MRP-S28 domain-containing protein

Overview
NameMRP-S28 domain-containing protein
Smed IDSMED30033632
Length (bp)1331
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MRP-S28 domain-containing protein (SMED30033632) t-SNE clustered cells

Violin plots show distribution of expression levels for MRP-S28 domain-containing protein (SMED30033632) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MRP-S28 domain-containing protein (SMED30033632) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MRP-S28 domain-containing protein (SMED30033632) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033632

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30033632h1SMcG0003632 dd_Smed_v4_3914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MRP-S28 domain-containing protein vs. Ensembl Human
Match: MRPS35 (mitochondrial ribosomal protein S35 [Source:HGNC Symbol;Acc:HGNC:16635])

HSP 1 Score: 178.718 bits (452), Expect = 7.214e-52
Identity = 94/210 (44.76%), Postives = 126/210 (60.00%), Query Frame = 2
Query:  470 KRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            K   PR   M  D+DW  ++P A  F  + VPLP+  G+ VK       V   + GN EL+KIPNFLHLTP+ I+KHC+ LK FCT+WP  L+ +     HFP+E    DY+ S P++R+ RARVV L+ +L +L L++    K  KL+G +RY   TD +TI  DRCP   QNYDY +Y+LT L  ES   E+WE    ++D   Y WE
Sbjct:   51 KALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKG-----VPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVG-ERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWE 254          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Human
Match: MRPS35 (mitochondrial ribosomal protein S35 [Source:HGNC Symbol;Acc:HGNC:16635])

HSP 1 Score: 120.939 bits (302), Expect = 1.398e-31
Identity = 61/137 (44.53%), Postives = 82/137 (59.85%), Query Frame = 2
Query:  470 KRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQL 874
            K   PR   M  D+DW  ++P A  F  + VPLP+  G+ VK       V   + GN EL+KIPNFLHLTP+ I+KHC+ LK FCT+WP  L+ +     HFP+E    DY+ S P++R+ RARVV L+   K  +L
Sbjct:   51 KALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKG-----VPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVPFKEAEL 182          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Human
Match: MRPS35 (mitochondrial ribosomal protein S35 [Source:HGNC Symbol;Acc:HGNC:16635])

HSP 1 Score: 117.087 bits (292), Expect = 1.508e-30
Identity = 57/128 (44.53%), Postives = 77/128 (60.16%), Query Frame = 2
Query:  470 KRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLK 850
            K   PR   M  D+DW  ++P A  F  + VPLP+  G+         V   + GN EL+KIPNFLHLTP+ I+KHC+ LK FCT+WP  L+ +     HFP+E    DY+ S P++R+ RARVV L+
Sbjct:   37 KALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKG----VPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLR 160          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Celegans
Match: mrps-35 (Mitochondrial Ribosomal Protein, Small [Source:UniProtKB/TrEMBL;Acc:D4YWC8])

HSP 1 Score: 169.474 bits (428), Expect = 2.790e-48
Identity = 84/183 (45.90%), Postives = 117/183 (63.93%), Query Frame = 2
Query:  509 EDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKEL--NNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWE 1051
            + W D+WP+AR+F  + VPLP+  G   N  + +  K  + GN EL+KIPNFLHLTP  I++HC+ +K+FCT +P EL  N +AT  H P+      YIH   +IRDIR+RVVT+K  +  L+L+E +  K  + L A RYD +T  +TI+ DRC    QN DY  Y+LT L  E++K EKW+
Sbjct:  103 QKWCDVWPAARTFASSVVPLPVRMGTRPNVEKRAPFK--KEGNLELVKIPNFLHLTPPAIQQHCQAIKKFCTPFPPELLSNPSATCQHLPISIEYSTYIHQGTSIRDIRSRVVTMKIHVAELKLSENQMEKLIR-LAANRYDEKTGKMTIITDRCHTRQQNLDYAHYLLTVLYHEAQKVEKWD 282          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Celegans
Match: mrps-35 (Mitochondrial Ribosomal Protein, Small [Source:UniProtKB/TrEMBL;Acc:D4YWC8])

HSP 1 Score: 58.151 bits (139), Expect = 5.766e-10
Identity = 29/69 (42.03%), Postives = 42/69 (60.87%), Query Frame = 2
Query:  845 LKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWE 1051
            +K  +  L+L+E +  K  +L  A RYD +T  +TI+ DRC    QN DY  Y+LT L  E++K EKW+
Sbjct:    1 MKIHVAELKLSENQMEKLIRL-AANRYDEKTGKMTIITDRCHTRQQNLDYAHYLLTVLYHEAQKVEKWD 68          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Fly
Match: mRpS35 (gene:FBgn0035374 transcript:FBtr0301626)

