKHGASIHTTT--ESGLTPIHVASFMGHLNVVQLLLQNGA-SSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA 476          

HSP 2 Score: 80.1073 bits (196), Expect = 7.697e-16
Identity = 82/284 (28.87%), Postives = 132/284 (46.48%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSR---GCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAA--VNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQ 990
            LS LH A     +  V  L+ + + P D D   +  T  HVA   G     + L+ R  E    P++R   G T LH+A    R   M  L      +            TP+  A++ G +++V+LL+++G +++ T+V G TPLH+A+  G L +VK  L+ G       + A ++   T L +A    K EIV+ +  +  DP           P + A+   +GD+ ++  LLE G+  ++    +G+T LH A   G +++   LL K AS   K  GQ
Sbjct:  305 LSPLHMATQGEHLACVQLLLGR-QAPVD-DVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE----PNARALNGFTPLHIACKKNRIKVMELLLKHGASIHT----TTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGA---RVGVKAREDQ--TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGS--TPLYFASREGHGDVASL--LLENGA-DISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ 568          

HSP 3 Score: 72.4034 bits (176), Expect = 2.021e-13
Identity = 72/247 (29.15%), Postives = 108/247 (43.72%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL---PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK----------------YIRDKEKDPRTWELFDDLQY-------------PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            IN  +  G   LHLA+  G    +      T LL     +D   + +  T L  AA  G+  IV +L+  G   +    +G TPL++AA E HL +VK+ L+ G +      +    +GFT L +A  +  +++V                 +I  ++ D     L   LQ+             P HIAA  G+ +N+  LL     AV+ T   G T LH A   G+ ++VK LL +GA I  KT
Sbjct:   37 INTCNQNGLNALHLASKEGHVDVV------TELLKREAEIDTATK-VGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQ-----SVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALL--LQHEHNADVTSKSGFTPLHIAAHYGN-MNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKT 268          

HSP 4 Score: 70.8626 bits (172), Expect = 6.349e-13
Identity = 55/181 (30.39%), Postives = 83/181 (45.86%), Query Frame = 1
Query:  472 WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            +TPL  AA   ++ + ++L+  G  T++    G  PLHLAA EGH  +V   L       H  ++     G TA+ LA  + K  + + +   + D  T      L Y P H+A+  G++  +  LL   ++ VN     GYT LH+A   GH  +V  LL   AS    T    T + I 
Sbjct:  604 YTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGR-----HASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTT---KLCYTPLHVASHYGNIKMVNFLLRNRAL-VNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 775          

HSP 5 Score: 70.0922 bits (170), Expect = 9.352e-13
Identity = 79/284 (27.82%), Postives = 115/284 (40.49%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDK--EKDPRTWE---------------------LFDDLQYPG----------HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
             T  HVA   G    ++ L+++     N  + RG T LH+A+  G+   +  L         +  + R  Q TPL  A+  G+  IV+LL++ G   +     G TPL+ A+ EGH  +    LE G  DI    + V   GFT L +A    + E+   + +K    DP+                        L D    P           HIAA    L   + LLE G+   N    +G   LH A   GH D+V  LL + ASI + T G  T + + 
Sbjct:  404 LTPIHVASFMGHLNVVQ-LLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSG---ARVGVKAREDQ-TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGA-DI----SPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGA-ETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 676          

HSP 6 Score: 48.1358 bits (113), Expect = 6.426e-6
Identity = 43/155 (27.74%), Postives = 69/155 (44.52%), Query Frame = 1
Query:  310 SLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTW 771
            +L++ +   I+     G T +HLAA   + +    L      +      C    +TPL  A+ +G I +V  L+R+    +    +G TPLH AA +GH  +V   L+   H+     LTA   NG TAL +A       +V  +    ++P T 
Sbjct:  653 ALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLC----YTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ---HEASPNELTA---NGNTALAIARRLGYISVVDTLSILTEEPVTG 797          

HSP 7 Score: 47.7506 bits (112), Expect = 8.026e-6
Identity = 42/139 (30.22%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  565 DGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            D  T    AA  G+L  +   L+ G  DI+ C    + NG  AL LA  +   ++V  +  +E +  T     +     HIAA+ G    ++ L+E G+  +N     G+T L+ A    H++IVK+LL  GA+  + T
Sbjct:   10 DAATSFLRAARNGNLERLMDHLKGGM-DINTC----NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTAL--HIAALAGQTDIVRVLVEFGA-NINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVAT 140          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 2.477e-16
Identity = 84/290 (28.97%), Postives = 137/290 (47.24%), Query Frame = 1
Query:  145 DTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            ++  + LH AA  G++ +   L++     + +D  A    T  HVA   G +  ++ L+ R  + I+     G T LH AA  G    +  L    R  P L A+ +N   +PL  A     ++ V+LL+      D   +D  TPLH+AA  GH  + K  L+ G     + L     NGFT L +A  K++ ++++ +        T    +    P H+A+  G L  +Q LL+ G+ + N T+ RG T LH A  +G +++VK LL  GA + +K    +T + I 
Sbjct:  210 ESGFTPLHIAAHYGNMNVATLLLN---LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAK-IDTKTRDGLTPLHCAARSGHEKVIEML--LERDAPIL-AKTKN-GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARAL-----NGFTPLHIACKKNRIKVMELLLKHGASIHTTT--ESGLTPIHVASFMGHLNVVQLLLQNGA-SSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA 483          

HSP 2 Score: 77.0258 bits (188), Expect = 7.338e-15
Identity = 79/276 (28.62%), Postives = 129/276 (46.74%), Query Frame = 1
Query:  154 LSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSR---GCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAA--VNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGAS 966
            LS LH A     +  V  L+ + + P D D   +  T  HVA   G     + L+ R  E    P++R   G T LH+A    R   M  L      +            TP+  A++ G +++V+LL+++G +++ T+V G TPLH+A+  G L +VK  L+ G       + A ++   T L +A    K EIV+ +  +  DP           P + A+   +GD+ ++  LLE G+  ++    +G+T LH A   G +++   LL K AS
Sbjct:  312 LSPLHMATQGEHLACVQLLLGR-QAPVD-DVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE----PNARALNGFTPLHIACKKNRIKVMELLLKHGASIHT----TTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGA---RVGVKAREDQ--TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGS--TPLYFASREGHGDVASL--LLENGA-DISPVTKKGFTPLHIASKYGRLEVATLLLEKYAS 567          

HSP 3 Score: 72.4034 bits (176), Expect = 2.125e-13
Identity = 78/282 (27.66%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  259 WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDK--EKDPRTWELFDDLQY-----------------------------PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
             T  HVA   G    ++ L+++     N  + RG T LH+A+  G+   +  L         +  + R  Q TPL  A+  G+  IV+LL++ G   +     G TPL+ A+ EGH  +    LE G  DI    + V   GFT L +A    + E+   + +K    DP+       L                               P HIAA    L   + LLE G+   N    +G   LH A   GH D+V  LL + ASI + T G  T + + 
Sbjct:  411 LTPIHVASFMGHLNVVQ-LLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSG---ARVGVKAREDQ-TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGA-DI----SPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGA-ETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 681          

HSP 4 Score: 70.8626 bits (172), Expect = 5.110e-13
Identity = 81/320 (25.31%), Postives = 129/320 (40.31%), Query Frame = 1
Query:  151 DLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDAC--LESLIMRKPEVINRPDSRGCTLLHLAAAHGR-------------------------YHCMHYLANFTRLL-----PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            D + LH A+  G   IV  L+ +   P     NA   + +       ++    + SL++     I+    +G T LH+A+ +GR                         +   HY      LL      +  +  +N  +TPL  AA   ++ + ++L+  G  T++    G  PLHLAA EGH  +V   L       H  ++     G TA+ LA  + K  + + +   + D  T      L Y P H+A+  G++  +  LL   ++ VN     GYT LH+A   GH  +V  LL   AS    T    T + I 
Sbjct:  476 DQTPLHIASRLGKAEIVQLLLQRGSDP-----NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKN-GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGR-----HASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTT---KLCYTPLHVASHYGNIKMVNFLLRNRAL-VNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 780          

HSP 5 Score: 69.3218 bits (168), Expect = 1.617e-12
Identity = 72/255 (28.24%), Postives = 108/255 (42.35%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLL---PNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVK----------------YIRDKEKDPRTWELFDDLQY---------------------PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            IN  +  G   LHLA+  G    +      T LL     +D   + +  T L  AA  G+  IV +L+  G   +    +G TPL++AA E HL +VK+ L+ G +      +    +GFT L +A  +  +++V                 +I  ++ D     L   LQ+                     P HIAA  G+ +N+  LL     AV+ T   G T LH A   G+ ++VK LL +GA I  KT
Sbjct:   36 INTCNQNGLNALHLASKEGHVDVV------TELLKREAEIDTATK-VGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQ-----SVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALL--LQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGN-MNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKT 275          

HSP 6 Score: 63.5438 bits (153), Expect = 1.225e-10
Identity = 54/186 (29.03%), Postives = 82/186 (44.09%), Query Frame = 1
Query:  454 QCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            Q     +TPL  AA +G +++  LL+  G A D T  +G TPLH+AA  G+  +VK  L+ G     K       +G T L  A     +++++ +   E+D        +   P H+A     L  +Q LL +    V+D      T LH A   GH  + K LL +G     + L   T + I 
Sbjct:  207 QTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKT-----RDGLTPLHCAARSGHEKVIEMLL--ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR-QAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA 384          

