General transcription factor IIH subunit 4

Overview
NameGeneral transcription factor IIH subunit 4
Smed IDSMED30033635
Length (bp)1982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of General transcription factor IIH subunit 4 (SMED30033635) t-SNE clustered cells

Violin plots show distribution of expression levels for General transcription factor IIH subunit 4 (SMED30033635) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of General transcription factor IIH subunit 4 (SMED30033635) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for General transcription factor IIH subunit 4 (SMED30033635) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033635

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033635h1SMcG0022241 SmedASXL_008862SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Human
Match: GTF2H4 (general transcription factor IIH subunit 4 [Source:HGNC Symbol;Acc:HGNC:4658])

HSP 1 Score: 224.942 bits (572), Expect = 9.210e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Human
Match: GTF2H4 (general transcription factor IIH subunit 4 [Source:HGNC Symbol;Acc:HGNC:4658])

HSP 1 Score: 224.942 bits (572), Expect = 9.210e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Human
Match: GTF2H4 (general transcription factor IIH subunit 4 [Source:HGNC Symbol;Acc:HGNC:4658])

HSP 1 Score: 224.942 bits (572), Expect = 9.210e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Human
Match: GTF2H4 (general transcription factor IIH subunit 4 [Source:HGNC Symbol;Acc:HGNC:4658])

HSP 1 Score: 224.942 bits (572), Expect = 9.210e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Human
Match: GTF2H4 (general transcription factor IIH subunit 4 [Source:HGNC Symbol;Acc:HGNC:4658])

HSP 1 Score: 224.942 bits (572), Expect = 9.210e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Celegans
Match: Y73F8A.24 (General transcription factor IIH subunit 4 [Source:UniProtKB/TrEMBL;Acc:D3NQB3])

HSP 1 Score: 162.54 bits (410), Expect = 3.693e-43
Identity = 130/471 (27.60%), Postives = 234/471 (49.68%), Query Frame = 3
Query:  483 LLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYA--LFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVA-------GIIHKTXXXXXXXXXXXXAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEY-IKEPSSIIDILPLLFQI------------GCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKS----VVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            L L+F+ T+  +  +++   P     I+R L  +++    ++++      K    +  + + +  +   ++ L DL +  R +   +   + ++  ++ +  YA  L   +  +LV E NE N +    DV  KKA+++W+ +L  +A         + +T+ N   ++   + G  +  EIT  GFQFLLL   KQ+W ++I YL+  + +   I++++  L QI             C  ID  +T     + Q E+L H  E G I         F +T LL  L + N+ +      D SA  +  S G +I+E++  +YA+T S LQ+A++ +F ++  RF   +   IT +S+  AL  GIT+ QIISFL  N HP     S     +PIT+ D+I+L E  R R      Y+Y +F ++ EF  +  +A  +N + W + ++ +V+V ED H ++R+++K  K+
Sbjct:   22 LFLDFLITIPPKTRQRLLQKPSCAFFIYRMLPPIAQQTTIQLIW------KGSFPTASDVEETKEIEDQVKLLKDLGLVHRQTTDGK---LNIDTDYKRSYMYAAMLGAAQISSLVLEPNEGNRR--GKDV-EKKAVERWDCILRYLALPSEENTQAVSETTRNLFKKANFTSGGDTQ-IEITTFGFQFLLLSPVKQMWTYVIEYLKLEMSQGQDIVEVIEPLIQIVLLANRGFKAERECYQIDANWT-----EPQNELLNHLRELGVIFIRKRKDGVFFLTQLLTHLAT-NETID-----DVSAEKV--SNGKVIVETNFRVYAYTSSLLQLAIIALFTEMTYRFQDMSVGMITRESVRGALQHGITAAQIISFLRANAHPQCIATSGPVNCLPITVADQIRLWEDERRRMNLKDAYIYSHFESEDEFHGVCEYARQQNILLWSDNQQKLVIVNEDGHELVRQWYKREKS 466          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Celegans
Match: Y73F8A.24 (General transcription factor IIH subunit 4 [Source:UniProtKB/TrEMBL;Acc:D3NQB3])

HSP 1 Score: 160.999 bits (406), Expect = 1.386e-42
Identity = 130/476 (27.31%), Postives = 236/476 (49.58%), Query Frame = 3
Query:  483 LLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDL-IIFTRVSNGPQGECMRLNKKFQENLKYA--LFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVA-------GIIHKTXXXXXXXXXXXXAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEY-IKEPSSIIDILPLLFQI----------------GCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKS----VVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            L L+F+ T+  +  +++   P     I+R L  +++    ++++      K    +  + + +  +   ++ L DL ++  + ++G     + ++  ++ +  YA  L   +  +LV E NE N +    DV  KKA+++W+ +L  +A         + +T+ N   ++   + G  +  EIT  GFQFLLL   KQ+W ++I YL+  + +   I++++  L QI                 C  ID  +T     + Q E+L H  E G I         F +T LL  L + N+ +      D SA  +  S G +I+E++  +YA+T S LQ+A++ +F ++  RF   +   IT +S+  AL  GIT+ QIISFL  N HP     S     +PIT+ D+I+L E  R R      Y+Y +F ++ EF  +  +A  +N + W + ++ +V+V ED H ++R+++K  K+
Sbjct:   22 LFLDFLITIPPKTRQRLLQKPSCAFFIYRMLPPIAQQTTIQLIW------KGSFPTASDVEETKEIEDQVKLLKDLGLVHRQTTDGK----LNIDTDYKRSYMYAAMLGAAQISSLVLEPNEGNRR--GKDV-EKKAVERWDCILRYLALPSEENTQAVSETTRNLFKKANFTSGGDTQ-IEITTFGFQFLLLSPVKQMWTYVIEYLKLEMSQGQDIVEVIEPLIQIVLLANRVQVAGFKAERECYQIDANWT-----EPQNELLNHLRELGVIFIRKRKDGVFFLTQLLTHLAT-NETID-----DVSAEKV--SNGKVIVETNFRVYAYTSSLLQLAIIALFTEMTYRFQDMSVGMITRESVRGALQHGITAAQIISFLRANAHPQCIATSGPVNCLPITVADQIRLWEDERRRMNLKDAYIYSHFESEDEFHGVCEYARQQNILLWSDNQQKLVIVNEDGHELVRQWYKREKS 470          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Celegans
Match: Y73F8A.24 (General transcription factor IIH subunit 4 [Source:UniProtKB/TrEMBL;Acc:D3NQB3])

HSP 1 Score: 157.918 bits (398), Expect = 6.517e-42
Identity = 124/409 (30.32%), Postives = 208/409 (50.86%), Query Frame = 3
Query:  681 TKSLEE----LNDLIIFTRVSNGPQGECMRLNKKFQENLKYA--LFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVA-------GIIHKTXXXXXXXXXXXXAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEY-IKEPSSIIDILPLLFQI------------GCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKS----VVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            TK +E+    L DL +  R +   +   + ++  ++ +  YA  L   +  +LV E NE N +    DV  KKA+++W+ +L  +A         + +T+ N   ++   + G  +  EIT  GFQFLLL   KQ+W ++I YL+  + +   I++++  L QI             C  ID  +T     + Q E+L H  E G I         F +T LL  L + N+ +      D SA  +  S G +I+E++  +YA+T S LQ+A++ +F ++  RF   +   IT +S+  AL  GIT+ QIISFL  N HP     S     +PIT+ D+I+L E  R R      Y+Y +F ++ EF  +  +A  +N + W + ++ +V+V ED H ++R+++K  K+
Sbjct:   28 TKEIEDQVKLLKDLGLVHRQTTDGK---LNIDTDYKRSYMYAAMLGAAQISSLVLEPNEGNRR--GKDV-EKKAVERWDCILRYLALPSEENTQAVSETTRNLFKKANFTSGGDTQ-IEITTFGFQFLLLSPVKQMWTYVIEYLKLEMSQGQDIVEVIEPLIQIVLLANRGFKAERECYQIDANWT-----EPQNELLNHLRELGVIFIRKRKDGVFFLTQLLTHLAT-NETID-----DVSAEKV--SNGKVIVETNFRVYAYTSSLLQLAIIALFTEMTYRFQDMSVGMITRESVRGALQHGITAAQIISFLRANAHPQCIATSGPVNCLPITVADQIRLWEDERRRMNLKDAYIYSHFESEDEFHGVCEYARQQNILLWSDNQQKLVIVNEDGHELVRQWYKREKS 416          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Celegans
Match: Y73F8A.24 (General transcription factor IIH subunit 4 [Source:UniProtKB/TrEMBL;Acc:D3NQB3])

