titin homolog

Overview
Nametitin homolog
Smed IDSMED30033644
Length (bp)4148
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of titin homolog (SMED30033644) t-SNE clustered cells

Violin plots show distribution of expression levels for titin homolog (SMED30033644) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of titin homolog (SMED30033644) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for titin homolog (SMED30033644) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033644

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30033644SMESG000002539.1 dd_Smed_v6_8111_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033644SMESG000002539.1 dd_Smed_v4_8111_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of titin homolog vs. Ensembl Human
Match: KIAA2012 (KIAA2012 [Source:HGNC Symbol;Acc:HGNC:51250])

HSP 1 Score: 55.4546 bits (132), Expect = 8.420e-7
Identity = 41/150 (27.33%), Postives = 73/150 (48.67%), Query Frame = 2
Query:  425 ISMQINTLKDLTNSILRYG---GKSDGIWLKFPSTRN-----GQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETE-MDIGDI 847
            + ++++TL+DL  +IL YG   G+ D  W  +   R+      Q+ ++PG SA+RY+  L+R    + + +L   G I +  + Q S +    + R   DLS  P  Y +L        P+  F   W ++    +SF+Q  + +D G+ 
Sbjct:  102 LDLELHTLQDLKEAILAYGRQQGEQDRAWQPYLHFRSQLESQAQRQIQPGHSAKRYLRGLLRTWPPDAMYRLWCAGYIKDSVLLQDSQLNVPKKLRPQQDLSGVPPKYHLL--------PV--FPSFWIQQ---GKSFEQRQQGLDEGEA 238          

HSP 2 Score: 53.9138 bits (128), Expect = 2.893e-6
Identity = 55/151 (36.42%), Postives = 96/151 (63.58%), Query Frame = 2
Query: 3626 RLKQI-EKERKDKEEFNRRLEEMKTQQAIXXXXXXXXXXXXAFEESERIRIENEMISRMRDSERIQYLXXXXXXXXXXXXXXXXXXXXXXXNARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKI 4075
            RLK   E+ R+ +EEF R+L E++ ++  EE +R   +++   E   ++  E + +  M + ER++Y ++K E EE+ RL  EE ++ +EE AR+ALEEA + AQ+QA++ A LE   +F + +  E  GL+   N++  +++SYF+FL+I
Sbjct: 1028 RLKAAQERARQQQEEFRRKLRELQRKKQQEEAERAEAEKQRQEELEMQLEEEQKHLMEMAEEERLEYQRRKQEAEEKARLEAEERRQKEEEAARLALEEATKQAQEQARQKAALEKHFHFYQELHKEASGLQWTQNISRPWVYSYFQFLQI 1178          
BLAST of titin homolog vs. Ensembl Mouse
Match: Gm973 (predicted gene 973 [Source:MGI Symbol;Acc:MGI:2685819])

HSP 1 Score: 51.2174 bits (121), Expect = 5.659e-6
Identity = 40/150 (26.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  431 MQINTLKDLTNSILRYGG---KSDGIWLKFPSTRNG-----QKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQ---ETEMDIGDI 847
            + ++TL+DL  +IL YG    K D  W  +   R+      Q+ ++PG+SA+RY+   +R    +++ +L   G I +  + Q S +      R   DLS  P  Y +L  +          SF   ++ + A+  D+   +T MD G +
Sbjct:   98 LGLHTLRDLKEAILAYGRRKRKQDSAWRPYLYFRSKPESQTQRQIQPGYSAKRYLRGFLRTWPPDIMHRLQCAGHIKDSVLLQDSQLGIPKNLRPQQDLSGVPPKYHLLPVIP---------SFRIQQRSSYAQGLDEWEIDTYMDQGSV 238          
BLAST of titin homolog vs. Ensembl Mouse
Match: Gm973 (predicted gene 973 [Source:MGI Symbol;Acc:MGI:2685819])

HSP 1 Score: 51.9878 bits (123), Expect = 6.386e-6
Identity = 40/149 (26.85%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  437 INTLKDLTNSILRYGG---KSDGIWLKF------PSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQ---ETEMDIGDI 847