HSP 7 Score: 48.1358 bits (113), Expect = 5.606e-6
Identity = 43/155 (27.74%), Postives = 69/155 (44.52%), Query Frame = 1
Query:  310 SLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKC-LTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTW 771
            +L++ +   I+     G T +HLAA   + +    L      +      C    +TPL  A+ +G I +V  L+R+    +    +G TPLH AA +GH  +V   L+   H+     LTA   NG TAL +A       +V  +    ++P T 
Sbjct:  658 ALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLC----YTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ---HEASPNELTA---NGNTALAIARRLGYISVVDTLSILTEEPVTG 802          

HSP 8 Score: 47.7506 bits (112), Expect = 8.450e-6
Identity = 42/139 (30.22%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  565 DGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            D  T    AA  G+L  +   L+ G  DI+ C    + NG  AL LA  +   ++V  +  +E +  T     +     HIAA+ G    ++ L+E G+  +N     G+T L+ A    H++IVK+LL  GA+  + T
Sbjct:    9 DAATSFLRAARNGNLERLMDHLKGGM-DINTC----NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTAL--HIAALAGQTDIVRVLVEFGA-NINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVAT 139          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.403e-15
Identity = 67/208 (32.21%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            N  + RG T LH+AA  G+   +  L    R    +DA+ R  Q TPL  AA  G++ IV+LL++H  + D    +G TPLH+AA EGH  +    LE G       L      GFT L +A    K E+   +  +   P       +   P H+A+   +      LL++G+ + + T   GYT LH A     ++I   LL  GA
Sbjct:   75 NATNVRGETALHMAARAGQTEVVRSL---LRNGAQVDAKAREEQ-TPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHG-----ASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAG--KNGLTPLHVASHYDNQKVALLLLDQGA-SPHATAKNGYTPLHIAAKKDQLEIATTLLEYGA 270          

HSP 2 Score: 77.0258 bits (188), Expect = 7.380e-15
Identity = 58/172 (33.72%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  472 WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYI--RDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKT 981
            +TPL  A    RI ++ELL+++G + +     G TP+H++A  G+L +V   L+ G         A +  G TAL +A    + E+V+ +     + D +  E     Q P HIAA  G L  +Q LL+  +     T N GYT LH A   GH D+   LL  GAS+ + T
Sbjct:   16 FTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASP-----NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKARE----EQTPLHIAARLGKLEIVQLLLQHMASPDAATSN-GYTPLHVAAREGHEDVTAILLEHGASLAVTT 177          

HSP 3 Score: 65.855 bits (159), Expect = 2.142e-11
Identity = 81/314 (25.80%), Postives = 121/314 (38.54%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYL---------ANFTRLLP---------------------NLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVN-GDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            LH AA  G + IV  L+  M  P    +N   +T  HVA   G +  + ++++     +     +G T LH+A+ +G+      L         A    L P                     +  A  +N  +TPL  AA   ++ I   L+ +G  T+     G  PLHL A EGH  +    L       H        +G + L LA  + K  + + +    K          L Y   I A + G++  +  LL+ G+  VN     GYT LH+A   GH  IV  LL  GA     T+   T + I 
Sbjct:  118 LHIAARLGKLEIVQLLLQHMASPDAATSNG--YTPLHVAAREGHED-VTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKN-GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNH-----ATKSGLSPLHLAAQEDKVNVAEIL---VKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGA-DVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIA 418          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.541e-15
Identity = 86/283 (30.39%), Postives = 129/283 (45.58%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGC----HDIHKC----LTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPG---HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            S LH A+  G + +V  L+D      D+D+ N+   TA HVA   G+D  +  LI     V N+ + RG T LH AAA  HG   C+  L N      +++ Q ++ + +PL   A HGR +  + LI++G   D  D DG TPLH+AA  GH  L+   +  G       IH      L A+        KL     K  IV    ++      +E+    ++     H AA  G++  +  LL  G+  +N  D    T LH A  + ++  V  L++ GA
Sbjct:  206 SPLHAASSSGQIGVVKLLLD---LGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANV-NQANERGFTPLHFAAASTHGAL-CLELLVNNGA---DVNVQSKDGK-SPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGA-DMNKKDRFERTALHYAAANCNVQCVVTLVASGA 478          

HSP 2 Score: 78.9518 bits (193), Expect = 2.083e-15
Identity = 70/227 (30.84%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  301 CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            CLE L +RK       D +G T +H AAA+G   C+  L        + D +      +PL  AA+HG    +E+LIR  V  DV + +G TPL LAA  GH   V+  ++ G       L     +  TAL  A T    E ++ + +        +  D + Q P  +A  NG       LL KG+ ++N  DN+G T LH+   +GH + V  LL +   + ++
Sbjct:  530 CLEHL-LRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQS-DGK-SGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGA----SVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGA-SINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLR 748          

HSP 3 Score: 68.1662 bits (165), Expect = 4.222e-12
Identity = 72/303 (23.76%), Postives = 124/303 (40.92%), Query Frame = 1
Query:  157 SLLHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQ----YPGHIAAVNGDLLNIQGLLEK-GSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTL------------GQETVIDIV 1011
            + LH AA  G V  +  L++  +    +D ++A   T   +AV  G   C  SL++ K   IN  D++GCT LH  AA G   C                                     V+LL++  V   + +  GR PLH+AAA GH+ ++   ++         +   D NG+T L  A     D  V+ + +        ++F   +     P H A +N +    + L++  G+  +N  D +G   LH A  + H++ ++ LLS  A + +  +            GQ T ++++
Sbjct:  652 TALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDC-ASLLLSKGASINAKDNKGCTALHRGAATGHEEC-------------------------------------VDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAP-IPLTDRNGYTPLHWACYNGHDGCVELLLE-------LDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVL 908          

HSP 4 Score: 60.8474 bits (146), Expect = 8.247e-10
Identity = 74/252 (29.37%), Postives = 115/252 (45.63%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKM---EFPSDL-DNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANF--TRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYT 897
            LH AA  G + I++ L+        P  L D N   +T  H A   G D C+E L+  + +V  + +    + LH A  +    C   L +    +++   DA+ R     PL  AA+   +  ++LL+ H    +VTD+ G++PL +A   G    V+  +     D    L   D N  TAL LA ++S +     I DK  D       +  LQ P H+AA +G    +Q LL KG+ ++   D+ GYT
Sbjct:  756 LHMAAACGHMGILSALVQAAMASGAPIPLTDRNG--YTPLHWACYNGHDGCVELLL--ELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGR----MPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTD----LKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGA-SILAVDHNGYT 994          

HSP 5 Score: 60.4622 bits (145), Expect = 1.161e-9
Identity = 84/361 (23.27%), Postives = 143/361 (39.61%), Query Frame = 1
Query:   82 ARFKRAVKDIDPVEIRKII--------MEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHC---------------------MHYLA--NFTRLLPNLDAQCRNMQW------TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEG-----------------CH-----------DIHKCLTAVDNNGFTALKLAETKSKDEI-VKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            A   +A+ + DP E+R +I        ++D   + LH AA  G   I+  L+      +  DN    W T  H A     +A +++L+    +V N  D    T LH+AAA+    C                     +H+ A    + ++  L A+  N+          + +AA+ G   +V++L+ HG      D  G +PLH A++ G + +VK  L+ G                 C+           D    +   +  GFT L  A   +   + ++ + +   D        D + P H+ AV+G     Q L++ G   ++  D  G T LH A   GH  ++  L++ GA
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNK---WLTPLHRACASRSEAAVQTLLKHSADV-NARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQS--KDGKSPLHMTAVHGRFTRSQTLIQNGG-EIDCEDRDGNTPLHIAARYGHELLINTLITNGA 361          

HSP 6 Score: 55.0694 bits (131), Expect = 4.953e-8
Identity = 66/232 (28.45%), Postives = 99/232 (42.67%), Query Frame = 1
Query:  277 AVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            A+  G    + SLI +K EV N  D    T LH AA  G    +  L     +L       ++ +W TPL  A      + V+ L++H    +  D + +TPLH+AAA   +   +  +      +       D  G TAL  A      E+V ++  K  +   ++  D      H AA  G    ++ L+  G+  V   D +GY+ LH A  SG I +VK LL  G  I
Sbjct:   13 AIFNGDPDEVRSLIYKKEEV-NAVDDEKRTPLHAAAYLGEAEIIELL-----VLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIP-----MLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAI--HWAAYMGHTEVVKVLVAHGA-DVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDI 230          

HSP 7 Score: 53.9138 bits (128), Expect = 1.096e-7
Identity = 51/195 (26.15%), Postives = 83/195 (42.56%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIV----KYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI------------WIKTLGQETVIDIV 1011
             PL+ A ++G    V  LI      +  D + RTPLH AA  G   +++  +  G       + + DN   T L  A     +  V    K+  D     + W      Q P H+AA N  +   + ++   S + N +D  G T LH A  +GH ++V +L++KGA+I            W   +G   V+ ++
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGAR-----VNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNW------QTPLHVAAANRAVKCAEAIIPMLS-SSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVL 190          