HSP 1 Score: 156.377 bits (394), Expect = 2.547e-41
Identity = 124/414 (29.95%), Postives = 210/414 (50.72%), Query Frame = 3
Query:  681 TKSLEE----LNDL-IIFTRVSNGPQGECMRLNKKFQENLKYA--LFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVA-------GIIHKTXXXXXXXXXXXXAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEY-IKEPSSIIDILPLLFQI----------------GCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKS----VVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            TK +E+    L DL ++  + ++G     + ++  ++ +  YA  L   +  +LV E NE N +    DV  KKA+++W+ +L  +A         + +T+ N   ++   + G  +  EIT  GFQFLLL   KQ+W ++I YL+  + +   I++++  L QI                 C  ID  +T     + Q E+L H  E G I         F +T LL  L + N+ +      D SA  +  S G +I+E++  +YA+T S LQ+A++ +F ++  RF   +   IT +S+  AL  GIT+ QIISFL  N HP     S     +PIT+ D+I+L E  R R      Y+Y +F ++ EF  +  +A  +N + W + ++ +V+V ED H ++R+++K  K+
Sbjct:   28 TKEIEDQVKLLKDLGLVHRQTTDGK----LNIDTDYKRSYMYAAMLGAAQISSLVLEPNEGNRR--GKDV-EKKAVERWDCILRYLALPSEENTQAVSETTRNLFKKANFTSGGDTQ-IEITTFGFQFLLLSPVKQMWTYVIEYLKLEMSQGQDIVEVIEPLIQIVLLANRVQVAGFKAERECYQIDANWT-----EPQNELLNHLRELGVIFIRKRKDGVFFLTQLLTHLAT-NETID-----DVSAEKV--SNGKVIVETNFRVYAYTSSLLQLAIIALFTEMTYRFQDMSVGMITRESVRGALQHGITAAQIISFLRANAHPQCIATSGPVNCLPITVADQIRLWEDERRRMNLKDAYIYSHFESEDEFHGVCEYARQQNILLWSDNQQKLVIVNEDGHELVRQWYKREKS 420          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Fly
Match: mrn (gene:FBgn0261109 transcript:FBtr0075595)

HSP 1 Score: 214.157 bits (544), Expect = 1.371e-61
Identity = 141/476 (29.62%), Postives = 243/476 (51.05%), Query Frame = 3
Query:  468 NFEKSLLLNFIKTLDS-QDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQG-ECMRLNKKFQENLKYALFGGE-----TCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXX-----AGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMK-------EKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNS 1820
            N E      +++T  + + +EK++  P  C  +FREL  +++  + R+LF+D+ V ++++ SW  +  +    ++   L  L ++ RV+  P G     L+  F+++++  L GG      T TL K+   S  + IA   L   A+ +W  VL  + G  ++   +    S         A  +K DE     IT +GFQFLLL  + QVW F++ YL+  +E   S+ + L +LFQ+   ++ + Y+           LQH  EFG +         F+ T L +++ S     +     D+ A+      GYI++E++  +YA+TDS LQ+AVL +F +L  RFP      +T  S+ +AL  GIT++QI+S+L    HP M+        KS +P T+VD+IKL E  RNR     G +Y  F + ++F TL ++A+  + + W+N     ++V ++ H  ++++WK    S
Sbjct:   31 NLECKDFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNVW-RVTAIPGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLDKD---SKPRDIA--FLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGLVFQRKRKEGRFYPTRLALNVTSKEAAATASVAMDEEATQ---DCGYIVVETNYRVYAYTDSPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCLPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNGHDDVKRYWKKYSKS 497          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Zebrafish
Match: gtf2h4 (general transcription factor IIH, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6779])

HSP 1 Score: 217.238 bits (552), Expect = 6.112e-63
Identity = 135/465 (29.03%), Postives = 248/465 (53.33%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIF--TRVSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSL------GYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            L  ++K L  + +++++  P TC  ++REL  L+K+ V R+LF+D  + ++ +A WV KD      + +  L  L ++    +  G QG    LN  F++NL+ AL GG      E   L  + +  + +S     L + A+++WE +L  + G     + +  +  +++ AG +K++      IT+ GFQFLLL    Q+W F + YL+  +     +++IL  LFQ+   ++ + Y+    +++    LQH  EFG +         ++ T L + L +G            SASS + ++      G+I++E++  IYA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  ++R +   G +Y  F +Q++F+ L + A+    + W+N    +++V    H  +++FWK +K+
Sbjct:   12 LHEYLKELTPEILDRLYNHPATCLAVYRELPPLAKNYVMRMLFLDHPLPQAAVALWVKKDSQKDHDQCVSVLTGLRLWHSQHLQGGLQG--FVLNPVFKDNLRIALLGGGKPWADEGANLGPDRHARDVES-----LDRYAMERWEVILHFMVGS-PSAAVSQDLAQLLIQAGLMKSETGEAPCITSAGFQFLLLDTASQLWYFTLQYLKTAQSRGMDLVEILSFLFQLSFSTLGRDYSVEGMSESLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAG----VTANPASGSASSALGAIPGTGDTGFIVVETNYRIYAYTNSELQIALVALFSEMLYRFPNLVVAQVTRESVQQAISNGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELEKDRLQFTEGVLYNQFLSQADFEVLRDRAQGLGVLVWQNPAHRVMVVTPHGHSEVKRFWKRQKS 464          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Zebrafish
Match: gtf2h4 (general transcription factor IIH, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6779])

HSP 1 Score: 217.238 bits (552), Expect = 9.878e-63
Identity = 135/465 (29.03%), Postives = 248/465 (53.33%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIF--TRVSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSL------GYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            L  ++K L  + +++++  P TC  ++REL  L+K+ V R+LF+D  + ++ +A WV KD      + +  L  L ++    +  G QG    LN  F++NL+ AL GG      E   L  + +  + +S     L + A+++WE +L  + G     + +  +  +++ AG +K++      IT+ GFQFLLL    Q+W F + YL+  +     +++IL  LFQ+   ++ + Y+    +++    LQH  EFG +         ++ T L + L +G            SASS + ++      G+I++E++  IYA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  ++R +   G +Y  F +Q++F+ L + A+    + W+N    +++V    H  +++FWK +K+
Sbjct:   30 LHEYLKELTPEILDRLYNHPATCLAVYRELPPLAKNYVMRMLFLDHPLPQAAVALWVKKDSQKDHDQCVSVLTGLRLWHSQHLQGGLQG--FVLNPVFKDNLRIALLGGGKPWADEGANLGPDRHARDVES-----LDRYAMERWEVILHFMVGS-PSAAVSQDLAQLLIQAGLMKSETGEAPCITSAGFQFLLLDTASQLWYFTLQYLKTAQSRGMDLVEILSFLFQLSFSTLGRDYSVEGMSESLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAGVT----ANPASGSASSALGAIPGTGDTGFIVVETNYRIYAYTNSELQIALVALFSEMLYRFPNLVVAQVTRESVQQAISNGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELEKDRLQFTEGVLYNQFLSQADFEVLRDRAQGLGVLVWQNPAHRVMVVTPHGHSEVKRFWKRQKS 482          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Xenopus
Match: gtf2h4 (Xenopus tropicalis general transcription factor IIH subunit 4 (gtf2h4), mRNA. [Source:RefSeq mRNA;Acc:NM_001015845])