HSP 1 Score: 190.274 bits (482), Expect = 1.421e-56
Identity = 98/208 (47.12%), Postives = 125/208 (60.10%), Query Frame = 2
Query:  476 TSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAAT-RYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK 1096
            T PR   M  D+DWT +WP  RSF   +VPLPL QGF    +E     P ++ NAELMKIPNFLHLTP  I + C+ +K+FCT WPK L   A  + HFPLE    DY  S P IR+  AR VT+  +L +L+ +     KF +L+G  RY+ +TD VT V DRCP   QNYDY +Y+LTA   ES   E WE    ++D   Y +E+
Sbjct:   65 TPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQGF----TERGAAAPSKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWPKGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARDKFLRLVG-DRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEPWEATKSEADMEVYLFER 267          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Zebrafish
Match: mrps35 (mitochondrial ribosomal protein S35 [Source:NCBI gene;Acc:503880])

HSP 1 Score: 176.407 bits (446), Expect = 4.584e-51
Identity = 94/211 (44.55%), Postives = 127/211 (60.19%), Query Frame = 2
Query:  482 PRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEKK*IQR 1111
            PR   M  D+DWT ++P+A SF  + VPLP+  G+  N      V P ++GN EL+KIPNFLHLTP  I+KHC+ LK F T+WP  L+ +     HFP++    D++ S  ++R+  AR+VTLK +  +L L++    K  KL   KRY  ETDT+TI  D CP   QNYDY +Y+LT L  ES K E WE E   +D   Y+W+    QR
Sbjct:   68 PRTERMAVDQDWTAVYPTAASFKPSAVPLPVRMGYPVNRG----VPPAKHGNLELIKIPNFLHLTPAAIKKHCEALKPFLTEWPSALDSDEKCTEHFPIQVQSKDFVSSGLSLRNPDARIVTLKVKHSSLNLDDHARKKMIKL-AEKRYCKETDTLTITTDSCPLRQQNYDYAMYLLTVLYHESWKSEAWEQEKTRADMEEYEWQDSPSQR 273          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Xenopus
Match: mrps35 (mitochondrial ribosomal protein S35 [Source:NCBI gene;Acc:548768])

HSP 1 Score: 183.726 bits (465), Expect = 1.028e-53
Identity = 94/218 (43.12%), Postives = 137/218 (62.84%), Query Frame = 2
Query:  452 RERKIFKRTS--PRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            +++ +F+R +  PR   M  D+DW  ++P+A  F  + VPLP+  G+ VK       V P++ GN EL+KIPNFLHLTP+ I+ HC  LK FCT+WP  L+ +     +FP+ F  +DY+ + P++R+ +ARVV+++ +L +L L++    K  KL G  RYD+ TDT+T+  DRCP   QN DY +Y+LT L  ES K E WE E  +SD   Y WE
Sbjct:   50 QQKNLFRREAAPPRTEKMLPDQDWCSVYPTAAPFKPSAVPLPVRMGYPVKRG-----VPPEKTGNLELIKIPNFLHLTPVAIKNHCAALKEFCTQWPSALSSDELCEKNFPINFQTLDYVSAGPSLRNPKARVVSMQVKLSSLNLDDHSRKKLIKLAGP-RYDSTTDTLTLRSDRCPVRRQNRDYTLYLLTVLYHESWKTEAWESEKEESDMEAYVWE 261          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Mouse
Match: Mrps35 (mitochondrial ribosomal protein S35 [Source:MGI Symbol;Acc:MGI:2385255])

HSP 1 Score: 174.866 bits (442), Expect = 1.716e-50
Identity = 95/225 (42.22%), Postives = 127/225 (56.44%), Query Frame = 2
Query:  428 STKKKAEPRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK 1096
            +  +   P  RK      PR   M  D+DW  ++P+A  F  + VPLP+  G+ VK       V   + GN EL+KIPNFLHLTP+ I++HC  LK FCT+WP  L+ +     HFP+E    DY+ S P+IR+ +AR VTL+ +L +L L+     K  KL+G +RY   TD +TI  DRCP   QN DY +Y+LT L  ES K E WE    + D   Y W K
Sbjct:   37 TASRSERPMRRKAL---PPRTEKMDTDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKG-----VPMAKEGNLELLKIPNFLHLTPVAIKRHCAALKDFCTEWPAALDSDEKCEEHFPVEIDTADYVSSGPSIRNPKARAVTLRVKLSSLNLDNHAKKKLIKLVG-ERYCKATDVLTITTDRCPLKRQNCDYAVYLLTVLYHESWKTEDWENSKTEEDMDEYVWAK 252          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Mouse
Match: Mrps35 (mitochondrial ribosomal protein S35 [Source:MGI Symbol;Acc:MGI:2385255])