HSP 8 Score: 51.6026 bits (122), Expect = 5.014e-7
Identity = 63/240 (26.25%), Postives = 97/240 (40.42%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLH-LAAAEGHLPLVKYF------------LEEGCHDIHKCLTAV----------DNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNR---GYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            I+ PD  G T LH AA+ G   C++ L +    +   D      + T L YAA +  +  V  L+  G   +  D    TPLH  AAA+G    V +             +   C +   CL  +          D  G+T +  A        ++ + ++    ++         P H+AA +G      G LE    ++ D D R   GYT L  A + GH D V+ L+  GAS+ +K
Sbjct:  414 IDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKD----RFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGH----HGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLK 645          

HSP 9 Score: 48.1358 bits (113), Expect = 6.011e-6
Identity = 49/172 (28.49%), Postives = 72/172 (41.86%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAET----KSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            TPL  AA+ G   I+ELL+  G   +  D    TPLH A A      V+  L+         + A D N  T L +A      K  + I+  +       R        +   H AA NG    +  L+ KG+  +N  D +    +H A   GH ++VK L++ GA +  K
Sbjct:   41 TPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSAD-----VNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAG------RTALHHAAFNGHSEMVNFLVAKGA-NINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCK 200          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 56.9954 bits (136), Expect = 1.197e-9
Identity = 45/136 (33.09%), Postives = 63/136 (46.32%), Query Frame = 1
Query:  550 DVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSK 957
            D  D  G TP H+A + G+L +VK   +     +   L  + N G T L LA  K   E+ +++ +     R  + F+  Q P H AA  G L  I+ L   G  AVN  D +G+T L  A   GH D    L+ K
Sbjct:   66 DYPDDSGWTPFHIACSVGNLEVVKSLYDR---PLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFN--QIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 2 Score: 53.5286 bits (127), Expect = 1.707e-8
Identity = 50/157 (31.85%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKME------FPSDLDNNAEIWTAAHVAVIGGKDACLESLIMR--KPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHG-VATDVTDVDGRTPLHLAAAEGH 606
            LHW+    +  I +FL+ KME      +P D       WT  H+A   G    ++SL  R  KP+ +N+  ++G T LHLA     +    +L      +   D         PL  AA  G + ++ELL   G  A +  D  G TPL  A AEGH
Sbjct:   40 LHWSVSFQAHEITSFLLSKMENVNLDDYPDD-----SGWTPFHIACSVGNLEVVKSLYDRPLKPD-LNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKD----KFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGH 186          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 58.5362 bits (140), Expect = 2.024e-9
Identity = 46/174 (26.44%), Postives = 80/174 (45.98%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW--TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVD 675
            LHWA++   + +V+FL+ +    +D++  A     T  H A   G    ++ L+    +     D +G  LLHL+        + Y+         LD  CR+ +  T L++AA+ G    V  L++ G +  + D +G TPLH    +G   ++KY +++G     K  T  D
Sbjct:  113 LHWASINNRLSVVDFLVSQ---GADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADP-TMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKD 282          

HSP 2 Score: 49.2914 bits (116), Expect = 1.686e-6
Identity = 51/195 (26.15%), Postives = 80/195 (41.03%), Query Frame = 1
Query:  262 TAAHVAVIGGKDACLESLIMRKP-EVINRPDS-RGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFL----EEGCHDI-----------------------------HKCLTAVDNNGFTALKLAETKSKDEIVKYI 741
            T  H A   G  A ++ +I  K  EV N  DS    T LH A+ + R   + +L +      +++A+   +  TPL +AA +G + IV+ L++HG    +TD  G   LHL+    ++ LV Y L     +G  DI                                +   D  GFT L     K +  ++KY+
Sbjct:   75 TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGA---DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYL 266          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 56.6102 bits (135), Expect = 1.070e-8
Identity = 37/100 (37.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:  349 DSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVD--GRTPLHLAAAEGHLPLVKYFLEEGC 642
            DS G T L +A   G+Y  +  +        N      N   T L  AA  G I IVELLI +G   ++  ++  G TPL  A+A GHL +VKY L+ G 
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGN---TALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGA 423          

HSP 2 Score: 53.9138 bits (128), Expect = 7.505e-8
Identity = 27/71 (38.03%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  802 HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTL---GQETVID 1005
             IA   G    ++ ++E+G   +ND DN G T LH+A + GHI+IV+ L+  GA + IK++   G   +ID
Sbjct:  335 QIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLID 405          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 49.2914 bits (116), Expect = 1.675e-6
Identity = 58/217 (26.73%), Postives = 90/217 (41.47%), Query Frame = 1
Query:  370 LHLAAAHGRYHCMHYL----ANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDI 1008
            LH A  + R+    +L    AN     PN  A       T L +AA +G I IV+LL++HG    + D  G   +H +    ++ LV           +     V+NN        +  SKD       +  + P  W            AA  GD L ++ LL+ GS  V  TDNRG+  LH A + G   ++  L+  GA+ + +   ++   D+
Sbjct:   88 LHWACINNRFSVAKFLLLRGAN-----PNQAAGPGGA--TALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVV----------YVLYFVVNNN-----DNVDIDSKD-------NNNRTPLLW------------AAYQGDFLTVELLLKFGS-TVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDL 262          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 46.9802 bits (110), Expect = 7.169e-6
Identity = 48/205 (23.41%), Postives = 78/205 (38.05%), Query Frame = 1
Query:   73 DDDARFKRAVKDIDPVEIRKIIMEDTDL----------SLLHWAALKGSVVIVNFLI----DKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATD--VTDVDGRTPLHLAAAEGHLPLVKYFLEEG 639
            +   R + A+ + + + +++++  + DL          S LH+A+  G  +I  +LI    DK E       N    T  H+A++ G +  L  L+ + P  IN     G   +H+A  +  Y C+                                      LLI  GV  D  V D +G TPLH+    G +  +K  L EG
Sbjct:    4 EPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGN----TCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCL-------------------------------------SLLI--GVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Nematostella
Match: EDO43381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU3])

HSP 1 Score: 74.3294 bits (181), Expect = 9.107e-14
Identity = 54/168 (32.14%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  232 SDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLD-AQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIV 732
            S+ +N      + H A   G  A ++ LI   P + + PD +G T LH+A+++G   C+ +LA     +  +D  Q     +T +  AA  G ++ + +L   G   +   VD +TPLHLAA  GHL  VK+ L            A D+NG TAL +AE    ++IV
Sbjct:  893 SESENVFRTGPSIHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLA-----VSGVDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRSR-----TEAEDSNGRTALDIAEEYGHEDIV 1050          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 69.3218 bits (168), Expect = 1.975e-13
Identity = 59/214 (27.57%), Postives = 95/214 (44.39%), Query Frame = 1
Query:  337 INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGF---TALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +N+ D  G + LH A    RY+ +  +A   R     +    ++  TPL  A   G + +  LL+  G A D  +  G TPLH+AA  G    +K+ L +G         A+D   F   T    A    + E    + +K+++ ++         P H+A   G  L+++ L   G ++ N+ D  G + LH A +SG   +V  LL  GA I
Sbjct:    1 LNKMDDTGFSALHHAT---RYNRVEAMAELIR-----NGSIEDLS-TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKG--------VAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDENQKS---------PLHLACAAGRALHVEALTRAG-LSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADI 187          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 70.8626 bits (172), Expect = 5.488e-13
Identity = 68/202 (33.66%), Postives = 87/202 (43.07%), Query Frame = 1
Query:  175 ALKGSVVIVNFLIDKMEFPSDL--DNNAEI-------WTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDA-QCRNMQ-WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRD 747
             L G V   N LI  +   S L  DN A I        T  H A   G+   + +L+ R P +IN  D    T LHLAA HG      + A    LL    A   RN   WTPL  AA  G + +  +L+      D TD    TPLHLA+ EGH+ +VK  L    +     +T  D+ G   L +A   S  E+   I D
Sbjct:  247 CLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHG------HAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKAN-----ITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 2 Score: 57.3806 bits (137), Expect = 1.169e-8
Identity = 79/324 (24.38%), Postives = 128/324 (39.51%), Query Frame = 1
Query:  139 MEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSD--------LDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPD-------------SRGCTLLHLAAAHGRYHCMHYLANFTR--LLPNLDA--------------QCRNM-QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEG------CHDIHKCLTAV---DNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +++  ++ LH+A ++G++ +   L    E             D + E  TA H+AV GG    L  L + K   +N                +R C  + +  +  +Y          R  LL   D               +CR+  + TPLM AA    +  V  L++HG      D++ R  +  AAAEG +  ++  LE        C D+  CL  +    N     L+++     D       D + D       +D+  P H AA  G +  +  LL++    +ND D    T LH A + GH  +VK LL +G +I
Sbjct:   33 LDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGD-LAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDV--CLNGLVGGSNKLILVLRISSQLLLDN--GACIDSKND-------EDIT-PIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAI 343          

HSP 3 Score: 54.6842 bits (130), Expect = 8.552e-8
Identity = 53/180 (29.44%), Postives = 72/180 (40.00%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDG--RTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDI 1008
            TP+ YAA  GR+  V  L++   A  + D DG   TPLHLAA  GH  +VK  L  G         A+D    T                                L  P   AA  G ++ +  +L      V+ TD    T LH A   GH+++VK LLS+ A+I +        +DI
Sbjct:  285 TPIHYAAKFGRVRTVCALLKRDPAI-INDEDGASNTPLHLAALHGHAAVVKELLYRG--------GAIDARNAT--------------------------------LWTPLDCAAARG-MVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDI 422          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Nematostella
Match: EDO37520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL9])