HSP 1 Score: 218.779 bits (556), Expect = 1.653e-63
Identity = 138/462 (29.87%), Postives = 251/462 (54.33%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIF--TRVSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPSSI-IDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISS--LGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNS 1820
            L  F++ L    +++++  P TC  +FREL  L+K+ V R+LF+++ + ++ +A WV K+      ++ + L  L ++   ++  G QG  + LN  F+ENLK AL GG      + C L  + +  +  S     L K A ++WE +L  + G     + +  +  +++ AG +K++      I++ GFQFLLL    Q+W F++ YL+  +    I ++IL  +FQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             + S++ S   G+I++E++  IYA+TDS+LQIA++ +F ++  RFP      +T +++ +A+  GIT++QII FL    HP M ++  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L N+A     + ++N  K +++V    H  +++FWK +K+S
Sbjct:   13 LHEFLQELSPGVLDQLYNHPATCLAVFRELPGLAKNYVMRMLFLEQPLPQAAVALWVKKENFKEHEENTQVLTGLRLWHTQQLPGGLQG--LILNPIFRENLKIALLGGGKPWADDGCLLGPDKHGKDVVS-----LDKYAEERWEVILHFMVGS-PSAAVSQDLAQLLIQAGLMKSESGEAPCISSAGFQFLLLDTPSQLWYFMLQYLKSAESRGMILVEILSFMFQLSFSTLGKDYSVEGMSDSLLTFLQHLREFGLVFQRKRKSRRYYPTRLAINLASG------------ISGSVVDSHKQGFIVVETNYRIYAYTDSELQIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHFLRTRAHPVMLQQNPVLPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARDLGVLVFENPAKRVMVVTPGGHSDVKRFWKRQKHS 454          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Xenopus
Match: gtf2h4 (Xenopus tropicalis general transcription factor IIH subunit 4 (gtf2h4), mRNA. [Source:RefSeq mRNA;Acc:NM_001015845])

HSP 1 Score: 218.779 bits (556), Expect = 1.746e-63
Identity = 138/462 (29.87%), Postives = 251/462 (54.33%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIF--TRVSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPSSI-IDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISS--LGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNS 1820
            L  F++ L    +++++  P TC  +FREL  L+K+ V R+LF+++ + ++ +A WV K+      ++ + L  L ++   ++  G QG  + LN  F+ENLK AL GG      + C L  + +  +  S     L K A ++WE +L  + G     + +  +  +++ AG +K++      I++ GFQFLLL    Q+W F++ YL+  +    I ++IL  +FQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             + S++ S   G+I++E++  IYA+TDS+LQIA++ +F ++  RFP      +T +++ +A+  GIT++QII FL    HP M ++  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L N+A     + ++N  K +++V    H  +++FWK +K+S
Sbjct:   19 LHEFLQELSPGVLDQLYNHPATCLAVFRELPGLAKNYVMRMLFLEQPLPQAAVALWVKKENFKEHEENTQVLTGLRLWHTQQLPGGLQG--LILNPIFRENLKIALLGGGKPWADDGCLLGPDKHGKDVVS-----LDKYAEERWEVILHFMVGS-PSAAVSQDLAQLLIQAGLMKSESGEAPCISSAGFQFLLLDTPSQLWYFMLQYLKSAESRGMILVEILSFMFQLSFSTLGKDYSVEGMSDSLLTFLQHLREFGLVFQRKRKSRRYYPTRLAINLASG------------ISGSVVDSHKQGFIVVETNYRIYAYTDSELQIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHFLRTRAHPVMLQQNPVLPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARDLGVLVFENPAKRVMVVTPGGHSDVKRFWKRQKHS 460          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Xenopus
Match: gtf2h4 (Xenopus tropicalis general transcription factor IIH subunit 4 (gtf2h4), mRNA. [Source:RefSeq mRNA;Acc:NM_001015845])

HSP 1 Score: 168.703 bits (426), Expect = 5.246e-46
Identity = 99/326 (30.37%), Postives = 180/326 (55.21%), Query Frame = 3
Query:  870 LTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPSSI-IDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISS--LGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNS 1820
            L K A ++WE +L  + G     + +  +  +++ AG +K++      I++ GFQFLLL    Q+W F++ YL+  +    I ++IL  +FQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             + S++ S   G+I++E++  IYA+TDS+LQIA++ +F ++  RFP      +T +++ +A+  GIT++QII FL    HP M ++  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L N+A     + ++N  K +++V    H  +++FWK +K+S
Sbjct:   58 LDKYAEERWEVILHFMVGS-PSAAVSQDLAQLLIQAGLMKSESGEAPCISSAGFQFLLLDTPSQLWYFMLQYLKSAESRGMILVEILSFMFQLSFSTLGKDYSVEGMSDSLLTFLQHLREFGLVFQRKRKSRRYYPTRLAINLASG------------ISGSVVDSHKQGFIVVETNYRIYAYTDSELQIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHFLRTRAHPVMLQQNPVLPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARDLGVLVFENPAKRVMVVTPGGHSDVKRFWKRQKHS 370          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Mouse
Match: Gtf2h4 (general transcription factor II H, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1338799])

HSP 1 Score: 225.328 bits (573), Expect = 4.751e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   20 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPVFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 463          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Mouse
Match: Gtf2h4 (general transcription factor II H, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1338799])

HSP 1 Score: 225.328 bits (573), Expect = 4.751e-66
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   20 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPVFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 463          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Mouse
Match: Gtf2h4 (general transcription factor II H, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1338799])

HSP 1 Score: 66.6254 bits (161), Expect = 2.029e-12
Identity = 47/152 (30.92%), Postives = 82/152 (53.95%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLV 917
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  +
Sbjct:   20 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPVFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFM 164          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Mouse
Match: Gtf2h4 (general transcription factor II H, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1338799])

HSP 1 Score: 66.2402 bits (160), Expect = 4.318e-12
Identity = 36/110 (32.73%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGGE 809
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL G  
Sbjct:   20 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPVFRQNLRIALLGAR 127          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Mouse
Match: Gtf2h4 (general transcription factor II H, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1338799])