HSP 1 Score: 79.7221 bits (195), Expect = 5.187e-18
Identity = 38/86 (44.19%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  470 KRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTK 727
            K   PR   M  D+DW  ++P+A  F  + VPLP+  G+         V   + GN EL+KIPNFLHLTP+ I++HC  LK FCT+
Sbjct:    4 KALPPRTEKMDTDQDWPSVYPTAAPFKPSAVPLPVRMGY----PVKKGVPMAKEGNLELLKIPNFLHLTPVAIKRHCAALKDFCTE 85          
BLAST of MRP-S28 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2YDF6|RT35_BOVIN (28S ribosomal protein S35, mitochondrial OS=Bos taurus OX=9913 GN=MRPS35 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.522e-51
Identity = 98/224 (43.75%), Postives = 135/224 (60.27%), Query Frame = 2
Query:  428 STKKKAEPRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            ++K +  PR + +     PR   M  D+DW  ++P A  F  + VPLP+  G+ VK       V   + GN EL+KIPNFLHLTP+ I+KHC+ LK FCT+WP  L+ +     HFP+E    DYI S P+IR+ +ARVVTL+ +L +L L++    K  KL+G  RY   TD +TI  DRCP   QNYDY +Y+LT L  ES K E+WE +  ++D   Y W+
Sbjct:   43 TSKHERAPRRKAL----PPRTEKMSVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKRG-----VPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDTADYISSGPSIRNPKARVVTLRVKLSSLNLDDHAKKKLIKLVG-DRYCKSTDVLTIKTDRCPLKRQNYDYAMYLLTVLYHESWKTEEWEKKKTEADMEEYVWK 256          
BLAST of MRP-S28 domain-containing protein vs. UniProt/SwissProt
Match: sp|P82673|RT35_HUMAN (28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.464e-51
Identity = 94/210 (44.76%), Postives = 126/210 (60.00%), Query Frame = 2
Query:  470 KRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            K   PR   M  D+DW  ++P A  F  + VPLP+  G+ VK       V   + GN EL+KIPNFLHLTP+ I+KHC+ LK FCT+WP  L+ +     HFP+E    DY+ S P++R+ RARVV L+ +L +L L++    K  KL+G +RY   TD +TI  DRCP   QNYDY +Y+LT L  ES   E+WE    ++D   Y WE
Sbjct:   51 KALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKG-----VPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVG-ERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWE 254          
BLAST of MRP-S28 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BJZ4|RT35_MOUSE (28S ribosomal protein S35, mitochondrial OS=Mus musculus OX=10090 GN=Mrps35 PE=1 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 6.764e-51
Identity = 96/225 (42.67%), Postives = 128/225 (56.89%), Query Frame = 2
Query:  428 STKKKAEPRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK 1096
            +  +   P  RK      PR   M  D+DW  ++P+A  F  + VPLP+  G+ VK       V   + GN EL+KIPNFLHLTP+ I++HC  LK FCT+WP  L+ +     HFP+E    DY+ S P+IR+ +AR VTL+ +L +L L+     K  KL+G +RY   TD +TI  DRCP   QNYDY +Y+LT L  ES K E WE    + D   Y W K
Sbjct:   37 TASRSERPMRRKAL---PPRTEKMDTDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKG-----VPMAKEGNLELLKIPNFLHLTPVAIKRHCAALKDFCTEWPAALDSDEKCEEHFPVEIDTADYVSSGPSIRNPKARAVTLRVKLSSLNLDNHAKKKLIKLVG-ERYCKATDVLTITTDRCPLKRQNYDYAVYLLTVLYHESWKTEDWENSKTEEDMDEYVWAK 252          
BLAST of MRP-S28 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q498P2|RT35_DANRE (28S ribosomal protein S35, mitochondrial OS=Danio rerio OX=7955 GN=mrps35 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.408e-50
Identity = 94/211 (44.55%), Postives = 127/211 (60.19%), Query Frame = 2
Query:  482 PRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEKK*IQR 1111
            PR   M  D+DWT ++P+A SF  + VPLP+  G+  N      V P ++GN EL+KIPNFLHLTP  I+KHC+ LK F T+WP  L+ +     HFP++    D++ S  ++R+  AR+VTLK +  +L L++    K  KL   KRY  ETDT+TI  D CP   QNYDY +Y+LT L  ES K E WE E   +D   Y+W+    QR
Sbjct:   68 PRTERMAVDQDWTAVYPTAASFKPSAVPLPVRMGYPVNRG----VPPAKHGNLELIKIPNFLHLTPATIKKHCEALKPFLTEWPSALDSDEKCTEHFPIQVQSKDFVSSGLSLRNPDARIVTLKVKHSSLNLDDHARKKMIKL-AEKRYCKETDTLTITTDSCPLRQQNYDYAMYLLTVLYHESWKSEAWEQEKTRADMEEYEWQDSPSQR 273          
BLAST of MRP-S28 domain-containing protein vs. TrEMBL
Match: F2E1E6 (Predicted protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 7.862e-64
Identity = 104/222 (46.85%), Postives = 149/222 (67.12%), Query Frame = 2
Query:  434 KKKAEPRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK 1096
            KK+A+P+ +++     PRYL M  D+DWT++WP+A SF ++ VPLP+ QG+V +  EN  +  ++Y NAELMKIPNF HLTP HI+KHC  +K+FCT WP++L+ + A  Y+ P++    DY++S+P+IRD RAR+V   F+L  L+ +E    KF +L G K Y+ + D +T+  D+CP   QNYDY  Y+LTAL  ES K E WE E    DW  Y W++
Sbjct:   57 KKRAKPQYKEVL---PPRYLRMSTDQDWTNVWPTATSFKYSVVPLPITQGYVASDKENKGLPMEKYANAELMKIPNFFHLTPNHIKKHCAAIKKFCTPWPEQLDSDEACDYYLPIKITTYDYLNSTPSIRDSRARIVKFNFKLDQLRFDEHARDKFVRLAGDK-YNADRDELTLTADKCPYRKQNYDYAQYLLTALYFESWKTESWEQERTKYDWQRYFWDE 274          
BLAST of MRP-S28 domain-containing protein vs. TrEMBL
Match: A0A1S3D3N4 (28S ribosomal protein S35, mitochondrial OS=Diaphorina citri OX=121845 GN=LOC103510776 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 3.480e-63
Identity = 112/224 (50.00%), Postives = 145/224 (64.73%), Query Frame = 2
Query:  425 ASTKKKAEPRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNN-AATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            + T+K+ E R+ K FK   PRYL M  D+DWT +WP  R+F    VPLPL QG+ K       V   ++GNAELMK+PNFLHLTP  I+KHC  +++FCT WP+ L        HFP+  I  DY HSSP IRDI+AR+VT+K +L  L+L++    KF +L+G  RY+ +TD +TIV DRCP   QNYDY +YVLTAL  ES  FE+WE E    D   Y+W+
Sbjct:   59 SVTEKRQERRKLK-FKAQPPRYLKMPVDQDWTSVWPGPRTFHPAVVPLPLRQGYDKKR-----VAQGKFGNAELMKVPNFLHLTPPAIKKHCDAIRKFCTPWPQGLETEMQMEKHFPITVITSDYCHSSPTIRDIKARIVTIKLKLSTLELDDHARDKFLRLVG-DRYNPKTDVLTIVTDRCPMKKQNYDYCMYVLTALFHESWTFEEWEKEKSTLDMEYYEWK 275          
BLAST of MRP-S28 domain-containing protein vs. TrEMBL
Match: U4U7S8 (MRP-S28 domain-containing protein OS=Dendroctonus ponderosae OX=77166 GN=D910_01661 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 4.590e-63
Identity = 111/216 (51.39%), Postives = 139/216 (64.35%), Query Frame = 2
Query:  449 PRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNA-ATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            PR+  +F   +PR   M  D+DW  +WP  RSF   +VPLP+ QGF    +E     P +Y NAELMKIPNFLHLTP  I++ C+ LK+FCT WP  L++A   + HFPLE    DY HSSP+IRD  AR+VTL+F+L +L L  R   KF +L+G K Y  +TDTVTIV DRCP   QN DY +Y+LTAL  ESKK E WE    ++D   Y WE
Sbjct:   50 PRKTPVF---APRTTQMAVDQDWGSVWPGPRSFHPASVPLPVRQGF----TEKGAPIPDKYANAELMKIPNFLHLTPPVIKRQCEALKKFCTPWPAALDSAEKIQQHFPLEITSSDYCHSSPSIRDPMARIVTLRFKLSSLHLESRAKDKFLRLVGDK-YVKDTDTVTIVTDRCPLRKQNLDYAMYLLTALYHESKKVEPWEELKSEADMETYIWE 257          
BLAST of MRP-S28 domain-containing protein vs. TrEMBL
Match: J3JTF0 (MRP-S28 domain-containing protein OS=Dendroctonus ponderosae OX=77166 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 5.331e-63
Identity = 111/216 (51.39%), Postives = 139/216 (64.35%), Query Frame = 2
Query:  449 PRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNA-ATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            PR+  +F   +PR   M  D+DW  +WP  RSF   +VPLP+ QGF    +E     P +Y NAELMKIPNFLHLTP  I++ C+ LK+FCT WP  L++A   + HFPLE    DY HSSP+IRD  AR+VTL+F+L +L L  R   KF +L+G K Y  +TDTVTIV DRCP   QN DY +Y+LTAL  ESKK E WE    ++D   Y WE
Sbjct:   50 PRKTPVF---APRTTQMAVDQDWGSVWPGPRSFHPASVPLPVRQGF----TEKGAPIPDKYANAELMKIPNFLHLTPPVIKRQCEALKKFCTPWPAALDSAEKIQQHFPLEITSSDYCHSSPSIRDPMARIVTLRFKLSSLHLESRAKDKFLRLVGDK-YVKDTDTVTIVTDRCPLRKQNLDYAMYLLTALYHESKKVEPWEELKSEADMETYIWE 257          
BLAST of MRP-S28 domain-containing protein vs. TrEMBL
Match: A0A293LRG5 (MRP-S28 domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.026e-62
Identity = 111/222 (50.00%), Postives = 142/222 (63.96%), Query Frame = 2
Query:  431 TKKKAEPRERKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKEL-NNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
             KK+ +PRE ++   ++PRY  M  D+DWT +WP+A+SF  + VPLPL QG+ +  +      P ++ N ELMKIPNFLHLTP HIEKHCKELK+FCT+WP  L  +     HFP+E    DY HSSP IRD+RAR+VTLK +L  L  +     K  +L+G  RYD  TD +TIV DRCP   QNYDY+ Y+L AL  E    E WE E  +SD   + WE
Sbjct:   32 AKKRFKPREMQV-NVSAPRYTRMPIDQDWTSVWPTAQSFRPSVVPLPLRQGYREKGA-----PPGKFANLELMKIPNFLHLTPPHIEKHCKELKKFCTQWPAGLETDKECAEHFPIEVTTSDYCHSSPTIRDVRARIVTLKVKLSKLNFDYHAKDKLLRLVG-DRYDPSTDILTIVTDRCPLKKQNYDYVHYLLAALYHECWTIEPWESEKAESDMECFIWE 246          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Cavefish
Match: mrps35 (mitochondrial ribosomal protein S35 [Source:NCBI gene;Acc:103024867])