HSP 1 Score: 70.8626 bits (172), Expect = 1.338e-12
Identity = 75/304 (24.67%), Postives = 122/304 (40.13%), Query Frame = 1
Query:  115 PVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSR--------------------GCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGAS 966
            P E+       T+++ LH+AA   +  ++  L +       LD N+   T A +A   G+   L  L  +   + +  +S                     G +LLH AA  G    + +L N  +L  + ++   N   TP+  AA +GR+S++E+L +HG   D        PL  AAA GHLP V++  + G  D  +C+            ++ +  K  + K + D+      W     L    HIA+       +  +L     A+   D  G   LHKA +   I  +K  L  G S
Sbjct:  791 PSELLNSSDSTTNMTALHFAASTSNTGVIGLLANHFSTVDCLDRNSR--TPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNH-KLSKDAESGAGN---TPMQIAAQYGRVSVMEVLHKHGAPCD------PRPLRSAAAGGHLPAVRFLHQAGVSD--ECVPC-------KYSISPSYMKQRVGKLVDDE----YLWRCETAL----HIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVS 1065          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Nematostella
Match: EDO36720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHV7])

HSP 1 Score: 66.2402 bits (160), Expect = 4.213e-12
Identity = 60/200 (30.00%), Postives = 92/200 (46.00%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGC-----HDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDK--EKDPRTWELFDDLQYPG---------------HIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDI 1008
            T L  A + G + +V+LL+ +G   D+ D +G + LH AA  G+L +++Y +  G      +D+ +    V  +    + LAE   +  + K + DK   K P+   L  D    G               H  A  GD  ++Q LLE G+  VN     G + LH+A  SG+ID    LL  GA ++ +T G    IDI
Sbjct:   48 TALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVATDVHCVIVLAEGMKRAGLRK-LTDKFFAKRPQLKTLIKDSLIQGLDNVNDLNDSGISLLHEMAGRGDSESVQFLLEHGA-EVNRQSLNGSSPLHEAVQSGNIDCTLLLLRSGADLYAETDGGFLPIDI 245          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 88.9669 bits (219), Expect = 1.374e-19
Identity = 57/183 (31.15%), Postives = 94/183 (51.37%), Query Frame = 1
Query:  121 EIRKIIMEDTDLSL---------LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYH-CMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEG 639
            ++++ I+ D  L+          LHWA   G   IV FL+D +    +L ++A  WT  H+A   G++  +++LI +  + +N  +  GCT LH AA+  RY   +  L N     PN   +   ++WTPL  A+  G   +++LL++   +T++ D  G TPLHLA  E  +   K  +E G
Sbjct:   21 KLKQCILSDKTLACKTDQDRRTALHWACSAGHTNIVEFLLD-LGVEVNLQDDAS-WTPLHIAASAGREDIVKALISKGAQ-LNSVNQNGCTPLHYAASKDRYEIALMLLENGAD--PNATDK---LEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHG 195          

HSP 2 Score: 83.9593 bits (206), Expect = 7.732e-18
Identity = 62/180 (34.44%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            T L +A   G  +IVE L+  GV  ++ D    TPLH+AA+ G   +VK  + +G       L +V+ NG T L  A +K + EI   + +   DP      D L++ P H A+  G+   IQ LL K S + N  D +G T LH AC    ++  K L+  GASI+I+   ++T + I 
Sbjct:   42 TALHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQ-----LNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNA---TDKLEWTPLHRASAKGNYRLIQ-LLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIA 212          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 86.2705 bits (212), Expect = 5.248e-17
Identity = 87/312 (27.88%), Postives = 139/312 (44.55%), Query Frame = 1
Query:   76 DDARFKRAVKDIDPVEIRKIIMEDTDLSL--------LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDI-VKWLLSKGASIWIKT 981
            D     +A+ ++DP E+R +I +  D++         LH AA  G   I+  LI      +  DN    W T  H AV    +  ++ L+    +V N  D    T LH+AAA+    C   L     LL N++   R  + T L +AA+ G + +V LL+  G   +  D   R  +H AA  GH+ +VK     G       +T  D   +T L  A +     +VK++ D   D      + +   P H+A  NG  + +  L+E G+  VN  + +G+  LH    S H  + ++ L+  GA + IK+
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNK---WLTPLHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVRCAEAL---VPLLSNVNVSDRAGR-TALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAE-----VTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNT--PLHVACYNGQDVVVNELIECGA-HVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKS 303          

HSP 2 Score: 73.9442 bits (180), Expect = 3.682e-13
Identity = 80/284 (28.17%), Postives = 120/284 (42.25%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFL-------EEGCHDIHK-----------CLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPR-TWE--------LFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACIS 921
            LH AA  G + +V FL+D      D++  NA   T  HVA   G+D  +  LI     V N+ + +G   LH  AA  HG   C+  L     +    D   ++    TPL   A HGR S  + +I +G   D  D +G TPLH+AA  GH  L+   +       + G H +             C   + ++GF      +  + D+  +       +   +W+        +F   + P H AA N +   +  L+  G+ +VND D RG T LH A  S
Sbjct:  210 LHAAASSGMISVVKFLLD---LGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHV-NQVNEKGFAPLHFTAASRHGAL-CLELL-----VCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGF------DIDTPDDFGRTCLHAAAESNLSWKPTLFFSCFIFSQFRTPLHYAAANCNYQCLFALVGSGA-SVNDLDERGCTPLHYAAAS 476          

HSP 3 Score: 73.1738 bits (178), Expect = 6.380e-13
Identity = 77/293 (26.28%), Postives = 128/293 (43.69%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDA-CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLAN-FTRLLPNLDAQCRNM--------QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            LH+AA   +   +  L+      +DLD      T  H A     D  CLE L+        R D++G   +H A+A+G   C+  + N F    P ++    ++          +PL  AA+HG    +E+L++  +  DV +  GRTPL LAA +GH+  V   + +G   + K  T        A K  + K K ++      + K+ R       L     +A ++G    +  LL KG+ +V   D  G T LH+  ++GH + ++ LL   AS  ++     T + + 
Sbjct:  437 LHYAAANCNYQCLFALVGSGASVNDLDERG--CTPLHYAAASDTDGKCLEYLLRNDANPGIR-DNQGYNAVHYASAYGHRLCLELVRNAFPPCYPLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAGKNCK-KEKTKLPGLCNLRLKNMRNANGLTPLM----LAVLSGHTDCVYSLLNKGA-SVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLA 720          

HSP 4 Score: 62.003 bits (149), Expect = 1.573e-9
Identity = 69/235 (29.36%), Postives = 96/235 (40.85%), Query Frame = 1
Query:  262 TAAHVAVIGGKDACLESLIMRKPEVINRP---DSRGCTLLHLAAAHGRYHC-----MHYLANFTR--------------LLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYT 897
            T  H+A   G    L  L+     V   P   DS G T LH A  +G+Y       + + A F R              L P +         TPL  AA+   +  ++LL+ H    +  D  G++PL +AA  G    V+  +     D    LT  D    TAL LA +K  +     I +K  D       +  LQ P H+AA NG  + +Q LL KG+ +V   D  GYT
Sbjct:  715 TPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGKYQMDLLLDISFFA-FLRIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKAD----LTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGA-SVLAVDENGYT 943          

HSP 5 Score: 56.9954 bits (136), Expect = 6.391e-8
Identity = 56/218 (25.69%), Postives = 87/218 (39.91%), Query Frame = 1
Query:  340 NRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEI--------VKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            N  ++ G T L LA   G   C++ L N    +   D   R    T L   A  G    +E L++H  +  V D  GRTP+HLAAA GH+ ++   L      +       D++G+T L  A    K ++          ++R ++ +     L D L                      G   VN  D +  T LH A  + H++ ++ LLS  A +
Sbjct:  641 NMRNANGLTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGR----TALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAA-QSVETLPVLTDSHGYTPLHWACYNGKYQMDLLLDISFFAFLRIRDNEGAAEMLIDTL----------------------GPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQV 831          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Medaka
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:101174941])

HSP 1 Score: 85.8853 bits (211), Expect = 5.529e-17
Identity = 79/273 (28.94%), Postives = 124/273 (45.42%), Query Frame = 1
Query:  142 EDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEV-INRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSK 957
            ++   + LHWAA  G   I   L+D+    ++ D      T AHVA   G++  +  L+ R  +V I   D+   T LH AA  G    +  L    +   ++D Q  + + T L  A+  G+  +  +LI  G +  +T V   TPLH+AA  GH    +  ++    D+H    A +  G T L LA  +     VK +  +  DP        L  P H+AA +G    ++ LL     A + TD  G + LH A  +GH +++K LL +
Sbjct:  506 DEDQFTALHWAAQNGDEAIARLLLDRGAAINETDGQGR--TPAHVACQHGQENVIRVLLSRGADVQIKGKDN--WTALHFAAWQGHLGIVKLLVK--QAGADVDGQTSDGR-TSLHLASQRGQYRVARILIELGASVHLTSVGLNTPLHVAAETGHTSTSRLLIKHKA-DMH----AQNTQGLTPLHLACQRGHLATVKMLIAEGADPS--RPSQTLCTPCHLAAGSGHCEVLKELLLHCPDAGSVTDEEGLSPLHLAVGAGHSNVIKMLLPQ 764          