HSP 1 Score: 50.8322 bits (120), Expect = 1.357e-7
Identity = 25/76 (32.89%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLI 713
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    K+ EE   L+
Sbjct:   20 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFS----KAQEESTGLL 91          
BLAST of General transcription factor IIH subunit 4 vs. UniProt/SwissProt
Match: sp|O70422|TF2H4_MOUSE (General transcription factor IIH subunit 4 OS=Mus musculus OX=10090 GN=Gtf2h4 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.323e-65
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   20 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPVFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 463          
BLAST of General transcription factor IIH subunit 4 vs. UniProt/SwissProt
Match: sp|P60027|TF2H4_PANTR (General transcription factor IIH subunit 4 OS=Pan troglodytes OX=9598 GN=GTF2H4 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.423e-65
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. UniProt/SwissProt
Match: sp|Q92759|TF2H4_HUMAN (General transcription factor IIH subunit 4 OS=Homo sapiens OX=9606 GN=GTF2H4 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.423e-65
Identity = 140/462 (30.30%), Postives = 246/462 (53.25%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            L  F+  L    +++++  P TC  +FREL +L+K+ V R+LF+++ + ++ +A WV K++S    +S   L+ L I+    +  G QG  + LN  F++NL+ AL GG      +T  L  + +  +  S     L K A ++WE VL  + G     + +  +  ++  AG +K+ E      IT+ GFQFLLL    Q+W F++ YL+  +     +++IL  LFQ+   ++ + Y+    + +    LQH  EFG +         ++ T L ++L SG             A   +   G+I++E++  +YA+T+S+LQIA++ +F ++  RFP      +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R R   G +Y  F +Q +F+ L+  A     + ++N  K +++V    H  +++FWK +K+S 
Sbjct:   19 LQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQG--LILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS-----LDKYAEERWEVVLHFMVGS-PSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVS----------GAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS 462          
BLAST of General transcription factor IIH subunit 4 vs. UniProt/SwissProt
Match: sp|Q6CLR2|TFB2_KLULA (General transcription and DNA repair factor IIH subunit TFB2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TFB2 PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 5.408e-53
Identity = 129/495 (26.06%), Postives = 238/495 (48.08%), Query Frame = 3
Query:  468 NFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKE-PSSIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLS------------------GNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKS-------------------VVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSD 1823
            N  K+ + ++++ L  Q   +++ SP TC  I+R LS ++K  +  +LF D  V    +  WV  D  Y L  S++ +  L +        Q   +RLN  F+++ K  L GGE      +  + +   +++  L + + +KWE++L  + G  +  +    V  ++ ++G ++  E     ITN+GFQFLL     Q+W  L+ YL+  +      +D+L  +F +G   + + Y C   +  QR MLQ   ++G I      +  F+ T L   L S                   N+  +++    Q  ++  +  G +I+E++  +Y++++S LQIA+L +F  L  RF       +T +S+  AL  GIT++QII++L  + HP M+  +                   V+P T+VD+I+L +   +R     GY+Y +F +  E+ T+ ++A+    + W+N +K M  V  + +  +  F  +R+N D
Sbjct:    4 NLFKTTVNDYLEGLPEQVQSRLYESPATCLAIYRLLSPMAKFFIMSMLFQDHDVSLRDLDKWVKPDAKYQLQYSIKSMKSLNLIIE-GESKQPLLIRLNPIFKKSFKNVLTGGEINNSFGDVADDDTNPVSTATLDQYSAEKWETILHYMVGTPNTNTPGGKVLDLLQHSGLMEEAEYGELKITNQGFQFLLQDVNAQMWTLLLQYLKMAESLQMDPVDVLNFIFMLGALQLGKAYKCDQLSNTQRTMLQDMRDYGLIYQNQSDYAKFYPTRLATLLTSDTKAFRSASVALDSVLNKANETTAVEGDSGQDETTERTQDGALIIETNFKLYSYSNSPLQIAILSLFVHLKSRFANMVTGQLTRESVRNALLNGITAEQIIAYLETHAHPRMRRLAEENLSKKLELDPTVKETLQVLPPTVVDQIRLWQLELDRIISYDGYLYTDFESYQEYQTVADYAKDIGVLLWQNEKKKMFFVSTEGNSQVLDF--HRRNFD 495          
BLAST of General transcription factor IIH subunit 4 vs. UniProt/SwissProt
Match: sp|Q75B51|TFB2_ASHGO (General transcription and DNA repair factor IIH subunit TFB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=TFB2 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.421e-50
Identity = 142/509 (27.90%), Postives = 240/509 (47.15%), Query Frame = 3
Query:  468 NFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIK----EPSSIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSL--------------------------------GYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMK-------EK------------SVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNR 1811
            N  K+ +  +++ L      +++ SP TC  I+R LS ++K  +  ++F DE V    +  WV  D  + L  +++ +  L + T   +G Q   ++LN  F+E+ K AL GGE         E     +   +L   A DKWE++L  + G     S    V S++ ++  ++ DE      ITNEGFQFLL     Q+W  L+ YL   +    +P   +D+L L+F IG   + + Y+    ++ Q+ MLQ   ++G +  +      F+ T L   L S  D +S++     SAS  ++S+                                G +I+E++  +Y++++S LQIA+L +F  L  RF       IT +SI RAL  GIT+DQII+++  + HP M+       EK             V+P T+VD+IKL +   +R     GY++++F N  E+  L  +A     + W + +K M  V ++ +  +  F K +
Sbjct:   13 NLFKNTVNEYLQELPQPVQSRLYQSPATCLAIYRLLSPMAKFFIMSMIFQDEEVSLRDLDRWVKPDAKFQLHDAIKSMKLLHLITEGRSG-QPLMVQLNSIFKESFKNALTGGEVKNSFGNVVEEENDPVTMAMLDSYAADKWETILHFMVGTPLTKSPGKNVLSLLRHSKLMEVDESSKELKITNEGFQFLLQDANAQIWTLLLQYLTMAETFQMDP---VDVLNLIFMIGALELGKAYSVVGLSETQKTMLQDLRDYGLVFQKQSNLSKFYPTRLATMLTS--DVVSIR-----SASGAVNSVLRQRAEGVDGKVLNGTALGDDDLQAGGEGALDGALIVETNFKLYSYSNSPLQIAILSLFIHLKTRFQNMVTGQITRESIRRALHNGITADQIIAYMETHAHPQMRRLAGDNLEKKLELDPNCRDTLQVLPPTVVDQIKLWQLELDRIISYDGYLFRDFDNLQEYQVLAQYARDIGVLLWSDDKKKMFFVSKEGNAQVIDFHKRK 510          
BLAST of General transcription factor IIH subunit 4 vs. TrEMBL
Match: A0A4Y7NK39 (General transcription factor IIH subunit 4 OS=Moina brachiata OX=675436 GN=EOG090X04KD PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 5.095e-77
Identity = 149/448 (33.26%), Postives = 248/448 (55.36%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPA-MKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWK 1805
            L +++KTL +  +++++  P TC  +FREL  LS+H + R+LF+D+ V K+++ SW++ + +  L +  + L +L I+  V      E + LN  F+ NLK AL GG     +K   E + KS     L   AI++WE VL  + G     + ++    ++ +AG +K +       IT +GFQFLL+    QVW FL+ YL+     +  +++ L  LFQ+   ++ Q Y+    +++    LQH  EFG +         F+ T L +D+ +G  +  L      S SS+  + GYII+E++  +YA+TDS LQ+A++ +FC+L  RFP      IT +SI +AL  GIT++QI+SFL  + HP   K   ++P T+ D+IKL    R+R     G +Y  F +Q++FD L N+A+ +  + W +     ++V  + H  ++KFWK
Sbjct:   13 LHSYLKTLPAGTLDRLYNHPATCLAVFRELPELSRHYIMRILFVDQAVPKAIMGSWISSNNTKELEELFKLLGELRIWHTVEMAGGLEGLLLNPAFRRNLKGALLGGGNEWSIKPPAEPDPKSRDIGFLDAYAIERWECVLHFMVGSRQHDAISSDALQLLHHAGLMKKENGDSQMTITRDGFQFLLMDTSSQVWYFLLQYLDTATARNLDLVECLGFLFQLSFSTLGQDYSTDNMSESLSRFLQHLREFGLVFQRKRKAGRFYPTRLALDIAAGPKKAMLG-----SMSSLSPTTGYIIVETNYRVYAYTDSTLQVALIALFCELMYRFPNLVVGIITRESIRQALRSGITAEQIVSFLRQHSHPERYKTPPILPPTIADQIKLWSLERDRFTYKDGVLYNQFDSQADFDVLKNYAQERGVLVWHSVTGRKMVVTRNGHDEVKKFWK 455          
BLAST of General transcription factor IIH subunit 4 vs. TrEMBL
Match: A0A4Y7M1Y0 (General transcription factor IIH subunit 4 OS=Daphnia hispanica OX=575233 GN=EOG090X04KD PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 9.014e-77
Identity = 152/449 (33.85%), Postives = 249/449 (55.46%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKND------EITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHP-AMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKN 1808
            L +++KTL +  +++++  P TC  +FREL  LS+  + R+LF+D+ V K+++ SWV+ + +  L   ++ L+DL ++  V      +   LN  F+ NLK AL GG     +K   +++ K+    +L + A+ +WE VL  + G       ++    ++ +AG +K +       IT +GFQFLL+    QVW FL+ YL+        +ID L  LFQ+   ++ Q Y+  + +   ++ LQH  EFG +         F+ T L +D+ SG  +  L   R   A+S   S GYII+E++  +YA+TDS LQ+A++ +FC+L  RFP      IT +SI +AL  GIT+DQI+SFL  + HP   KE  V+P T+ D+IKL    R+R     G +Y  F +Q++F+ L N+A+ +  + W       ++V ++ H  +RKFWK 
Sbjct:   13 LHSYLKTLPATVLDRLYNHPATCLAVFRELPELSRLYIMRILFVDQAVPKAIMGSWVSPNSAKELEDIVKLLSDLRLWQEVEMQGGLKGWLLNPTFRRNLKGALLGGGNEWSMKPPTDTDPKARGITILDEYAMGRWECVLHFMVGSHQHEVISSDALQILQHAGLMKKEVGENQLTITRDGFQFLLMDTSAQVWYFLLQYLDTATARGLDLIDCLGFLFQLSFSTLGQDYSTDSMSDGLQKFLQHLREFGLVYQRKRKDGRFYPTRLALDIASGPKKSMLNTMR---ATSSNQSSGYIIVETNYRVYAYTDSSLQVALIALFCELMYRFPNLVVGIITRESIRQALRSGITADQIVSFLRQHAHPECYKEPPVLPSTIADQIKLWAIERDRFIYKDGVLYNQFDSQADFEILKNYAQERGVLVWHTIHGRKMVVTKEGHEEVRKFWKR 458          
BLAST of General transcription factor IIH subunit 4 vs. TrEMBL
Match: A0A4Y7M1C8 (General transcription factor IIH subunit 4 OS=Daphnia atkinsoni OX=342845 GN=EOG090X04KD PE=2 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 6.736e-76
Identity = 151/449 (33.63%), Postives = 248/449 (55.23%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHP-AMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKN 1808
            L +++KTL +  +++++  P TC  +FREL  LS+  + R+LF+D+ V K+++ SWV+ + +  L   ++ L +L ++  V      +   LN  F+ NLK AL GG     +K   +++ K+    +L + A+ +WE VL  + G       ++    ++ +AG +K +       IT +GFQFLL+    QVW FL+ YL+        +ID L  LFQ+   ++ Q Y+    T+  ++ LQH  EFG +         F+ T L +D+ SG  +  L       A+S   S GYII+E++  +YA+TDS LQ+A++ +FC+L  RFP      IT +SI +AL  GIT+DQI+SFL  + HP   KE  V+P T+ D+IKL    R+R     G +Y  F +Q++F+ L N+A+ +  + W   +   ++V ++ H  +RKFWK 
Sbjct:   22 LHSYLKTLPATVLDRLYNHPATCLAVFRELPELSRLYIMRILFVDQAVPKAIMGSWVSPNSAKELEDIVKLLTELRLWQEVEMQGGLKGWLLNPTFRRNLKGALLGGGNDWSMKPPTDTDPKARGIAILDEYAMGRWECVLHFMVGSHQHEVISSDALQILQHAGLMKKEPGENQLTITRDGFQFLLMDTSAQVWYFLLQYLDTATARGLDLIDCLGFLFQLSFSTLGQDYSTDLMTEGLQKFLQHLREFGLVYQRKRKDGRFYPTRLALDIASGPKKSMLNT---MKATSSNQSSGYIIVETNYRVYAYTDSSLQVALIALFCELMYRFPNLVVGIITRESIRQALRSGITADQIVSFLRQHAHPECYKEPPVLPSTIADQIKLWAIERDRFIYKDGVLYNQFDSQADFEILKNYAQERGVLVWHTIQGRKMVVTKEGHEEVRKFWKR 467          
BLAST of General transcription factor IIH subunit 4 vs. TrEMBL
Match: A0A0R3UG68 (General transcription factor IIH subunit 4 OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6190 PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.247e-75
Identity = 150/481 (31.19%), Postives = 270/481 (56.13%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIA--SDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKND------EITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLL----------------------------SGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRK 1814
            + +++KTLD+ D+++++  P TC ++FREL  LSKH++ R+LF+++T+ KS+++ WV+K    +L ++  +L+DL ++  + +       RLNKKFQE++K +LFGG    L+ ++  +  +     +D L   A ++W+S+L  + G          VR V++ +G +K         IT  GFQFLL+ +  QV +F++ Y +Y+KE   ++I+ L  +FQ+   SI + Y  +  + A++E+LQH  E G           F+VT L + L                             +G  + ++K G  +S  +  + +G+I++E++  +YA+TDS L+ A+L +F K+  R+P      IT  S+  AL +GI++DQIISFLM+N HP M ++  ++P TLVD+I+L E  R R     G +Y+ F   ++F+ + ++A+    + W+  E+ +++V +  H  +R FWK ++
Sbjct:   10 IFDYLKTLDANDLDELYGHPPTCLIVFRELRELSKHLILRLLFLEQTIPKSIVSGWVSKGSQELLNQACTDLSDLRVWHSIDSNSARGSWRLNKKFQESMKVSLFGGGN-QLLSDFGSTTAEKHPKDADFLENYASERWDSILHFMVG-SDNAEVGTCVRDVLLLSGLMKRGGPDFSMGITQRGFQFLLMDRSSQVLRFMLHYFDYLKESRMNLIESLQFVFQLSFLSIGKSYPISMLSTAKQEILQHMRELGLAYQRKRTAPRFYVTRLALSLAFGTSTISSSVRSSLDGEHSLLFSTNPLPTGVSQRAVKAGGTESGGA--ADVGFILVETNFRLYAYTDSPLRTALLSLFSKIRVRYPNMVVADITRDSVREALLRGISADQIISFLMSNAHPDMLRQPEILPPTLVDQIRLWELERERLFFQEGCLYEQFAKNTDFEMIRDYAKGHGYLLWECPERRLMVVSKAGHDDVRAFWKQKR 486          
BLAST of General transcription factor IIH subunit 4 vs. TrEMBL
Match: A0A164RYY7 (General transcription factor IIH subunit 4 OS=Daphnia magna OX=35525 GN=APZ42_026818 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 3.287e-75
Identity = 147/448 (32.81%), Postives = 248/448 (55.36%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE------ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHP-AMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWK 1805
            L +++KTL +  +++++  P TC  +FREL  LS+  + R+LF+D+ V K+++ SWV+ + +  L   ++ L +L ++  V      +   LN  F+ NLK AL GG     +K   +++ K+    +L + A+ +WE VL  + G       ++    ++ +AG +K +       IT +GFQFLL+    QVW FL+ YL+        +ID L  LFQ+   ++ Q Y+  + +   ++ LQH  EFG +         F+ T L +D+ SG  +  L      +A+S   + GYI++E++  +YA+TDS LQ+A++ +FC+L  RFP      IT +S+ +AL  GIT+DQI+SFL  + HP   KE  V+P T+ D+IKL    R+R     G +Y  F +Q++F+ L N+A+ +  + W       ++V ++ H  +RKFWK
Sbjct:   13 LHSYLKTLTATVLDRLYNHPATCLAVFRELPELSRLYIMRILFVDQAVPKAIMGSWVSPNSAKELEDIVKLLTELRLWQEVEMQGGLKGWLLNPTFRRNLKGALLGGGNEWSMKPPTDADPKARGIAILDEYAMGRWECVLHFMVGSHQHEVISSDALQILQHAGLMKKEPGENQLTITRDGFQFLLMDTSAQVWYFLLQYLDTATARGLDLIDCLGFLFQLSFSTLGQDYSTDSMSDGLQKFLQHLREFGLVYQRKRKDGRFYPTRLALDIASGPKKSMLNA---MTATSSNQNSGYIVVETNYRVYAYTDSSLQVALIALFCELMYRFPNLVVGIITRESVRQALRSGITADQIVSFLRQHAHPECYKEPPVLPSTIADQIKLWAIERDRFVYKDGVLYNQFDSQADFEILKNYAQERGVLVWHTTHGRKMVVTKEGHEEVRKFWK 457          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Cavefish
Match: gtf2h4 (general transcription factor IIH subunit 4 [Source:NCBI gene;Acc:103042913])