HSP 1 Score: 179.874 bits (455), Expect = 4.612e-52
Identity = 95/214 (44.39%), Postives = 131/214 (61.21%), Query Frame = 2
Query:  458 RKIFKRTSPRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELN-NAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            R+I +   PR   M  D+DWT ++P+A SF  + VPLP+  G+ VK       V P + GN EL+KIPNFLHLTP  I+K C+ LK FCT+WP  L+ +     HFP++  + DY+ + P++R   AR+VTL  +L +L L++    K  KL G +RY+ +TDT+TI  D CP   QN+DY +Y+LT L  ES K E WE E   +D   Y WE
Sbjct:   82 RQIKQVLQPRTERMAVDQDWTAVYPTAASFKADAVPLPVRMGYPVKKG-----VPPSKKGNLELLKIPNFLHLTPNAIKKQCEALKPFCTEWPAALDSDEKCEKHFPIQVQKKDYVFAGPSLRHPDARIVTLTVKLSSLNLDDHARKKMIKLSG-ERYNKDTDTLTITADSCPLKQQNHDYAMYMLTVLYHESWKIEAWEKEKTRADMEEYVWE 289          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000516.1 (pep scaffold:Pmarinus_7.0:GL487058:7246:8462:1 gene:ENSPMAG00000000467.1 transcript:ENSPMAT00000000516.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 1.354e-8
Identity = 25/50 (50.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query:  962 RCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEKK*IQR 1111
            RCP   QN+DY +Y+LT L  ES K E WE E  D+D   Y WEK   +R
Sbjct:    1 RCPVRKQNHDYAMYLLTILYYESCKVEPWEAEKTDADQEEYVWEKSPSER 50          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Yeast
Match: RSM24 (Mitochondrial ribosomal protein of the small subunit [Source:SGD;Acc:S000002582])