HSP 2 Score: 65.4698 bits (158), Expect = 1.214e-10
Identity = 65/237 (27.43%), Postives = 103/237 (43.46%), Query Frame = 1
Query:  352 SRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTP---------------------------------LHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
            +RG T LHLA    +      L    R   N++A+  + Q+T L +AA +G  +I  LL+  G A + TD  GRTP                                 LH AA +GHL +VK  +++   D+        ++G T+L LA  + +  + + + +         +   L  P H+AA  G   +   LL K    ++  + +G T LH AC  GH+  VK L+++GA
Sbjct:  473 TRGSTPLHLATEKHQKPLAELL--LGRRSMNVNAKDED-QFTALHWAAQNGDEAIARLLLDRGAAINETDGQGRTPAHVACQHGQENVIRVLLSRGADVQIKGKDNWTALHFAAWQGHLGIVKLLVKQAGADV----DGQTSDGRTSLHLASQRGQYRVARILIELGASVHLTSV--GLNTPLHVAAETGH-TSTSRLLIKHKADMHAQNTQGLTPLHLACQRGHLATVKMLIAEGA 699          

HSP 3 Score: 53.9138 bits (128), Expect = 5.007e-7
Identity = 42/137 (30.66%), Postives = 61/137 (44.53%), Query Frame = 1
Query:  568 GRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            G TPLHLA  +   PL +  L     +++    A D + FTAL                                   H AA NGD    + LL++G+ A+N+TD +G T  H AC  G  ++++ LLS+GA + IK
Sbjct:  475 GSTPLHLATEKHQKPLAELLLGRRSMNVN----AKDEDQFTAL-----------------------------------HWAAQNGDEAIARLLLDRGA-AINETDGQGRTPAHVACQHGQENVIRVLLSRGADVQIK 571          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 85.8853 bits (211), Expect = 6.564e-17
Identity = 87/312 (27.88%), Postives = 139/312 (44.55%), Query Frame = 1
Query:   76 DDARFKRAVKDIDPVEIRKIIMEDTDLSL--------LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDI-VKWLLSKGASIWIKT 981
            D     +A+ ++DP E+R +I +  D++         LH AA  G   I+  LI      +  DN    W T  H AV    +  ++ L+    +V N  D    T LH+AAA+    C   L     LL N++   R  + T L +AA+ G + +V LL+  G   +  D   R  +H AA  GH+ +VK     G       +T  D   +T L  A +     +VK++ D   D      + +   P H+A  NG  + +  L+E G+  VN  + +G+  LH    S H  + ++ L+  GA + IK+
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNK---WLTPLHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVRCAEAL---VPLLSNVNVSDRAGR-TALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAE-----VTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNT--PLHVACYNGQDVVVNELIECGA-HVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKS 303          

HSP 2 Score: 77.411 bits (189), Expect = 3.042e-14
Identity = 76/282 (26.95%), Postives = 128/282 (45.39%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDA-CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNM--------QWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIK 978
            LH+AA   +   +  L+      +DLD      T  H A     D  CLE L+        R D++G   +H A+A+G   C+  +A+ T L   ++    ++          +PL  AA+HG    +E+L++  +  DV +  GRTPL LAA +GH+  V   + +G   + K  T       T +  A T    E ++ +          ++ D + Q P  +A ++G    +  LL KG+ +V   D  G T LH+  ++GH + ++ LL   AS  ++
Sbjct:  442 LHYAAANCNYQCLFALVGSGASVNDLDERG--CTPLHYAAASDTDGKCLEYLLRNDANPGIR-DNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKR----TPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGA-SVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVR 715          

HSP 3 Score: 71.633 bits (174), Expect = 1.798e-12
Identity = 82/321 (25.55%), Postives = 131/321 (40.81%), Query Frame = 1
Query:  136 IMEDTDL----SLLHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIV---------------------------------ELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQ----YPGHIAAVNGDLLNIQGLLEK-GSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            I+ D+D+    S LH AA  G    +  L+  +    DLD  N++  T   +A   G   C++ LI +   ++ +  +   T +H AA +G   C+  L     L   +D Q  N Q TPLM A   G    V                                 E L++H  +  V D  GRTP+HLAAA GH+ ++   L      +       D++G+T L  A     D  V+ + ++       E+F   +     P H A +  +    + L++  G   VN  D +  T LH A  + H++ ++ LLS  A +
Sbjct:  541 ILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLL---DLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQ-TPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAA-QSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQ-------EVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQV 849          

HSP 4 Score: 70.4774 bits (171), Expect = 3.761e-12
Identity = 83/285 (29.12%), Postives = 119/285 (41.75%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFL-------EEGCHDIHK-----------CLTAVDNNGF----------TALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACIS 921
            LH AA  G + +V FL+D      D++  NA   T  HVA   G+D  +  LI     V N+ + +G   LH  AA  HG   C+  L     +    D   ++    TPL   A HGR S  + +I +G   D  D +G TPLH+AA  GH  L+   +       + G H +             C   + ++GF          T L  A      E +  + +   D    + F   + P H AA N +   +  L+  G+ +VND D RG T LH A  S
Sbjct:  210 LHAAASSGMISVVKFLLD---LGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHV-NQVNEKGFAPLHFTAASRHGAL-CLELL-----VCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFG--RTPLHYAAANCNYQCLFALVGSGA-SVNDLDERGCTPLHYAAAS 481          

HSP 5 Score: 63.5438 bits (153), Expect = 5.106e-10
Identity = 67/250 (26.80%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLD--NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKG-SIAVNDTDNRGYTM 900
            +H AA  G + ++  L+   +    L    ++  +T  H A   G D C+E L+ +  EV ++ +    + LH A           L     L P +         TPL  AA+   +  ++LL+ H    +  D  G++PL +AA  G    V+  +     D    LT  D    TAL LA +K  +     I +K  D       +  LQ P H+AA NG  + +Q LL KG S+   D + + +T 
Sbjct:  723 VHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQ--EVFHKAEGNPFSPLHCAVIRDNEGAAEML--IDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKAD----LTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGKHFTF 964          

HSP 6 Score: 56.9954 bits (136), Expect = 5.504e-8
Identity = 85/326 (26.07%), Postives = 124/326 (38.04%), Query Frame = 1
Query:   76 DDARFKRAVKDIDPV--EIRKIIMEDTDL--SLLHWAALKGSVVIVNFLIDKMEFPSDLD-NNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATD----VTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRD------------KEKDPRTWELFDD----LQY-----------------PGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGH 927
            D A FK  V+ +D +  +   I+++D  L  + +H AA  G    +  LI   +  S +D  +    T   +AV+ G   C+ SL + K   +   D  G T LH  A  G   CM  L         L   CR    TP+  AA  G I ++  L+    + +    +TD  G TPLH A   GH   V+  LE+     HK     + N F+ L  A  +  +   + + D            K + P     F D    LQ                  P  +AA NG    ++ L+      +   D    T LH AC  GH
Sbjct:  588 DLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSL-LNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASF--LVRDCRGR--TPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQ--EVFHK----AEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGH 902          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 85.8853 bits (211), Expect = 6.636e-17
Identity = 82/274 (29.93%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLID---KMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAA--HGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            LH AA  G + +V  L+    +++ P+   N     TA H+A   G+DA +  LI     V ++P+++G T LH AAA  HG   C+ +L N      +++ Q R+ + +PL   A HGR +  + LI++G   +  D DG TPLH+AA  GH  L+   +  G     + +     +G   L LA   +  +  + +        T +         H AA  G++  +Q LL+ G    N TD  G T LH A  S H   ++ L+  G  I
Sbjct:  210 LHAAASSGQIAVVKHLLSLSVEIDEPNAFGN-----TALHLACFNGQDAVVSELIDYGANV-SQPNNKGFTPLHFAAASTHGAL-CLEFLVNNGA---DINIQSRDGK-SPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGV-----HGMFPLHLAALNAHSDCCRKLLSSGFQIDTPDSLGRTCL--HAAAAGGNVDCVQLLLKSGG-EHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDI 464          

HSP 2 Score: 77.411 bits (189), Expect = 2.779e-14
Identity = 69/224 (30.80%), Postives = 102/224 (45.54%), Query Frame = 1
Query:  301 CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            CLE L+        + D +G + +H AAA G  HC+  L + T      +A C N Q +PL  AA+HG    +++L+R G   D  D  GRTPL LAA  GH   V   L +G       L+     G T + LA        V+ + D+       ++ D   + P  +A V G +  +  LLE+    VN  D +G   LH A +    + V+ LL + A +
Sbjct:  509 CLEFLLQSGAAAALK-DKQGYSPVHYAAAFGHRHCLELLLD-THDGRQEEADCGNAQ-SPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASP----LSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLER-EANVNTADKKGLMALHLALLCAQDECVQCLLEQDACL 724          