HSP 1 Score: 216.468 bits (550), Expect = 8.884e-63
Identity = 133/462 (28.79%), Postives = 247/462 (53.46%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIF--TRVSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSG---NDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            L  +++ L    +++++  P TC  ++REL +L+K+ V R+LF+D  + ++ +A WV KD      + +  L  L ++   ++  G QG  + LN  F++NL+ AL GG      E  +L  + +  + +S     L + A+++WE +L  + G     + +  +  +++ AG +K++      IT+ GFQFLLL    Q+W   + YL  ++     +++IL  LFQ+   ++ + Y+    +++ +  LQH  EFG +         ++ T L + L +G   N   S       SA S     G+I++E++  +YA+TDS+LQIA++ +F ++  R        +T +S+ +A+  GIT+ QII FL    HP M K+  V+P T+ D+I+L E  R+R +   G +Y  F +Q++F+ L + A+    + W+N    +++V    H  +++FWK +K+
Sbjct:   12 LHEYLRELSPDILDRLYNHPATCLAVYRELPSLAKNYVMRMLFLDHPLPQAAVALWVKKDSQKDHDQCVSVLTGLRLWHNQQLQGGLQG--IVLNPVFKDNLRIALLGGGKAWADEGSSLGPDRHARDVES-----LDRYAMERWEVILHFMVGS-PSAAVSQDLAQLLIQAGLMKSEAGDAPCITSAGFQFLLLDTASQLWYITLQYLNTVQSRGMDLVEILSFLFQLSFSTLGRDYSVEGMSESLQTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAGVTANSSSSSSSSTAVSAMSGTGESGFIVVETNYRVYAYTDSELQIALVALFSEMLYRLSNVVVAQVTRESVQQAIANGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLQFTEGVLYNQFLSQADFEVLRDRAQGLGVLVWQNAPHRVMVVTPHGHSEVKRFWKRQKS 465          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Sea Lamprey
Match: gtf2h4 (general transcription factor IIH, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6779])