HSP 1 Score: 47.3654 bits (111), Expect = 2.152e-6
Identity = 29/81 (35.80%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  830 ARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSD 1072
            +R V L  + K L L E+  HKF ++L   RYD+ TD   +  D+    +QN  YL  +L  L AESK   + +  D   D
Sbjct:  197 SRKVVLSVKTKELGLEEKSLHKF-RILARSRYDHTTDIFKMSSDKFEHASQNARYLHDILQRLLAESKDLTEDDFSDVPLD 276          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Nematostella
Match: EDO38413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD14])

HSP 1 Score: 124.79 bits (312), Expect = 2.355e-33
Identity = 66/182 (36.26%), Postives = 107/182 (58.79%), Query Frame = 2
Query:  512 DWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELE 1057
            DW  ++   ++++   +P+ L  G  K+   ++F + +   N ELMKIPNF HL+P  IE+HC+ LK  C  WPK+L+ +      PL  I  +Y+ + P++    ++ V L+  LK+L L++    K  +L+G +RY+   D++TI+ DRCP   QN DY +Y++T L  E+ K E WE E
Sbjct:    7 DWPSVFSGPQTYNPAIIPVFLRMGRRKHNRLDNFPQ-RTMANLELMKIPNFFHLSPPAIERHCQALKPLCKPWPKDLDPSLR----PLRVITRNYLFAGPSLHHPGSKKVKLQVFLKDLILDDHARTKLIELVG-ERYNPVDDSLTIITDRCPTRQQNKDYALYLMTVLYNEAWKIEPWETE 182          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Nematostella
Match: EDO30147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1L7])