HSP 3 Score: 72.7886 bits (177), Expect = 8.281e-13
Identity = 95/370 (25.68%), Postives = 144/370 (38.92%), Query Frame = 1
Query:   55 FAYITADDDARFKRAVKDIDPVEIRKIIMEDTDLSLL--------HWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW-TAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHC---------------------MHYLA--NFTRLLPNLDAQCRNMQ------WTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEE----------GCHDIH-KCLTAVD-----------------NNGFTALKLAETKSKDEI-VKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGA 963
             A +   D     +A+   DP EIR +I +  D+++L        H AA  G   I   LI      +  DN   +W T  H AV       ++ LI R    +N  D    T LH+AAA+    C                     +H+ A    T ++  L A+  N+          L +AA+ G + +V +L+ HG      D  G TPLH AA+ G + +VK+ L            G   +H  C    D                 N GFT L  A   +   + ++++ +   D        D + P H+ AV+G     Q L++ G   +N  D  G T LH A   GH  ++  L++ GA
Sbjct:    1 MAVLKLADQPALIQAIFSGDPEEIRMLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARVNAKDN---MWFTPLHRAVASRSQDAVQVLI-RHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQS--RDGKSPLHMTAVHGRFTRSQTLIQNGG-EINSVDKDGNTPLHVAARYGHELLINTLITSGA 363          

HSP 4 Score: 70.4774 bits (171), Expect = 3.751e-12
Identity = 74/266 (27.82%), Postives = 114/266 (42.86%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLI-----DKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGC--------TLLHLAAAHGRYHCMHYLANFTRLLPNLDAQ------CRNMQW-TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYT 897
            +H AA +G    ++ L+     +    P   D +   +T  H A   G+D C+E L+          + RGC        T LH A  +G   C   L         LDA       CR+ +  TPL  AA+ G+   ++LL+ H    D  D  GRTPL  AAA+G +  ++  L+ G       L+ +D +G T L +A +   ++ V  I  +  D       +  +Q P H+AA  G    +Q LL +G+ +    D  G T
Sbjct:  735 IHLAAAQGHASWLSELLTIACSESSSVPPLKDGSG--YTPLHWACFYGQDGCVEVLL----------EQRGCRCIDGNPFTPLHCAVVNGHESCAALL---------LDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAG-----AGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGA-STQTVDEDGLT 973          

HSP 5 Score: 69.707 bits (169), Expect = 6.497e-12
Identity = 78/279 (27.96%), Postives = 118/279 (42.29%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIW--TAAHVAVIGGKDACLESLIMRKP---EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLM---YAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQY-PGHIAAVNGDLLNIQGLLEK-GSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            L  AAL+G    V+ L+ +   P   D   +++  T  H+AV+ G   C+  L++ +P   EV++  D +G T L LA   G         +   LL   +A         LM    A    +   V+ L+         D  GRTP+HLAAA+GH   +   L   C +        D +G+T L  A    +D  V+ + ++    R     D   + P H A VNG       LL+  GS      D +G T LH A  +G  + ++ LLS  A +
Sbjct:  599 LALAALRGHADCVHTLLSQGASPLSTD---QLYGRTPVHLAVMNGHTTCVR-LLLDEPDGAEVLDVADPQGRTPLMLAVVGGHV-------DAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQ----RGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPV 862          

HSP 6 Score: 67.3958 bits (163), Expect = 3.258e-11
Identity = 73/255 (28.63%), Postives = 103/255 (40.39%), Query Frame = 1
Query:  271 HVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAA---------------EG--------HLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGAS 966
            H+A +     C   L+    + I+ PDS G T LH AAA G   C+  L          D   R    TPL YAA       +E L+  G   + TD  GR+ LH AAA               EG            +++ L+ G     K     D  G++ +  A        ++ + D     +      + Q P H+AA +G    +Q LL +G   V++ D  G T L  A + GH D V  LLS+GAS
Sbjct:  377 HLAALNAHSDCCRKLLSSGFQ-IDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGR----TPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALK-----DKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLL-RGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGAS 620          

HSP 7 Score: 63.5438 bits (153), Expect = 5.850e-10
Identity = 81/309 (26.21%), Postives = 131/309 (42.39%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANF----TRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRH-------------------------------GVATDVT---DVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIA--VNDTDNRGYTMLHKACISGHIDIVKWLLSKGAS 966
            L  A + G V  V+ L+++    +  D       A H+A++  +D C++ L+ +   ++ + DS+G T +HLAAA G    +  L       +  +P L        +TPL +A ++G+   VE+L+                                  + +D+T   D  GRTPLH AA  G    ++  L    HD    +   D++G T L  A  K +   ++ + D         L D D   P H+A  NG    +  +L++ S A  +N T+    T LH A   G    V+ LLS+GAS
Sbjct:  669 LMLAVVGGHVDAVSLLLEREANVNTADKKG--LMALHLALLCAQDECVQCLLEQDACLL-QGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLK---DGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLS---HDAP--VDPADDHGRTPLMTAAAKGRVGALEALLDAGAG---LSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGAS 963          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Planmine SMEST
Match: SMESG000036685.1 (SMESG000036685.1)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 641/641 (100.00%), Postives = 641/641 (100.00%), Query Frame = 1
Query:    7 MLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIVXXXXXXXXXXXXXXXXXXXXPFLKKEDPDRRVFIXXXXXXXXXXXXXXXYKRLNELIEESKSEILNLEEMINKKEMILQLEQSEVXXXXXXXXXXLIKQKHRNIKALKYEIMKLNYQLNVVKFNLYQLTKEPTIKEREIGRALADCEHQFEEITDRLFYEREVREQTEAELSRIRQQLLKLRDFILKNDCPDDLVTMVIAFDKYLIGKENLTVIRKAPEKKDKVYSIQFEINDLSKITISKVSYYTDSKLIVKSNIENLSFKKFVEYIKCMIKQDMKRHXXXXXXXXXXXXXXHLHPKGGIFVTIK 1929
            MLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIVKRKGHGKLLKLLEAEEARYEPFLKKEDPDRRVFIPLLSSLDNPNLDSLDYKRLNELIEESKSEILNLEEMINKKEMILQLEQSEVDDETDDTDDDLIKQKHRNIKALKYEIMKLNYQLNVVKFNLYQLTKEPTIKEREIGRALADCEHQFEEITDRLFYEREVREQTEAELSRIRQQLLKLRDFILKNDCPDDLVTMVIAFDKYLIGKENLTVIRKAPEKKDKVYSIQFEINDLSKITISKVSYYTDSKLIVKSNIENLSFKKFVEYIKCMIKQDMKRHKIKKGNKGKQIKGKHLHPKGGIFVTIK
Sbjct:    1 MLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIVKRKGHGKLLKLLEAEEARYEPFLKKEDPDRRVFIPLLSSLDNPNLDSLDYKRLNELIEESKSEILNLEEMINKKEMILQLEQSEVDDETDDTDDDLIKQKHRNIKALKYEIMKLNYQLNVVKFNLYQLTKEPTIKEREIGRALADCEHQFEEITDRLFYEREVREQTEAELSRIRQQLLKLRDFILKNDCPDDLVTMVIAFDKYLIGKENLTVIRKAPEKKDKVYSIQFEINDLSKITISKVSYYTDSKLIVKSNIENLSFKKFVEYIKCMIKQDMKRHKIKKGNKGKQIKGKHLHPKGGIFVTIK 641          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Planmine SMEST
Match: SMESG000005009.1 (SMESG000005009.1)

HSP 1 Score: 174.866 bits (442), Expect = 2.176e-47
Identity = 108/315 (34.29%), Postives = 167/315 (53.02%), Query Frame = 1
Query:   97 AVKDIDPVEIRKIIMEDTDL---------SLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNN-GFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIV 1011
            AVK+ D  E++K++     +         + LHWAA  G++  +++L+     P+        WT AHVA I G+DAC++ LI      +N  D+RG T  HLA+ HG    +  +        ++D Q     WTP+  AA+HGR+  ++ L+R G+ +D  D  G T  HLAA EGHLP++K+ + +G      C+    N+ G T   LA+   K +IV+YI   E +    E    L +P H+AA N DL  ++ L+E G + +N+ DN G T LHKA   G++ +++WL+  GA+  I+    ET  DI 
Sbjct:   12 AVKNGDTEEMKKMVKSGASINEVDSEHKFTPLHWAAYVGALECMHWLMWNGADPTVCTPRG--WTPAHVASIKGQDACIQCLI-NNGVGLNSKDTRGSTPAHLASVHGNSFTLQAILRAGVETESVDYQG----WTPVHGAAFHGRLGCLQFLLRWGLRSDDVDNQGNTAAHLAAMEGHLPVLKFLVAQG--PTSSCVLGCRNDDGETPKMLAQRFFKQDIVEYISHLEWERDCPEEAMSLAFPAHLAAANDDLEQLRALIENGVVNINERDNHGSTPLHKAAGQGNLKVIQWLIELGANQEIQNDAGETAQDIA 317          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.175e-18
Identity = 87/302 (28.81%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH----------DIHK------------------CLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLS 954
            + + ++L  +H+A L GS  IV  LID+ +  S LD +       H A   G    LE L+ R   V N  D R  + +H AA +G    +  L      +   D         P+ YA  +G +++V LLI  G + ++ D D R P+H A    H+ +VK  L+  C+           IH                   CL A    G   +  A     DEIVK +  +  +    EL D D     H A   G L NI  +L   S  +N  D      +H AC +GH +IVK L+S
Sbjct:  127 VHDKSNLRPIHYACLSGSYQIVEMLIDRCQIES-LDKHD--MMPLHYASQNGHCGVLELLLSRVSNV-NAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPD----KFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN---IELQDKDSGRAIHYACCRGHL-NIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVS 416          