HSP 1 Score: 120.168 bits (300), Expect = 1.402e-31
Identity = 62/194 (31.96%), Postives = 115/194 (59.28%), Query Frame = 3
Query: 1251 FHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHT---DSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNS 1820
            ++ T L ++L SG     + +G     S+ +   GY+++E++  +YA+T   DS+LQ+A++ +FC++  RFP      +T +S+ +A+  GIT++QII FL  + HP M K+  V+P T+ D+I+L E  R+R     G +Y  F +Q++++ L   A+    + W+   + +++V    H  +++FWK +KNS
Sbjct:    7 YYPTRLAINLASG-----ISQG-----STDVHQQGYLVVETNYRVYAYTAVLDSELQVALVALFCEMLYRFPNLVVAQVTRESVQQAIANGITAEQIIHFLRTHAHPEMMKQTPVLPPTITDQIRLWEMERDRLVFTEGVLYSQFLSQADYEVLCVRAKELGVLQWECAARRLMVVTPAGHTDVKRFWKRQKNS 190          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Sea Lamprey
Match: gtf2h4 (general transcription factor IIH, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6779])

HSP 1 Score: 90.5077 bits (223), Expect = 8.739e-21
Identity = 69/232 (29.74%), Postives = 117/232 (50.43%), Query Frame = 3
Query:  567 RELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTR--VSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYI----KNDEITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFI 1223
            RELS L+++ V R+LF++  +  + I SWV KD      +S + L +L ++    +  G  G  + LN  F+ NL+ AL GG      +T  L  + +  +  S     L + A+++WE +L  + G       +  V  +++ AG +    K   IT+ GFQFLLL    QVW F++ YL   +     +++IL  LFQ+   ++ + Y+    +++    LQH  EFG +
Sbjct:    1 RELSPLARNYVMRMLFLETPLPTAAIDSWVCKDAQKAHEESAQLLRELRVWQDHVIPGGLPG--LVLNPVFRANLRTALLGGGNPWSDDTTGLGPDKHARDVTS-----LDRYALERWEVILHFMVGS-PGAEVSADVAQLLIKAGLMRRLKKQISITSAGFQFLLLDTASQVWYFMLQYLNSTETRGMDLVEILSFLFQLSFSTLGKDYSVEGMSESLLNFLQHLREFGMV 224          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Yeast
Match: TFB2 (Subunit of TFIIH and nucleotide excision repair factor 3 complexes; involved in transcription initiation, required for nucleotide excision repair, similar to 52 kDa subunit of human TFIIH [Source:SGD;Acc:S000006043])

HSP 1 Score: 163.696 bits (413), Expect = 4.898e-44
Identity = 130/500 (26.00%), Postives = 229/500 (45.80%), Query Frame = 3
Query:  495 FIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECM-RLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGII------HKTXXXXXXXXXXXXAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMS---------LKEGRDQ-----------SASSIISS--------------LGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKS-------------------VVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNR 1811
            +++ +  Q   +++ SP TC  I+R L  L+K  +  ++F +  V    +  WVN +       +++ +  L +   + N   G  M  LN  F+ +L+ AL GGE         E N  S+  D+L + + +KWE++L  + G         K  N      ++         +ITNEGFQFLL +   Q+W  L+ YL+ I+     ++D+L  +F +G   + + Y     ++ QR MLQ   ++G +  +      F+ T L + L S    +          L++ R++           S + I +S               G +I+E++  IY++++S LQIAVL +F  L  RF       IT +SI RAL  GIT+DQII++L  + HP M+  +                   V+P T+VD+I+L +   +R     G +Y +F    E++ L  +A+    + WK+ +K    + ++ +  +  F K +
Sbjct:   13 YLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLL--IPNKSSGTLMINLNPTFKISLRNALTGGEVQNSFGVVVEENVVSL--DLLDEYSANKWETILHFMVGTPLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNREEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRK 508          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Nematostella
Match: EDO38911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBP9])