HSP 1 Score: 126.331 bits (316), Expect = 4.511e-33
Identity = 72/201 (35.82%), Postives = 115/201 (57.21%), Query Frame = 2
Query:  485 RYLGMKGDE-DWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELED----CDSD 1072
            R + MK +  DW  ++   ++++   +P+ L  G  K+   ++F + +   N ELMKIPNF HL+P  IE+HC+ LK  C  WPK+L+ +      PL  I  +Y+ + P++    ++ V L+  LK+L L++    K  +L+G +RY+   D++TIV DRCP   QN DY +Y++T L  E+ K E WE E     CD +
Sbjct:   80 RAVTMKPESTDWPSVFSGPQTYNPAIIPVFLRMGRRKHNRLDNFPQ-RTMANLELMKIPNFFHLSPPAIERHCQALKPLCKPWPKDLDPSLR----PLRVITRNYLFAGPSLHHPGSKKVKLQVFLKDLILDDHARTKLIELVG-ERYNPVDDSLTIVTDRCPTRQQNNDYALYLMTVLYNEAWKIEPWETEASNEICDDE 274          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Nematostella
Match: EDO49697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG12])

HSP 1 Score: 58.5362 bits (140), Expect = 4.225e-9
Identity = 28/76 (36.84%), Postives = 45/76 (59.21%), Query Frame = -1
Query:   45 EFEQKHRPLELFDHLPPLSSNTEVYSDRPKLIGKGPWTFAQPFRDKKNFKTLSSSIAENYSPFVAGMVKNPNYFTH 272
            E E K RP  +FDHLPPL+     YS++P+++  G +T A P ++K++++  S S+A NY+P    +     Y  H
Sbjct:   11 ECETKKRP-AMFDHLPPLTVPQPAYSEKPRIVEYGAYTKAAPVKEKQHYRYASDSVANNYTPSAQTLTTKLIYKKH 85          
BLAST of MRP-S28 domain-containing protein vs. Ensembl Medaka
Match: mrps35 (mitochondrial ribosomal protein S35 [Source:NCBI gene;Acc:101155924])

HSP 1 Score: 173.711 bits (439), Expect = 4.040e-50
Identity = 92/206 (44.66%), Postives = 124/206 (60.19%), Query Frame = 2
Query:  482 PRYLGMKGDEDWTDIWPSARSFDFNTVPLPLNQGF-VKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNN-AATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWE 1093
            PR   M  D+DWT ++P+A  F  N+VPLP+  G+ VK       V P + GN EL+KIPNFLHLTP  I+KHC+ LK FCT+WP  L+        FP++    D++ + P+IR+  AR+V L  +L +L L++    K  KL+G +RY  +TD +TI  D CP   QNYDY +Y+LT L  ES K E WE E   +D   Y WE
Sbjct:   66 PRTEKMAMDQDWTAVYPAATPFRPNSVPLPVRMGYPVKGG-----VPPHKKGNLELIKIPNFLHLTPAAIKKHCEALKPFCTEWPSALDTEPKCDQQFPVKVESRDFVSAGPSIRNPAARIVQLSIKLSSLNLDDHARKKMLKLVG-ERYCRDTDVLTIRADSCPLRQQNYDYAMYLLTVLYHESWKKEPWEAEKTVADMEEYMWE 265          
BLAST of MRP-S28 domain-containing protein vs. Planmine SMEST
Match: SMESG000042964.1 (SMESG000042964.1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.418e-147
Identity = 198/200 (99.00%), Postives = 198/200 (99.00%), Query Frame = 2
Query:  497 MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK 1096
            MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEF QVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALT ESKKFEKWELEDCDSDWINYKWEK
Sbjct:    1 MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFTQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTTESKKFEKWELEDCDSDWINYKWEK 200          

HSP 2 Score: 123.25 bits (308), Expect = 1.418e-147
Identity = 68/84 (80.95%), Postives = 68/84 (80.95%), Query Frame = 3
Query: 1095 KSKFKENAKLYCEKAN----------------IDFENLTNHKEIKHKLKNAVENIYNKKESNKVWENYKDAVLELMQLKTSSVV 1298
            KSKFKENAKLYCEKAN                IDFENLTNHKEIKHKLKNAVENIYNKKESNKVWENYKDAVLELMQLKTSSVV
Sbjct:  200 KSKFKENAKLYCEKANVILIYLMRYRVDKFIQIDFENLTNHKEIKHKLKNAVENIYNKKESNKVWENYKDAVLELMQLKTSSVV 283          
BLAST of MRP-S28 domain-containing protein vs. Planmine SMEST
Match: SMESG000007378.1 (SMESG000007378.1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.418e-147
Identity = 198/200 (99.00%), Postives = 198/200 (99.00%), Query Frame = 2
Query:  497 MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK 1096
            MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEF QVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALT ESKKFEKWELEDCDSDWINYKWEK
Sbjct:    1 MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFTQVDYIHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTVTIVGDRCPAHNQNYDYLIYVLTALTTESKKFEKWELEDCDSDWINYKWEK 200          