            ++TL+DL  +IL YG    K D  W  +      P ++  Q+ ++PG+SA+RY+   +R    +++ +L   G I +  + Q S +      R   DLS  P  Y +L  +          SF   ++ + A+  D+   +T MD G +
Sbjct:  101 LHTLRDLKEAILAYGRRKRKQDSAWRPYLYFRSKPESQT-QRQIQPGYSAKRYLRGFLRTWPPDIMHRLQCAGHIKDSVLLQDSQLGIPKNLRPQQDLSGVPPKYHLLPVIP---------SFRIQQRSSYAQGLDEWEIDTYMDQGSV 239          
BLAST of titin homolog vs. UniProt/SwissProt
Match: sp|Q0VF49|K2012_HUMAN (Uncharacterized protein KIAA2012 OS=Homo sapiens OX=9606 GN=KIAA2012 PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 4.399e-6
Identity = 41/150 (27.33%), Postives = 73/150 (48.67%), Query Frame = 2
Query:  425 ISMQINTLKDLTNSILRYG---GKSDGIWLKFPSTRN-----GQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETE-MDIGDI 847
            + ++++TL+DL  +IL YG   G+ D  W  +   R+      Q+ ++PG SA+RY+  L+R    + + +L   G I +  + Q S +    + R   DLS  P  Y +L        P+  F   W ++    +SF+Q  + +D G+ 
Sbjct:  102 LDLELHTLQDLKEAILAYGRQQGEQDRAWQPYLHFRSQLESQAQRQIQPGHSAKRYLRGLLRTWPPDAMYRLWCAGYIKDSVLLQDSQLNVPKKLRPQQDLSGVPPKYHLL--------PV--FPSFWIQQ---GKSFEQRQQGLDEGEA 238          
BLAST of titin homolog vs. TrEMBL
Match: A0A267F672 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000850g3 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.281e-35
Identity = 92/252 (36.51%), Postives = 152/252 (60.32%), Query Frame = 2
Query:  443 TLKDLTNSILRYGGKS-DGIWL---KFPSTRNGQ-KLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEE--IIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKG 1177
            T+ +L +++L +G K  + + L   +  ST + + K+VRPGFSARRY+A+  + L+++ V   ++ GK+ EKTIFQ++  LPH+++R + +LS YP PYRI+KQML++PGPLNE+SFIW+KK+ S      +  +  GDI++ +    E+  E+   ++Y+ +  + +K +LS LL+KSA+N+ L   +E    E    T D ++ +           FDM  AV  LL+++T      N+L   G +G  G
Sbjct:   59 TVDELASTVLNFGSKGNESVCLDIQQMTSTSSQEPKVVRPGFSARRYLASWTKTLDEDTVNTWLSLGKLSEKTIFQTNAFLPHLKKRANDNLSEYPAPYRIVKQMLIAPGPLNEYSFIWSKKEVS------DDGLSRGDIQVFS----EDKAEL---VKYSELDKETQKGILSKLLVKSALNYGLSRAQEAKASESGEGTADASSGEG---------PFDMVHAVRSLLDRDT------NALREEGDSGAGG 282          
BLAST of titin homolog vs. TrEMBL
Match: A0A1I8HDT8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.976e-34
Identity = 91/252 (36.11%), Postives = 151/252 (59.92%), Query Frame = 2
Query:  443 TLKDLTNSILRYGGKS-DGIWL---KFPSTRNGQ-KLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEE--IIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKG 1177
            T+ +L +++L +G K  + + L   +  ST + + K+VRPGFSARRY+A+  + L+++ V   ++ GK+ EKTIFQ++  LPH+++R + +LS YP PYRI+KQML++PGPLNE+SFIW+KK+ S      +  +  GDI++ +    E+  E+   ++Y+ +  + +K +LS LL+KSA+N+ L   +E    E      D ++ +           FDM  AV  LL+++T      N+L   G +G  G
Sbjct:   59 TVDELASTVLNFGSKGNESVCLDIQQMTSTSSQEPKVVRPGFSARRYLASWTKTLDEDTVNTWLSLGKLSEKTIFQTNAFLPHLKKRANDNLSEYPAPYRIVKQMLIAPGPLNEYSFIWSKKEVS------DDGLSRGDIQVFS----EDKAEL---VKYSELDKETQKGILSKLLVKSALNYGLSRAQEAKASESGEGPADASSGEG---------PFDMVHAVRSLLDRDT------NALREEGDSGAGG 282          
BLAST of titin homolog vs. TrEMBL
Match: A0A1I8J496 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.180e-33
Identity = 96/286 (33.57%), Postives = 163/286 (56.99%), Query Frame = 2
Query:  377 NNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGK-SDGIWL---KFPSTRNGQ-KLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEE--IIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQ 1213