HSP 1 Score: 227.639 bits (579), Expect = 2.601e-67
Identity = 142/465 (30.54%), Postives = 242/465 (52.04%), Query Frame = 3
Query:  465 ENFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTL-VKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGII----HKTXXXXXXXXXXXXAGYIK------NDEITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNS 1820
             + ++  L  ++  L    ++++F  P TC  +FREL  L+KH V R LF D+ V +S++++WV   Y      SL  L  L I+  V +G       +N  F+ N+K AL GG    +   ++   +  +   D L K AI++WESVL  + G      +    +  V  V+V +G +K      N  I+  GFQFLLL +  QVW F++  LE ++     +++ L LLFQ+   S  + Y     T +Q + LQ   E G +         ++ T L V+L +        +G + + S I    G+II+E++  +YA+T+S LQ++++ +FC++  RFP      +T +S  +AL  GI+++QI++FL    HP M K   ++P T+ D+++L E  R+R +   G +Y  F +Q++F+ L  +AE    + W N  K +V+V    H  +++FWK ++  
Sbjct:   15 RHLQRKDLYEYLSGLPVGILDRLFCHPATCLTVFRELPELAKHFVMRTLFADQPVPESIVSTWVKSAYYKYNIGSLNTLKQLRIWREVPSGVHKR-YEMNATFRTNMKAALCGGGKSWMGSTQHLGPDKHTREPDFLDKYAIERWESVLHFMTGSTEMADNAGGVSQDVVKVLVLSGLMKCESPGSNPIISPAGFQFLLLDRPSQVWYFMLQCLETVEARGMDLVECLSLLFQLSFSSPGKDYPTDGLTDSQMKFLQQLREIGLVFQRKRKSRRYYPTKLSVNLTAAG------KGINTTDSQI--EAGFIIIETNYRVYAYTESCLQVSLIGLFCEILCRFPNLCVASLTRESCQQALASGISAEQILNFLQTRAHPEMLKRTPIIPSTISDQVRLWEMERSRMKFTEGVLYNQFLSQADFEMLRKYAEDLGVLIWANSTKRVVVVSRSGHDDVKRFWKRQRQG 470          
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Medaka
Match: gtf2h4 (general transcription factor IIH subunit 4 [Source:NCBI gene;Acc:101173874])