HSP 2 Score: 123.25 bits (308), Expect = 1.418e-147
Identity = 68/84 (80.95%), Postives = 68/84 (80.95%), Query Frame = 3
Query: 1095 KSKFKENAKLYCEKAN----------------IDFENLTNHKEIKHKLKNAVENIYNKKESNKVWENYKDAVLELMQLKTSSVV 1298
            KSKFKENAKLYCEKAN                IDFENLTNHKEIKHKLKNAVENIYNKKESNKVWENYKDAVLELMQLKTSSVV
Sbjct:  200 KSKFKENAKLYCEKANVILIYLMRYRVDKFIQIDFENLTNHKEIKHKLKNAVENIYNKKESNKVWENYKDAVLELMQLKTSSVV 283          
BLAST of MRP-S28 domain-containing protein vs. Planmine SMEST
Match: SMESG000042964.1 (SMESG000042964.1)

HSP 1 Score: 249.98 bits (637), Expect = 1.627e-82
Identity = 117/118 (99.15%), Postives = 117/118 (99.15%), Query Frame = 2
Query:  497 MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFIQVDYIHSSPNIRDIRARVVTLK 850
            MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEF QVDYIHSSPNIRDIRARVVTLK
Sbjct:    1 MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAELMKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFTQVDYIHSSPNIRDIRARVVTLK 118          
BLAST of MRP-S28 domain-containing protein vs. Planmine SMEST
Match: SMESG000013731.1 (SMESG000013731.1)