            ++VD  DQ+        +    T+ +L +++L +G K ++ + L   +  ST + + K+VRPGFSARRY+A+  + L+++ V   ++ GK+ EKTIFQ++  LPH+++R + +LS YP PYRI+KQML++PGPLNE+SFIW+KK+ S     +      GDI++ +    E+  E+   ++Y+ +  + +K +LS LL+KSA+N+ L   +E    E      D ++ +           FDM  AV  LL+++T      N+L   G +G  G   +   P + +
Sbjct: 4435 SSVDSADQSEG------TFSAITVDELASTVLNFGSKGNESVCLDIQQMTSTSSQEPKVVRPGFSARRYLASWTKTLDEDTVNTWLSLGKLSEKTIFQTNAFLPHLKKRANDNLSEYPAPYRIVKQMLIAPGPLNEYSFIWSKKEVSDDGLSR------GDIQVFS----EDKAEL---VKYSELDKETQKGILSKLLVKSALNYGLSRAQEAKASESGEGPADASSGEG---------PFDMVHAVRSLLDRDT------NALREEGDSGAGGVTREEFSPEDER 4686          
BLAST of titin homolog vs. TrEMBL
Match: A0A1I8IBU0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.527e-32
Identity = 94/286 (32.87%), Postives = 158/286 (55.24%), Query Frame = 2
Query:  377 NNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSD-----GIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEE--IIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQ 1213
            ++VD  DQ+        +    T+ +L +++L +G K +      I     ++    K+VRPGFSARRY+A+  + L+++ V   ++ GK+ EKTIFQ++  LPH+++R + +LS YP PYRI+KQML++PGPLNE+SFIW+KK+ S     +      GDI++ +    E+  E+   ++Y+ +  + +K +LS LL+KSA+N+ L   +E    E      D ++ +           FDM  AV  LL+++T      N+L   G +G  G   +   P + +
Sbjct: 1953 SSVDSADQSEG------TFSAITVDELASTVLNFGSKGNESVCLDIQQMTSTSSQEPKVVRPGFSARRYLASWTKTLDEDTVNTWLSLGKLSEKTIFQTNAFLPHLKKRANDNLSEYPAPYRIVKQMLIAPGPLNEYSFIWSKKEVSDDGLSR------GDIQVFS----EDKAEL---VKYSELDKETQKGILSKLLVKSALNYGLSRAQEAKASESGEGPADASSGEG---------PFDMVHAVRSLLDRDT------NALREEGDSGAGGVTREEFSPEDER 2204          
BLAST of titin homolog vs. TrEMBL
Match: A0A1I8I2A1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.808e-32
Identity = 94/286 (32.87%), Postives = 158/286 (55.24%), Query Frame = 2
Query:  377 NNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSD-----GIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEE--IIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQ 1213
            ++VD  DQ+        +    T+ +L +++L +G K +      I     ++    K+VRPGFSARRY+A+  + L+++ V   ++ GK+ EKTIFQ++  LPH+++R + +LS YP PYRI+KQML++PGPLNE+SFIW+KK+ S     +      GDI++ +    E+  E+   ++Y+ +  + +K +LS LL+KSA+N+ L   +E    E      D ++ +           FDM  AV  LL+++T      N+L   G +G  G   +   P + +
Sbjct: 2200 SSVDSADQSEG------TFSAITVDELASTVLNFGSKGNESVCLDIQQMTSTSSQEPKVVRPGFSARRYLASWTKTLDEDTVNTWLSLGKLSEKTIFQTNAFLPHLKKRANDNLSEYPAPYRIVKQMLIAPGPLNEYSFIWSKKEVSDDGLSR------GDIQVFS----EDKAEL---VKYSELDKETQKGILSKLLVKSALNYGLSRAQEAKASESGEGPADASSGEG---------PFDMVHAVRSLLDRDT------NALREEGDSGAGGVTREEFSPEDER 2451          
BLAST of titin homolog vs. Planmine SMEST
Match: SMESG000002539.1 (SMESG000002539.1)

HSP 1 Score: 2260.34 bits (5856), Expect = 0.000e+0
Identity = 1352/1362 (99.27%), Postives = 1353/1362 (99.34%), Query Frame = 2