HSP 2 Score: 57.3806 bits (137), Expect = 2.680e-8
Identity = 63/242 (26.03%), Postives = 101/242 (41.74%), Query Frame = 1
Query:  331 EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGC----HD------IH-KCLT----------------AVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            EV  + D R    +H A   G Y  +  L ++     N++  C      P+ YA  +G   IVELL+ +    +  D +   PLH A   GH  +V+  L   C    HD      IH  CL+                ++D +    L  A       +++ +  +  +    +     Q P H AA NG +  +  LL+  S A+   D      +H AC +GH+++V+ L+S+G SI I
Sbjct:   27 EVFCKNDKRP---IHYACESGDYDIVKLLLSYK---CNIEV-CDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDRCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVD--KRSQSPIHYAAQNGHVDAVSLLLKHNS-AIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI 258          

HSP 3 Score: 53.9138 bits (128), Expect = 3.221e-7
Identity = 49/196 (25.00%), Postives = 87/196 (44.39%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRN-MQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRD 747
            +H+A+  G   IV  L+ +       D ++    A H A   G    +E L+ +  E IN  D      +H A  +G    +  L ++       D + R+  + TP+ YA ++G   ++ +L+ +    +V D D   P+H A   GHL +VK  + + C+     + A     ++ L LA  K   +IV+ + D
Sbjct:  333 IHFASFYGHDEIVKILLSERCNIELQDKDS--GRAIHYACCRGHLNIVEMLLAQSCE-INAGDKNYRRPIHHACQNGHCEIVKLLVSYK-----CDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCN-----IEACTKENWSPLDLASQKGFSQIVELLSD 515          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.394e-18
Identity = 87/302 (28.81%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  136 IMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCH----------DIHK------------------CLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFD-DLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLS 954
            + + ++L  +H+A L GS  IV  LID+ +  S LD +       H A   G    LE L+ R   V N  D R  + +H AA +G    +  L      +   D         P+ YA  +G +++V LLI  G + ++ D D R P+H A    H+ +VK  L+  C+           IH                   CL A    G   +  A     DEIVK +  +  +    EL D D     H A   G L NI  +L   S  +N  D      +H AC +GH +IVK L+S
Sbjct:  133 VHDKSNLRPIHYACLSGSYQIVEMLIDRCQIES-LDKHD--MMPLHYASQNGHCGVLELLLSRVSNV-NAVDKRSQSPIHYAAQNGHVDAVSLLLKHNSAIEAPD----KFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASFYGHDEIVKILLSERCN---IELQDKDSGRAIHYACCRGHL-NIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVS 422          

HSP 2 Score: 58.151 bits (139), Expect = 1.974e-8
Identity = 69/273 (25.27%), Postives = 114/273 (41.76%), Query Frame = 1
Query:  244 NNAEIWTAAHVAVIGGKDACLESLIMRKP--EVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGC----HD------IH-KCLT----------------AVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASIWI 975
            N+ ++    H A   G+   ++ L+M     EV  + D R    +H A   G Y  +  L ++     N++  C      P+ YA  +G   IVELL+ +    +  D +   PLH A   GH  +V+  L   C    HD      IH  CL+                ++D +    L  A       +++ +  +  +    +     Q P H AA NG +  +  LL+  S A+   D      +H AC +GH+++V+ L+S+G SI I
Sbjct:    2 NDNDLMRPIHYACQYGQLDLVKMLLMGMCDVEVFCKNDKRP---IHYACESGDYDIVKLLLSYK---CNIEV-CDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDRCQIESLDKHDMMPLHYASQNGHCGVLELLLSRVSNVNAVD--KRSQSPIHYAAQNGHVDAVSLLLKHNS-AIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEI 264          

HSP 3 Score: 53.9138 bits (128), Expect = 3.229e-7
Identity = 49/196 (25.00%), Postives = 87/196 (44.39%), Query Frame = 1
Query:  163 LHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRN-MQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRD 747
            +H+A+  G   IV  L+ +       D ++    A H A   G    +E L+ +  E IN  D      +H A  +G    +  L ++       D + R+  + TP+ YA ++G   ++ +L+ +    +V D D   P+H A   GHL +VK  + + C+     + A     ++ L LA  K   +IV+ + D
Sbjct:  339 IHFASFYGHDEIVKILLSERCNIELQDKDS--GRAIHYACCRGHLNIVEMLLAQSCE-INAGDKNYRRPIHHACQNGHCEIVKLLVSYK-----CDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCN-----IEACTKENWSPLDLASQKGFSQIVELLSD 521          
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.833e-18
Identity = 83/283 (29.33%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  133 IIMEDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDN-NAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEE---GCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +I E  + SLLH+A L+    IV+FL   + F  D++   A      H+A   G    +E L   K   I+  D +G T LH A   G  + +  L  +   +  L+    ++   P+          +V++L+ +G   +V + +G+TPL +AA EGH  L    L E      +I   L   DN+GF+ L  A      EI+K       D    +  +D +   H AA+ G    +  L+E  S  +N TDN   T +H A ++ ++ +VK LL KGA+I
Sbjct:   75 VIDEKNNFSLLHYACLENHKDIVSFL---LIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVR----RNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQ--NDGKTIFHSAAIIG-YSELFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANI 347          

HSP 2 Score: 63.1586 bits (152), Expect = 5.061e-10
Identity = 60/204 (29.41%), Postives = 91/204 (44.61%), Query Frame = 1
Query:  142 EDTDLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDACLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLDAQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKE 753
            +D+  S LH AA  G+  I   L+     P     N   + A HVA I G   C+  L+    E     D+   + ++LAA +GRY    +L +  +   + D   RN     LM+AA  G + IVE L+   V  ++ D    T LH AA  GHL +VK   ++G         + D  G T L +A    +  +V++  + E
Sbjct:  428 DDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQND--FLALHVATIKGHLDCVIILLEASKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRN----TLMFAAKSGCLPIVEDLLNDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAK------LSEDMFGSTQLDVAILNQQWHVVRFFLNNE 619          