HSP 1 Score: 212.231 bits (539), Expect = 3.264e-61
Identity = 130/459 (28.32%), Postives = 244/459 (53.16%), Query Frame = 3
Query:  486 LLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIF--TRVSNGPQGECMRLNKKFQENLKYALFGG------ETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDE-----ITNEGFQFLLLQKKKQVWQFLISYLEYIKEPS-SIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAM-KEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKN 1817
            L  +++ L    +++++  P TC  + REL  L+K+ V R+LF+++ + ++ +A WV KD      + +  L  L ++   ++  G QG    LN  F++NL+ AL GG      E   L  + +  + +S     L + A+++WE +L  + G    ++ +  +  ++V AG +K++      IT+ GFQFLLL    Q+W   + YL   +     +++IL  LFQ+   ++ + Y+    +++    LQH  EFG +         ++ T L + L +G   +S     + + +      G+I++E++  IYA+T+S+LQIA++ +F ++  RFP     H+T +S+ +A+  GIT+ QII FL    HP M K+   +P T+ D+I+L E  R+R +   G +Y  F +Q++F+ L + A+    + W++     ++V    H  ++KFWK +++
Sbjct:   12 LHEYLRELGPDVLDRLYNHPATCLAVCRELPLLAKNYVMRMLFLEQPLPQAAVALWVRKDGQRDHDECVSVLTGLRLWHSQQLQGGLQGYI--LNPVFKDNLRIALLGGGKVWADEGIILGPDRHARDIES-----LDRYAMERWEVILQFMVG--SPSAVSQDLAQLLVQAGLMKSEAGEAPYITSAGFQFLLLDTASQLWYLTLQYLNTAQSRGMELVEILSFLFQLSFSTLGRDYSVEGMSESLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAG---VSSNSPSNMTNTPGTGDAGFIVVETNYRIYAYTNSELQIALVALFSEMLYRFPNVVVAHLTRESVQQAIANGITAQQIIHFLRTRAHPVMLKQSPALPPTITDQIRLWELERDRLQFTEGVLYNQFLSQADFEVLRDRAQGLGCLVWQDASHRAMVVTPQGHSEVKKFWKRQRS 458          
BLAST of General transcription factor IIH subunit 4 vs. Planmine SMEST
Match: SMESG000022992.1 (SMESG000022992.1)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 456/456 (100.00%), Postives = 456/456 (100.00%), Query Frame = 3
Query:  462 MENFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTXXXXXXXXXXXXAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEYIKEPSSIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSDYL 1829
            MENFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTSNNNIVRSVIVNAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEYIKEPSSIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSDYL
Sbjct:    1 MENFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVLFIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRLNKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLSLVAGIIHKTSNNNIVRSVIVNAGYIKNDEITNEGFQFLLLQKKKQVWQFLISYLEYIKEPSSIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLEFGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYIIMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDKGITSDQIISFLMNNGHPAMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYMYQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNRKNSDYL 456          
The following BLAST results are available for this feature:
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF2H49.210e-6630.30general transcription factor IIH subunit 4 [Source... [more]
GTF2H49.210e-6630.30general transcription factor IIH subunit 4 [Source... [more]
GTF2H49.210e-6630.30general transcription factor IIH subunit 4 [Source... [more]
GTF2H49.210e-6630.30general transcription factor IIH subunit 4 [Source... [more]
GTF2H49.210e-6630.30general transcription factor IIH subunit 4 [Source... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y73F8A.243.693e-4327.60General transcription factor IIH subunit 4 [Sourc... [more]
Y73F8A.241.386e-4227.31General transcription factor IIH subunit 4 [Sourc... [more]
Y73F8A.246.517e-4230.32General transcription factor IIH subunit 4 [Sourc... [more]
Y73F8A.242.547e-4129.95General transcription factor IIH subunit 4 [Sourc... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrn1.371e-6129.62gene:FBgn0261109 transcript:FBtr0075595[more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf2h46.112e-6329.03general transcription factor IIH, polypeptide 4 [S... [more]
gtf2h49.878e-6329.03general transcription factor IIH, polypeptide 4 [S... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gtf2h41.653e-6329.87Xenopus tropicalis general transcription factor II... [more]
gtf2h41.746e-6329.87Xenopus tropicalis general transcription factor II... [more]
gtf2h45.246e-4630.37Xenopus tropicalis general transcription factor II... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtf2h44.751e-6630.30general transcription factor II H, polypeptide 4 [... [more]
Gtf2h44.751e-6630.30general transcription factor II H, polypeptide 4 [... [more]
Gtf2h42.029e-1230.92general transcription factor II H, polypeptide 4 [... [more]
Gtf2h44.318e-1232.73general transcription factor II H, polypeptide 4 [... [more]
Gtf2h41.357e-732.89general transcription factor II H, polypeptide 4 [... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70422|TF2H4_MOUSE3.323e-6530.30General transcription factor IIH subunit 4 OS=Mus ... [more]
sp|P60027|TF2H4_PANTR4.423e-6530.30General transcription factor IIH subunit 4 OS=Pan ... [more]
sp|Q92759|TF2H4_HUMAN4.423e-6530.30General transcription factor IIH subunit 4 OS=Homo... [more]
sp|Q6CLR2|TFB2_KLULA5.408e-5326.06General transcription and DNA repair factor IIH su... [more]
sp|Q75B51|TFB2_ASHGO1.421e-5027.90General transcription and DNA repair factor IIH su... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y7NK395.095e-7733.26General transcription factor IIH subunit 4 OS=Moin... [more]
A0A4Y7M1Y09.014e-7733.85General transcription factor IIH subunit 4 OS=Daph... [more]
A0A4Y7M1C86.736e-7633.63General transcription factor IIH subunit 4 OS=Daph... [more]
A0A0R3UG681.247e-7531.19General transcription factor IIH subunit 4 OS=Meso... [more]
A0A164RYY73.287e-7532.81General transcription factor IIH subunit 4 OS=Daph... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2h48.884e-6328.79general transcription factor IIH subunit 4 [Source... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf2h41.402e-3131.96general transcription factor IIH, polypeptide 4 [S... [more]
gtf2h48.739e-2129.74general transcription factor IIH, polypeptide 4 [S... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TFB24.898e-4426.00Subunit of TFIIH and nucleotide excision repair fa... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO389112.601e-6730.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2h43.264e-6128.32general transcription factor IIH subunit 4 [Source... [more]
back to top
BLAST of General transcription factor IIH subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022992.10.000e+0100.00SMESG000022992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033635 ID=SMED30033635|Name=General transcription factor IIH subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1982bp
ATTTATTAAAATAGTTTGATGAATATAGTGCCATTGAATCTCAAGGCGAA
ACGCAAAGACATGATATGAGATGTTTGAGATAATTTATTCACTAGATATC
TATGTGATAAATCAAGCCGTTACCTTTACGTGCTCTTCTATATAATTATT
TTGATGTTACATGTGATAAGTGTAATTTTTTTATTTATTGAATATAAAAT
TTGGTAATGATTTTAAATGTTCGGAGTTGTTTAGTAAATGTGAACGAATA
ATTGTATACTGGATAATTGTATCAAAAAACAATGATGTTTGATTATCATC
CAATGAAAACCTCTAATGAATTTCACAATAAAATTTTTTTTCCAACAAAT
AATTGATATTAATTGAGATTTCTTTGTCAACAAATGTTTATTATTTTTTA
GTAAATATTTTGAGATTTGAAAATGACATCTTGAATAAATTGTTTTAATA
TTTAAATATCGATGGAAAATTTTGAAAAGAGTTTATTACTTAATTTTATT
AAGACCTTAGATTCTCAAGATATTGAGAAAATTTTCCTTTCTCCATATAC
TTGCGCAGTTATTTTTCGTGAATTGTCAAATCTTAGTAAACACATCGTTT
GTCGTGTGTTATTTATTGACGAAACTGTGCGTAAGAGCCTTATAGCTTCA
TGGGTAAATAAAGATTATTCCTACATGTTAACAAAATCTCTTGAAGAACT
AAATGATTTGATTATATTTACAAGAGTCAGTAATGGACCTCAAGGTGAAT
GTATGCGCCTTAACAAAAAATTTCAAGAAAACCTCAAATATGCTCTTTTT
GGAGGAGAAACATGTACATTAGTCAAAGAATATAATGAATCGAATTTTAA
ATCAATTGCTTCGGATGTTTTAACCAAAAAAGCAATTGACAAATGGGAAT
CGGTTTTATCTTTAGTTGCTGGTATTATTCATAAAACATCGAACAATAAT
ATTGTTCGTAGTGTTATTGTGAATGCTGGTTACATCAAAAACGATGAAAT
TACAAATGAAGGATTTCAGTTTCTTTTATTACAAAAAAAGAAACAAGTTT
GGCAGTTTCTTATTTCTTATTTGGAATATATTAAGGAACCTTCAAGTATT
ATCGATATTCTACCGTTGCTATTCCAAATCGGTTGCGGATCAATTGATCA
AGTATATACTTGCACAACACCGACAAAGGCTCAACGCGAAATGTTGCAGC
ATTTTTTGGAATTCGGTTTCATCGTTTCTGAAACGGAACCGCATCTGGCA
TTCCATGTGACGCCGTTATTGGTCGATTTGCTGTCTGGCAATGATCGAAT
GTCACTAAAGGAAGGCCGTGACCAGTCTGCATCATCGATCATTAGCAGTT
TGGGATATATCATTATGGAATCAAGTGATCTCATATATGCTCACACAGAT
TCAAAATTACAAATTGCAGTCTTAGAAATGTTTTGCAAACTGCATAAACG
TTTCCCTTTCGCCGCTGCCTATCATATAACAGATCAATCGATTTTCAGGG
CGCTTGATAAAGGAATCACTTCAGATCAGATAATATCCTTTCTCATGAAC
AACGGCCATCCGGCAATGAAAGAAAAATCCGTTGTTCCGATCACGTTGGT
GGATAAAATCAAATTAGTGGAATTCAACCGCAACCGCACAAGGCCAGTTA
GTGGTTACATGTATCAAAATTTTACTAATCAATCTGAATTCGACACGCTC
GTCAATTTTGCTGAGCCTAAAAATGCGATTGCCTGGAAGAATCGCGAGAA
GCTCATGGTGATGGTATACGAAGACAGCCATATGATGATTCGTAAATTCT
GGAAAAATAGGAAGAATTCAGATTATCTTTGATGAAGAAATCTCTATGAT
CATTATAAATATAGCTCACCATTTAATCTTCAGATATTGTATTTTTATTT
GTTAATACACTTTCTATCGTGTTTTGTAAATTGTTGAATAATGATTCAAA
TTCCTCGAGTTTTCATATATTTATTAGCATGT
back to top

protein sequence of SMED30033635-orf-1

>SMED30033635-orf-1 ID=SMED30033635-orf-1|Name=SMED30033635-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MENFEKSLLLNFIKTLDSQDIEKIFLSPYTCAVIFRELSNLSKHIVCRVL
FIDETVRKSLIASWVNKDYSYMLTKSLEELNDLIIFTRVSNGPQGECMRL
NKKFQENLKYALFGGETCTLVKEYNESNFKSIASDVLTKKAIDKWESVLS
LVAGIIHKTSNNNIVRSVIVNAGYIKNDEITNEGFQFLLLQKKKQVWQFL
ISYLEYIKEPSSIIDILPLLFQIGCGSIDQVYTCTTPTKAQREMLQHFLE
FGFIVSETEPHLAFHVTPLLVDLLSGNDRMSLKEGRDQSASSIISSLGYI
IMESSDLIYAHTDSKLQIAVLEMFCKLHKRFPFAAAYHITDQSIFRALDK
GITSDQIISFLMNNGHPAMKEKSVVPITLVDKIKLVEFNRNRTRPVSGYM
YQNFTNQSEFDTLVNFAEPKNAIAWKNREKLMVMVYEDSHMMIRKFWKNR
KNSDYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001671ATPase activator activity
GO:0004003ATP-dependent DNA helicase activity
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0032781positive regulation of ATPase activity
GO:0006289nucleotide-excision repair
GO:0032508DNA duplex unwinding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR040662Tfb2_C
IPR004598TFIIH_p52/Tfb2
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0000439core TFIIH complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.70.2610coord: 377..454
e-value: 2.4E-16
score: 61.6
IPR004598Transcription factor TFIIH subunit p52/Tfb2PFAMPF03849Tfb2coord: 11..367
e-value: 2.7E-82
score: 276.6
IPR004598Transcription factor TFIIH subunit p52/Tfb2PANTHERPTHR13152TFIIH, POLYPEPTIDE 4coord: 3..450
IPR040662Transcription factor Tfb2, C-terminal domainPFAMPF18307Tfb2_Ccoord: 381..448
e-value: 2.3E-14
score: 53.5