Query:   50 MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSRINMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTVLPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVANNTNFPMISIDEAISKDNNNSMSKVNLLPNLTLRLNSINVQKSTNFLKKKAALEAHSEGQXXXXXXHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNKPIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSKNTYSEXXXXXXXXXXXXXXXXXXXXXXNAKLVRKISKGKHFDSEMKLGDXXXXXXXXXXXXXRLIQLLSEHAENVAERVLSKSGGEDFASDVNEAVTQWNEILKERYFELFSYIAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEEYTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMAFLQNGSNLALDAIEVYKDPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESELKMXXXXXXXXXXXXXXXXWDGRSFSKDINSNSGVIIEESINAEETSSKSANHQKVPEIGGELSNLQNVHSALYNQTHSSYETQTNLSEIKQNNVGDNNLTASSLDKPINKSFLKFKSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGRVDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNXXXXXXXXXXXXXXXXXXXXXSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDIHLQHDSTIDTSKSSQGVLSEFSENNQIDQMNYEGVSXXXXXXXXXXXXXXXXXREKRLLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMAKKLXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXYLRLKQIEKERKDKEEFNRRLEEMKTQQAIXXXXXXXXXXXXAFEESERIRIENEMISRMRDSERIQYLXXXXXXXXXXXXXXXXXXXXXXXNARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPSTDKIEADSKLTN 4135
            MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSRINMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTVLPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVANNTNFPMISIDEAISKDNNNSM KVNLLPNLTLRLNSINVQKSTNFLKKKA LEAHSEGQSSSSTSHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNKPIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSKNTYSEFGKGFDSSSLSSSGNFANNSLLNAKLVRKISKGKHFDSEMKLGDNQSNEFSQQNNQNRLIQLLSEHAENVAERVLSKSGGEDFASDVNEAVTQWNEILKERYFELFSYIAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEEYTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMA LQNGSNLALDAIEVYKDPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESELKMIKPVISSISPIIIDSVWDGRSFSKDINSNS VIIEESINAEETSSKSANHQKV EIGGELSNLQNVHSALYNQT SSYETQTNLSEIKQNNVGDNNLTASSLDKPINKSFLK KSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGRVDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNKKRKQDIQKPKKKASKSLAKDSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDIHLQHDSTI TSKSSQGVLSEFSENNQIDQMNYEGVSDEENDYDNDGDDGDEENREKRLLMRQQREAKRKAAAEKRRLEVERKRREKEDQRKLENKRKELEEIMAK+LEEQRRQMEEEFRLKQEREKAEELEKLDALKLQEYLRLKQIEKERKDKEEFNRRLEEMKTQQAIEEQKRRLEQER AFEESERIRIENEMISRMRDSERIQYLKKKAEEEERKRLREEEEKRVKEENARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPSTDKIEADSKLTN
Sbjct:    1 MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSRINMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTVLPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVANNTNFPMISIDEAISKDNNNSMPKVNLLPNLTLRLNSINVQKSTNFLKKKATLEAHSEGQSSSSTSHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNKPIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSKNTYSEFGKGFDSSSLSSSGNFANNSLLNAKLVRKISKGKHFDSEMKLGDNQSNEFSQQNNQNRLIQLLSEHAENVAERVLSKSGGEDFASDVNEAVTQWNEILKERYFELFSYIAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEEYTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMALLQNGSNLALDAIEVYKDPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESELKMIKPVISSISPIIIDSVWDGRSFSKDINSNSAVIIEESINAEETSSKSANHQKVTEIGGELSNLQNVHSALYNQTPSSYETQTNLSEIKQNNVGDNNLTASSLDKPINKSFLKSKSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGRVDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNKKRKQDIQKPKKKASKSLAKDSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDIHLQHDSTIHTSKSSQGVLSEFSENNQIDQMNYEGVSDEENDYDNDGDDGDEENREKRLLMRQQREAKRKAAAEKRRLEVERKRREKEDQRKLENKRKELEEIMAKRLEEQRRQMEEEFRLKQEREKAEELEKLDALKLQEYLRLKQIEKERKDKEEFNRRLEEMKTQQAIEEQKRRLEQERFAFEESERIRIENEMISRMRDSERIQYLKKKAEEEERKRLREEEEKRVKEENARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPSTDKIEADSKLTN 1362          
BLAST of titin homolog vs. Planmine SMEST
Match: SMESG000002539.1 (SMESG000002539.1)

HSP 1 Score: 2206.79 bits (5717), Expect = 0.000e+0
Identity = 1332/1362 (97.80%), Postives = 1333/1362 (97.87%), Query Frame = 2
Query:   50 MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSRINMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTVLPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVANNTNFPMISIDEAISKDNNNSMSKVNLLPNLTLRLNSINVQKSTNFLKKKAALEAHSEGQXXXXXXHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNKPIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSKNTYSEXXXXXXXXXXXXXXXXXXXXXXNAKLVRKISKGKHFDSEMKLGDXXXXXXXXXXXXXRLIQLLSEHAENVAERVLSKSGGEDFASDVNEAVTQWNEILKERYFELFSYIAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEEYTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMAFLQNGSNLALDAIEVYKDPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESELKMXXXXXXXXXXXXXXXXWDGRSFSKDINSNSGVIIEESINAEETSSKSANHQKVPEIGGELSNLQNVHSALYNQTHSSYETQTNLSEIKQNNVGDNNLTASSLDKPINKSFLKFKSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGRVDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNXXXXXXXXXXXXXXXXXXXXXSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDIHLQHDSTIDTSKSSQGVLSEFSENNQIDQMNYEGVSXXXXXXXXXXXXXXXXXREKRLLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMAKKLXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXYLRLKQIEKERKDKEEFNRRLEEMKTQQAIXXXXXXXXXXXXAFEESERIRIENEMISRMRDSERIQYLXXXXXXXXXXXXXXXXXXXXXXXNARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPSTDKIEADSKLTN 4135
            MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSRINMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTVLPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVANNTNFPMISIDEAISKDNNNSM KVNLLPNLTLRLNSINVQKSTNFLKKKA LEAHSEGQSSSSTSHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNKPIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSKNTYSEFGKGFDSSSLSSSGNFANNSLLNAKLVRKISKGKHFDSEMKLGDNQSNEFSQQNNQNRLIQLLSEHAENVAERVLSKSGGEDFASDVN                    IAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEEYTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMA LQNGSNLALDAIEVYKDPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESELKMIKPVISSISPIIIDSVWDGRSFSKDINSNS VIIEESINAEETSSKSANHQKV EIGGELSNLQNVHSALYNQT SSYETQTNLSEIKQNNVGDNNLTASSLDKPINKSFLK KSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGRVDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNKKRKQDIQKPKKKASKSLAKDSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDIHLQHDSTI TSKSSQGVLSEFSENNQIDQMNYEGVSDEENDYDNDGDDGDEENREKRLLMRQQREAKRKAAAEKRRLEVERKRREKEDQRKLENKRKELEEIMAK+LEEQRRQMEEEFRLKQEREKAEELEKLDALKLQEYLRLKQIEKERKDKEEFNRRLEEMKTQQAIEEQKRRLEQER AFEESERIRIENEMISRMRDSERIQYLKKKAEEEERKRLREEEEKRVKEENARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPSTDKIEADSKLTN
Sbjct:    1 MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSRINMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTVLPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGIWLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTIFQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKNSARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSNLLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVTDLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVANNTNFPMISIDEAISKDNNNSMPKVNLLPNLTLRLNSINVQKSTNFLKKKATLEAHSEGQSSSSTSHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNKPIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSKNTYSEFGKGFDSSSLSSSGNFANNSLLNAKLVRKISKGKHFDSEMKLGDNQSNEFSQQNNQNRLIQLLSEHAENVAERVLSKSGGEDFASDVN--------------------IAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEEYTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMALLQNGSNLALDAIEVYKDPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESELKMIKPVISSISPIIIDSVWDGRSFSKDINSNSAVIIEESINAEETSSKSANHQKVTEIGGELSNLQNVHSALYNQTPSSYETQTNLSEIKQNNVGDNNLTASSLDKPINKSFLKSKSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGRVDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNKKRKQDIQKPKKKASKSLAKDSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDIHLQHDSTIHTSKSSQGVLSEFSENNQIDQMNYEGVSDEENDYDNDGDDGDEENREKRLLMRQQREAKRKAAAEKRRLEVERKRREKEDQRKLENKRKELEEIMAKRLEEQRRQMEEEFRLKQEREKAEELEKLDALKLQEYLRLKQIEKERKDKEEFNRRLEEMKTQQAIEEQKRRLEQERFAFEESERIRIENEMISRMRDSERIQYLKKKAEEEERKRLREEEEKRVKEENARMALEEAQRIAQQQAKELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPSTDKIEADSKLTN 1342          
The following BLAST results are available for this feature:
BLAST of titin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
KIAA20128.420e-727.33KIAA2012 [Source:HGNC Symbol;Acc:HGNC:51250][more]
back to top
BLAST of titin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gm9735.659e-626.67predicted gene 973 [Source:MGI Symbol;Acc:MGI:2685... [more]
Gm9736.386e-626.85predicted gene 973 [Source:MGI Symbol;Acc:MGI:2685... [more]
back to top
BLAST of titin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q0VF49|K2012_HUMAN4.399e-627.33Uncharacterized protein KIAA2012 OS=Homo sapiens O... [more]
back to top
BLAST of titin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F6724.281e-3536.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HDT86.976e-3436.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J4962.180e-3333.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IBU01.527e-3232.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I2A11.808e-3232.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of titin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of titin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002539.10.000e+099.27SMESG000002539.1[more]
SMESG000002539.10.000e+097.80SMESG000002539.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033644 ID=SMED30033644|Name=titin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=4148bp
ATAAATCGGATTTTAGAAAATAAAGCTGTCATTTCTCTGGTAACGACAGA
TGAATTTAAATGGAAATGTTCTAAATGAAATAAATGATTCAGTTTCAATA
GATAATAGCCAAGTAGATGATAATACTATTTCTGATTGTAGAAATAGTTT