HSP 3 Score: 55.8398 bits (133), Expect = 1.000e-7
Identity = 51/167 (30.54%), Postives = 79/167 (47.31%), Query Frame = 1
Query:  475 TPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAEGHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDKEKDPRTWELF--DDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTMLHKACISGHIDIVKWLLSKGASI 969
            +PL  AA  G   I ++L++ G    +   +    LH+A  +GHL  V   LE       +     D N  +A+ LA    + EI K++ D  KD  + + F  + L +    AA +G L  ++ LL    + +N  D    T LH+A   GH+DIVK L  +GA +
Sbjct:  433 SPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEAS----KETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMF----AAKSGCLPIVEDLLND-EVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKL 590          
The following BLAST results are available for this feature:
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD421.133e-4732.75ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:H... [more]
ANKRD422.291e-4732.75ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:H... [more]
ANKRD424.379e-4732.55ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:H... [more]
ANKRD422.483e-4436.90ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:H... [more]
ANKRD425.171e-2030.30ankyrin repeat domain 42 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-442.890e-1430.14AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.890e-1430.14AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.999e-1430.14AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.999e-1430.14AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
trp-43.267e-1430.70TRP (Transient receptor potential) channel family ... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG100114.409e-1829.69gene:FBgn0039590 transcript:FBtr0085319[more]
Ank29.808e-1831.56gene:FBgn0261788 transcript:FBtr0344222[more]
Ank21.104e-1731.56gene:FBgn0261788 transcript:FBtr0303122[more]
Ank21.291e-1731.56gene:FBgn0261788 transcript:FBtr0303123[more]
Ank21.399e-1731.56gene:FBgn0261788 transcript:FBtr0303113[more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripk46.041e-2131.34receptor-interacting serine-threonine kinase 4 [So... [more]
ripk46.998e-2131.34receptor-interacting serine-threonine kinase 4 [So... [more]
ripk47.860e-2131.34receptor-interacting serine-threonine kinase 4 [So... [more]
ank3b2.772e-1930.36ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3b2.850e-1930.36ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps27a9.148e-4835.08ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE... [more]
rps27a1.207e-4735.08ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE... [more]
rps27a2.968e-4734.71ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE... [more]
rps27a4.240e-4734.71ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE... [more]
rps27a1.362e-2834.82ribosomal protein S27a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd422.456e-5133.33ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MG... [more]
Ankrd425.373e-5133.33ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MG... [more]
Ankrd429.361e-5133.33ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MG... [more]
Ankrd421.104e-5033.33ankyrin repeat domain 42 [Source:MGI Symbol;Acc:MG... [more]
Ankrd442.456e-1930.61ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3V096|ANR42_MOUSE7.724e-5033.33Ankyrin repeat domain-containing protein 42 OS=Mus... [more]
sp|Q8N9B4|ANR42_HUMAN1.192e-4336.90Ankyrin repeat domain-containing protein 42 OS=Hom... [more]
sp|Q54KA7|SECG_DICDI5.485e-1929.61Ankyrin repeat, PH and SEC7 domain containing prot... [more]
sp|Q5F478|ANR44_CHICK1.081e-1831.47Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q5RF15|TNI3K_PONAB6.925e-1828.57Serine/threonine-protein kinase TNNI3K OS=Pongo ab... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6T6321.017e-5135.42ANK_REP_REGION domain-containing protein OS=Pocill... [more]
A0A5F8GMZ49.602e-5037.10Ankyrin repeat domain 42 OS=Monodelphis domestica ... [more]
F6VRI71.289e-4937.10Ankyrin repeat domain 42 OS=Monodelphis domestica ... [more]
A0A2B4RXB31.386e-4936.36Ankyrin repeat domain-containing protein 42 OS=Sty... [more]
A0A091IEY53.548e-4939.58Ankyrin repeat domain-containing protein 42 (Fragm... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b3.170e-2030.50ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ankrd442.816e-1831.34ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
ANKRD509.057e-1830.51ankyrin repeat domain 50 [Source:NCBI gene;Acc:103... [more]
psmd101.025e-1732.40proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ripk41.081e-1730.21receptor interacting serine/threonine kinase 4 [So... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007446.11.192e-1930.11pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000095.12.337e-1628.67pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.12.477e-1628.97pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007449.11.403e-1532.21pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000003991.11.541e-1530.39pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS61.197e-933.09Evolutionarily conserved 19S regulatory particle a... [more]
AKR12.024e-926.44Palmitoyl transferase involved in protein palmitoy... [more]
HOS41.070e-837.00Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR21.675e-626.73Ankyrin repeat-containing protein; member of a fam... [more]
AVO27.169e-623.41Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433819.107e-1432.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387251.975e-1327.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387025.488e-1333.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375201.338e-1224.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367204.213e-1230.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd101.374e-1931.15proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ankrd28b5.248e-1727.88ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ripk45.529e-1728.94receptor interacting serine/threonine kinase 4 [So... [more]
ankrd28b6.564e-1727.88ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd446.636e-1729.93ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Alpha-latrocrustotoxin-Lt1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036685.10.000e+0100.00SMESG000036685.1[more]
SMESG000005009.12.176e-4734.29SMESG000005009.1[more]
SMESG000026756.11.175e-1828.81SMESG000026756.1[more]
SMESG000026756.11.394e-1828.81SMESG000026756.1[more]
SMESG000078033.15.833e-1829.33SMESG000078033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033645 ID=SMED30033645|Name=Alpha-latrocrustotoxin-Lt1a|organism=Schmidtea mediterranea sexual|type=transcript|length=1965bp
TACTCAATGTTAAATGATGAATATTTGGAAGAATCCGAAAAGAGGCGTTT
ATTGTTTGCGTACATAACCGCCGATGATGATGCTAGATTCAAAAGAGCAG
TAAAAGATATAGATCCAGTAGAAATTAGAAAAATCATTATGGAAGATACC
GATTTGTCGTTGCTACATTGGGCAGCTCTCAAAGGCTCAGTGGTCATTGT
GAATTTTTTAATTGATAAAATGGAATTTCCGTCTGATCTTGATAATAATG
CTGAGATATGGACAGCAGCTCACGTAGCTGTTATAGGTGGAAAAGATGCT
TGTCTCGAATCTCTTATTATGAGAAAACCCGAAGTTATCAATCGACCTGA
TAGCAGAGGGTGCACATTATTACATTTGGCGGCTGCTCATGGAAGATATC
ATTGCATGCATTATTTAGCAAACTTTACAAGGCTGCTGCCAAATTTAGAT
GCACAGTGTAGAAATATGCAATGGACTCCTTTAATGTATGCCGCATGGCA
TGGCAGAATATCAATTGTGGAATTATTGATTCGTCATGGAGTAGCTACGG
ATGTTACTGATGTTGATGGGCGAACGCCTTTACATTTAGCTGCAGCTGAA
GGGCATTTACCATTAGTAAAGTATTTTCTAGAAGAGGGTTGTCATGATAT
TCATAAATGCTTAACGGCAGTTGACAATAATGGTTTCACCGCATTAAAAT
TGGCAGAAACCAAGAGCAAGGATGAAATAGTTAAATATATCAGAGATAAA
GAAAAAGATCCAAGAACTTGGGAATTGTTTGATGATCTTCAATATCCTGG
TCACATAGCTGCAGTAAATGGAGATTTGTTAAATATTCAAGGCCTGTTAG
AGAAAGGAAGCATTGCCGTCAATGATACCGATAATAGAGGTTATACAATG
TTACACAAAGCTTGTATAAGTGGTCATATCGATATTGTGAAATGGTTACT
TAGTAAAGGAGCTTCAATATGGATAAAAACTTTAGGACAAGAAACAGTTA
TTGATATTGTTAAAAGAAAAGGACATGGAAAATTATTAAAATTACTTGAA
GCAGAAGAAGCGAGATATGAACCATTTTTAAAAAAAGAGGATCCAGATAG
AAGAGTCTTTATTCCTTTGTTATCGTCTTTGGATAATCCTAATCTTGATT
CCTTAGATTACAAAAGGTTGAATGAATTGATTGAGGAGAGTAAATCTGAA
ATTTTGAATCTTGAAGAAATGATTAATAAAAAAGAAATGATTTTACAGCT
GGAACAAAGTGAAGTAGATGATGAAACTGATGACACTGATGATGATCTGA
TAAAACAAAAACACAGAAATATAAAGGCTTTAAAATATGAAATAATGAAA
TTAAATTATCAACTAAATGTCGTAAAATTTAATTTATATCAATTAACAAA
GGAACCAACTATCAAAGAACGAGAAATCGGAAGGGCTTTGGCTGATTGTG
AACATCAGTTTGAAGAAATTACAGATCGACTCTTTTATGAAAGAGAAGTC
CGAGAACAAACTGAAGCGGAGCTTTCCCGGATCCGACAGCAATTACTCAA
ATTAAGAGATTTTATTCTGAAAAACGATTGTCCAGATGACTTGGTGACGA
TGGTGATTGCCTTTGATAAGTACTTGATCGGAAAAGAAAATCTTACTGTC
ATTCGAAAGGCTCCAGAAAAAAAAGATAAAGTTTATTCTATTCAATTTGA
AATTAATGATTTGAGCAAAATAACCATTTCCAAAGTTTCCTATTACACTG
ATTCAAAATTAATTGTTAAGTCGAATATTGAAAATTTGTCATTTAAAAAA
TTTGTTGAGTATATTAAGTGCATGATCAAACAGGATATGAAGCGACATAA
AATCAAGAAAGGAAATAAAGGTAAGCAAATCAAAGGAAAGCATTTACATC
CCAAAGGTGGAATATTTGTAACTATCAAATGAATTGAAAATAAATATATG
ATTATTAAAAAAAAA
back to top

protein sequence of SMED30033645-orf-1

>SMED30033645-orf-1 ID=SMED30033645-orf-1|Name=SMED30033645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
YSMLNDEYLEESEKRRLLFAYITADDDARFKRAVKDIDPVEIRKIIMEDT
DLSLLHWAALKGSVVIVNFLIDKMEFPSDLDNNAEIWTAAHVAVIGGKDA
CLESLIMRKPEVINRPDSRGCTLLHLAAAHGRYHCMHYLANFTRLLPNLD
AQCRNMQWTPLMYAAWHGRISIVELLIRHGVATDVTDVDGRTPLHLAAAE
GHLPLVKYFLEEGCHDIHKCLTAVDNNGFTALKLAETKSKDEIVKYIRDK
EKDPRTWELFDDLQYPGHIAAVNGDLLNIQGLLEKGSIAVNDTDNRGYTM
LHKACISGHIDIVKWLLSKGASIWIKTLGQETVIDIVKRKGHGKLLKLLE
AEEARYEPFLKKEDPDRRVFIPLLSSLDNPNLDSLDYKRLNELIEESKSE
ILNLEEMINKKEMILQLEQSEVDDETDDTDDDLIKQKHRNIKALKYEIMK
LNYQLNVVKFNLYQLTKEPTIKEREIGRALADCEHQFEEITDRLFYEREV
REQTEAELSRIRQQLLKLRDFILKNDCPDDLVTMVIAFDKYLIGKENLTV
IRKAPEKKDKVYSIQFEINDLSKITISKVSYYTDSKLIVKSNIENLSFKK
FVEYIKCMIKQDMKRHKIKKGNKGKQIKGKHLHPKGGIFVTIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0016020membrane
GO:0016021integral component of membrane
GO:0044218other organism cell membrane
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:1900017positive regulation of cytokine production involved in inflammatory response
Vocabulary: molecular function
TermDefinition
GO:0090729toxin activity
GO:0005515protein binding
GO:0051059NF-kappaB binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 387..414
NoneNo IPR availablePANTHERPTHR24201FAMILY NOT NAMEDcoord: 50..354
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 190..205
score: 46.11
coord: 312..326
score: 38.89
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 85..115
e-value: 180.0
score: 10.5
coord: 189..219
e-value: 1.8E-6
score: 37.5
coord: 296..325
e-value: 6.2E-4
score: 29.1
coord: 156..187
e-value: 1.0E-4
score: 31.7
coord: 227..256
e-value: 310.0
score: 8.8
coord: 50..82
e-value: 5.4
score: 16.0
coord: 119..149
e-value: 0.15
score: 21.1
coord: 262..292
e-value: 560.0
score: 6.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 156..188
score: 10.366
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 296..328
score: 11.594
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 189..213
score: 12.422
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 261..362
e-value: 5.9E-18
score: 66.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 144..259
e-value: 4.0E-26
score: 93.7
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 5..143
e-value: 8.2E-16
score: 60.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 50..349
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 265..326
e-value: 4.9E-9
score: 36.7
coord: 91..184
e-value: 1.3E-13
score: 51.3
coord: 187..254
e-value: 1.4E-9
score: 38.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 50..349
score: 46.103