GGAGATTTCAACTAAAATTTCAGATGATTTGGAGAATTTCTCATCTCGCA
TCAACATGCTGAATGATCAATACAGCAACAAGGGGATGACAAAGAATTCA
TTTCTATTGTTGGCTAAACATTATCCAAACTATCAACACTATACTCATAG
ATTGGCACTGCTCAATCGATATCAGAAAATATCAGAATCACATACGGTGT
TGCCAGAAATTAAAGGTCACACTCTTAATAATGTCGACCGGCAAGATCAA
ACTTCTAAGCAAATTCATGACAATATATCAATGCAGATCAACACCTTAAA
AGATCTGACGAATTCAATATTGCGATATGGAGGAAAATCGGACGGGATTT
GGTTGAAATTTCCTAGCACGAGGAACGGCCAAAAGTTAGTGCGCCCTGGA
TTTAGTGCACGTAGATATATGGCCAACTTGGTGCGTCATTTAAACGATAA
TCTCGTGGAGAAATTGATTGCTGATGGAAAAATTCTTGAAAAAACTATTT
TTCAAAGTAGTCTTATCTTACCTCATATTCGAAGGCGATTAAGCGCAGAT
CTCAGCCGCTATCCTGAACCATATCGAATTCTAAAGCAAATGCTGATGTC
TCCAGGACCTTTGAATGAGTTTTCATTTATTTGGACAAAAAAAAAGAATT
CGGCCAGGTCATTCGATCAAGAAACAGAAATGGATATAGGCGATATTAAA
ATTCTTACGAAAAAGACGCTGGAGAACAATAAAGAAGTATTCGAAGAAAT
TCAATACACTAATATGAGTCATGACAAGAAAAAAACTGTGCTTTCAAATC
TGCTTTTAAAATCGGCAATGAATCACGCCTTGAAAATAAAGGAGGAAATT
ATTGAACATAATTCACAGACCACGGACAAAACAACAAAAGATAATGTCCA
TAACATCCATATCCCAATTATTAATTTTGATATGCGAGAAGCTGTAACTG
ATCTTTTAAACAAAGAAACGTTTCAAATGCTATCCAGTAATTCTCTTTCA
ACATCCGGACAAACCGGATTCAAGGGCCAAGCGTTAAAGCCTGGAGGACC
CAGAGAAAACCAAAATTTGGACTTTCAAGAAAATTTAACAGTAGCAAATA
ATACAAATTTTCCGATGATTTCTATTGACGAAGCCATCAGCAAGGACAAT
AACAATTCTATGTCAAAAGTCAATCTTTTACCAAATCTGACTTTGCGCCT
TAACTCTATAAACGTCCAAAAATCAACGAACTTTTTGAAAAAGAAAGCAG
CACTTGAAGCTCATAGTGAAGGTCAGAGTTCATCATCAACGAGCCACAAC
GCCGTTATTTCTTTTGATCCATCAAATTTTGGGCTGCCAGATTTTCAAGC
TCAACAAGACGCTCAGTCAATGGCATTTCTTGAGAGGTTGAAAAATAAAC
CTATTAAATCTGGAGCTCTTCGTGATAAAATTCATCCCTATGGAAAGTAT
AGAGGCACGGAGGACATATTACTTGATTCCAGCTCGATCCAGATCGGAGA
TATTGATCCAACTTCATCTTTCAACAACTGGAAGTACGACGACTCAAAAA
ACACTTACAGTGAGTTTGGGAAAGGTTTTGATTCATCTTCGTTGTCGTCT
AGTGGAAATTTTGCTAATAATTCATTGTTAAATGCGAAATTGGTGAGGAA
GATTAGCAAAGGCAAGCATTTTGATTCGGAGATGAAACTTGGTGACAATC
AAAGTAACGAATTCAGTCAACAGAATAATCAGAACAGGTTGATTCAATTG
CTAAGTGAGCATGCTGAAAACGTCGCTGAAAGAGTTTTGAGCAAATCAGG
AGGAGAAGATTTTGCGTCTGATGTTAATGAAGCCGTGACGCAATGGAACG
AAATATTAAAAGAGAGATATTTTGAACTTTTTAGTTACATTGCAATTCTG
GAAATTTTAAAACAAAAGAATTCCTTAGTCAATCATGCCAACCAAACGAA
TGGACAAATCTGGAATCTTGATGTGCAAGACCTTAAAAATGAAGAAGAAT
ACACTGGAATGATAAAGAATATATTCAAATCTCTTTTTAAAGAAAAGCTT
GACGATATCCCTAATGATGATGTGGAAATTTCTCCCAGCGTTATGGCATT
TTTACAAAATGGCTCAAATTTGGCTCTTGATGCCATCGAAGTCTACAAGG
ATCCCATTACTGGAAAACCGATAGTCAGATTAAAACAAACATTATCAATG
CAGCCGGAAAATTCTTCAAAAAATAGCTTGAATTTTATTTCAAGAGCATC
GAATCATTCTCAGTTGACTAATATAAATCGTTCTGATACCGAATCTGAAT
TGAAAATGATAAAACCAGTGATTTCATCTATCTCTCCAATAATCATAGAT
TCCGTTTGGGATGGAAGGTCCTTCTCAAAAGATATCAACTCTAATTCGGG
AGTGATAATAGAAGAAAGTATAAACGCAGAAGAAACATCATCAAAAAGTG
CCAACCATCAAAAGGTACCTGAAATCGGAGGTGAACTCAGTAATTTACAA
AATGTTCACTCTGCATTATACAATCAGACCCATTCATCATATGAAACTCA
AACTAATCTATCAGAAATTAAACAAAATAATGTTGGTGATAATAACCTTA
CAGCCTCATCGCTGGATAAACCAATTAACAAGTCCTTCCTAAAGTTCAAA
TCGTCAACAGGAAATAATGGCATTTTATCTTCATCTCCTCAAACTGAAAT
TCAAAAGTCATTTTCAAAACAATTAAAACAGGAATTTGTTGTTGGTCGCG
TTGATGAGACCAAAGATATAATTTCCCTTTATTCTCAGACCCCTAGCAAG
ACAGTAAAACCCAAACTACACATGTTATCTCCTCAAAACAAATTGGCTAA
GAGTTCTGGAAAAAATCTATCAAACAAGAAACGGAAACAAGATATACAGA
AACCAAAAAAGAAAGCAAGTAAATCATTGGCAAAGGATTCTGAGGAACTT
CCTTTAACAATAAAGTCAGAGGTAATTAATACTTTGGATATTCTCGAGAC
GGTTAACAATTTAATAACTCCTATTGAAAAAGAACACAGCGAAGACATCC
ACTTACAACACGATTCTACTATCGACACGTCGAAGTCATCCCAAGGCGTT
CTGTCGGAATTCAGTGAAAATAACCAAATAGACCAAATGAATTATGAAGG
CGTTTCTGATGAGGAAAATGATTATGATAATGATGGAGACGATGGAGATG
AGGAAAACAGAGAAAAAAGATTATTGATGCGTCAGCAAAGAGAAGCAAAG
AGAAAGGCGGCTGCTGAAAAACGTCGCTTAGAAGTAGAACGCAAAAGAAG
AGAAAAGGAAGATCAACGAAAATTGGAAAATAAACGAAAAGAGCTAGAAG
AAATTATGGCAAAAAAGTTAGAAGAGCAAAGACGTCAAATGGAAGAAGAG
TTTAGATTAAAACAAGAAAGAGAAAAGGCAGAGGAACTTGAAAAACTCGA
CGCTTTAAAACTACAAGAGTATTTAAGACTTAAACAGATAGAAAAAGAAA
GAAAAGATAAGGAAGAGTTTAACAGACGTCTAGAAGAAATGAAAACTCAA
CAAGCCATAGAAGAGCAAAAGCGAAGACTTGAACAAGAGAGACTTGCTTT
TGAAGAATCTGAAAGAATACGAATTGAAAATGAAATGATATCAAGAATGC
GCGATAGTGAACGCATTCAATACCTCAAGAAAAAGGCAGAAGAGGAAGAA
CGCAAACGACTTAGAGAAGAAGAAGAAAAACGAGTAAAAGAGGAAAATGC
TCGAATGGCCTTGGAAGAAGCACAAAGAATAGCTCAACAACAAGCTAAAG
AACTAGCAATTTTGGAAGCTCGTTTGAATTTTACGAGAGGTGTAAAAATT
GAAAATGAAGGATTAAAGAAATTTTTAAATGTCACTCCGAATTTTATATG
GTCATATTTTGAATTTTTAAAGATTCTTGGTTTACAACCGAATCCTTCTA
CTGATAAAATTGAGGCAGATAGCAAATTAACTAACTAAAGCCAGATTC
back to top

protein sequence of SMED30033644-orf-1

>SMED30033644-orf-1 ID=SMED30033644-orf-1|Name=SMED30033644-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1363bp
MNLNGNVLNEINDSVSIDNSQVDDNTISDCRNSLEISTKISDDLENFSSR
INMLNDQYSNKGMTKNSFLLLAKHYPNYQHYTHRLALLNRYQKISESHTV
LPEIKGHTLNNVDRQDQTSKQIHDNISMQINTLKDLTNSILRYGGKSDGI
WLKFPSTRNGQKLVRPGFSARRYMANLVRHLNDNLVEKLIADGKILEKTI
FQSSLILPHIRRRLSADLSRYPEPYRILKQMLMSPGPLNEFSFIWTKKKN
SARSFDQETEMDIGDIKILTKKTLENNKEVFEEIQYTNMSHDKKKTVLSN
LLLKSAMNHALKIKEEIIEHNSQTTDKTTKDNVHNIHIPIINFDMREAVT
DLLNKETFQMLSSNSLSTSGQTGFKGQALKPGGPRENQNLDFQENLTVAN
NTNFPMISIDEAISKDNNNSMSKVNLLPNLTLRLNSINVQKSTNFLKKKA
ALEAHSEGQSSSSTSHNAVISFDPSNFGLPDFQAQQDAQSMAFLERLKNK
PIKSGALRDKIHPYGKYRGTEDILLDSSSIQIGDIDPTSSFNNWKYDDSK
NTYSEFGKGFDSSSLSSSGNFANNSLLNAKLVRKISKGKHFDSEMKLGDN
QSNEFSQQNNQNRLIQLLSEHAENVAERVLSKSGGEDFASDVNEAVTQWN
EILKERYFELFSYIAILEILKQKNSLVNHANQTNGQIWNLDVQDLKNEEE
YTGMIKNIFKSLFKEKLDDIPNDDVEISPSVMAFLQNGSNLALDAIEVYK
DPITGKPIVRLKQTLSMQPENSSKNSLNFISRASNHSQLTNINRSDTESE
LKMIKPVISSISPIIIDSVWDGRSFSKDINSNSGVIIEESINAEETSSKS
ANHQKVPEIGGELSNLQNVHSALYNQTHSSYETQTNLSEIKQNNVGDNNL
TASSLDKPINKSFLKFKSSTGNNGILSSSPQTEIQKSFSKQLKQEFVVGR
VDETKDIISLYSQTPSKTVKPKLHMLSPQNKLAKSSGKNLSNKKRKQDIQ
KPKKKASKSLAKDSEELPLTIKSEVINTLDILETVNNLITPIEKEHSEDI
HLQHDSTIDTSKSSQGVLSEFSENNQIDQMNYEGVSDEENDYDNDGDDGD
EENREKRLLMRQQREAKRKAAAEKRRLEVERKRREKEDQRKLENKRKELE
EIMAKKLEEQRRQMEEEFRLKQEREKAEELEKLDALKLQEYLRLKQIEKE
RKDKEEFNRRLEEMKTQQAIEEQKRRLEQERLAFEESERIRIENEMISRM
RDSERIQYLKKKAEEEERKRLREEEEKRVKEENARMALEEAQRIAQQQAK
ELAILEARLNFTRGVKIENEGLKKFLNVTPNFIWSYFEFLKILGLQPNPS
TDKIEADSKLTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR031440DUF4670
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1256..1308
NoneNo IPR availableCOILSCoilCoilcoord: 1110..1189
NoneNo IPR availableCOILSCoilCoilcoord: 1194..1237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 969..1013
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1084..1099
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1100..1142
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1082..1142
IPR031440Protein of unknown function DUF4670PFAMPF15709DUF4670coord: 1022..1301
e-value: 3.7E-20
score: 72.7
IPR031440Protein of unknown function DUF4670PANTHERPTHR21937UNCHARACTERIZEDcoord: 119..369
coord: 525..1338