HSP 1 Score: 212.616 bits (540), Expect = 1.908e-63
Identity = 101/102 (99.02%), Postives = 101/102 (99.02%), Query Frame = -1
Query:    3 LKYDNIKIGVLNEFEQKHRPLELFDHLPPLSSNTEVYSDRPKLIGKGPWTFAQPFRDKKNFKTLSSSIAENYSPFVAGMVKNPNYFTHSSQLEPSSINSKRL 308
            LKYDNIKIGVLNEFEQKHRPLELFDHLPPLSSNTEVYSDRPKLIGKGPWTFAQPFRDKKNFKTLSSSIAENYSPFVAGMVKNPNYFTHSSQLEPSSI SKRL
Sbjct:   11 LKYDNIKIGVLNEFEQKHRPLELFDHLPPLSSNTEVYSDRPKLIGKGPWTFAQPFRDKKNFKTLSSSIAENYSPFVAGMVKNPNYFTHSSQLEPSSIKSKRL 112          
The following BLAST results are available for this feature:
BLAST of MRP-S28 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MRPS357.214e-5244.76mitochondrial ribosomal protein S35 [Source:HGNC S... [more]
MRPS351.398e-3144.53mitochondrial ribosomal protein S35 [Source:HGNC S... [more]
MRPS351.508e-3044.53mitochondrial ribosomal protein S35 [Source:HGNC S... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrps-352.790e-4845.90Mitochondrial Ribosomal Protein, Small [Source:Un... [more]
mrps-355.766e-1042.03Mitochondrial Ribosomal Protein, Small [Source:Un... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpS351.421e-5647.12gene:FBgn0035374 transcript:FBtr0301626[more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps354.584e-5144.55mitochondrial ribosomal protein S35 [Source:NCBI g... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps351.028e-5343.12mitochondrial ribosomal protein S35 [Source:NCBI g... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mrps351.716e-5042.22mitochondrial ribosomal protein S35 [Source:MGI Sy... [more]
Mrps355.187e-1844.19mitochondrial ribosomal protein S35 [Source:MGI Sy... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q2YDF6|RT35_BOVIN1.522e-5143.7528S ribosomal protein S35, mitochondrial OS=Bos ta... [more]
sp|P82673|RT35_HUMAN3.464e-5144.7628S ribosomal protein S35, mitochondrial OS=Homo s... [more]
sp|Q8BJZ4|RT35_MOUSE6.764e-5142.6728S ribosomal protein S35, mitochondrial OS=Mus mu... [more]
sp|Q498P2|RT35_DANRE4.408e-5044.5528S ribosomal protein S35, mitochondrial OS=Danio ... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F2E1E67.862e-6446.85Predicted protein OS=Hordeum vulgare subsp. vulgar... [more]
A0A1S3D3N43.480e-6350.0028S ribosomal protein S35, mitochondrial OS=Diapho... [more]
U4U7S84.590e-6351.39MRP-S28 domain-containing protein OS=Dendroctonus ... [more]
J3JTF05.331e-6351.39MRP-S28 domain-containing protein OS=Dendroctonus ... [more]
A0A293LRG51.026e-6250.00MRP-S28 domain-containing protein (Fragment) OS=Or... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps354.612e-5244.39mitochondrial ribosomal protein S35 [Source:NCBI g... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000516.11.354e-850.00pep scaffold:Pmarinus_7.0:GL487058:7246:8462:1 gen... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RSM242.152e-635.80Mitochondrial ribosomal protein of the small subun... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO384132.355e-3336.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301474.511e-3335.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496974.225e-936.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps354.040e-5044.66mitochondrial ribosomal protein S35 [Source:NCBI g... [more]
back to top
BLAST of MRP-S28 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000042964.11.418e-14799.00SMESG000042964.1[more]
SMESG000007378.11.418e-14799.00SMESG000007378.1[more]
SMESG000042964.11.627e-8299.15SMESG000042964.1[more]
SMESG000013731.11.908e-6399.02SMESG000013731.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033632 ID=SMED30033632|Name=MRP-S28 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1331bp
TTCAAACGTTTCGAGTTGATCGAACTGGGCTCTAACTGACTGGAATGTGT
GAAATAATTTGGATTTTTAACCATTCCCGCTACAAAAGGAGAATAGTTTT
CAGCGATAGAAGAACTCAATGTTTTGAAATTCTTTTTATCACGAAATGGT
TGAGCGAATGTCCATGGACCTTTGCCGATAAGTTTAGGTCTATCACTGTA
AACTTCCGTATTTGAACTTAAGGGGGGGAGATGATCAAATAATTCCAATG
GCCTGTGCTTTTGTTCAAATTCATTCAAAACGCCAATTTTAATATTGTCA
TATTTTAAAATTATAATGAAAAAATTATTTACGTTTTTCTGTCGTCCAGA
TTACATTTATAAATATATGAAATGTAAACATTATTGCACTGCACAAACTA
AATTCAAGCATTTAGTAATTATTGGCCTCAACGAAAAAAAAAGCTGAACC
GAGAGAAAGAAAGATTTTTAAACGTACTTCGCCTAGATATTTGGGAATGA
AAGGAGATGAAGATTGGACTGATATATGGCCATCTGCACGATCATTTGAT
TTTAACACAGTTCCATTGCCTTTAAACCAAGGATTTGTGAAAAATACAAG
TGAAAACAGTTTTGTTAAACCAAAACAATATGGTAACGCAGAATTAATGA
AAATTCCAAATTTTCTACATCTAACACCTATACATATAGAAAAGCATTGC
AAAGAATTAAAAAGATTTTGTACGAAATGGCCAAAGGAGTTGAATAATGC
TGCTACAAGATATCATTTCCCACTCGAATTTATACAGGTTGACTATATAC
ACAGCTCACCAAATATTAGAGATATTCGAGCTAGAGTTGTGACATTAAAA
TTTGAGTTAAAAAATTTGCAATTGAATGAGCGCGAATGCCACAAATTTCA
GAAGTTACTTGGAGCAAAACGATACGATAATGAAACAGATACCGTTACAA
TAGTCGGCGATAGATGTCCAGCACATAATCAAAATTACGATTATCTAATT
TATGTTCTTACGGCATTAACAGCTGAATCAAAGAAATTCGAGAAATGGGA
ATTGGAAGATTGTGACAGTGATTGGATAAATTACAAATGGGAAAAAAAGT
AAATTCAAAGAAAACGCTAAATTGTATTGCGAAAAAGCAAATATTGATTT
CGAAAACTTGACAAATCATAAAGAAATTAAACATAAATTGAAAAATGCTG
TTGAGAATATTTATAATAAAAAAGAGAGTAATAAAGTTTGGGAAAATTAC
AAAGACGCTGTATTGGAGCTGATGCAGTTGAAAACATCAAGCGTTGTTTG
ATATTCAAAATTAAATTTATAAAAATATTTT
back to top

protein sequence of SMED30033632-orf-1

>SMED30033632-orf-1 ID=SMED30033632-orf-1|Name=SMED30033632-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MKGDEDWTDIWPSARSFDFNTVPLPLNQGFVKNTSENSFVKPKQYGNAEL
MKIPNFLHLTPIHIEKHCKELKRFCTKWPKELNNAATRYHFPLEFIQVDY
IHSSPNIRDIRARVVTLKFELKNLQLNERECHKFQKLLGAKRYDNETDTV
TIVGDRCPAHNQNYDYLIYVLTALTAESKKFEKWELEDCDSDWINYKWEK
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0032543mitochondrial translation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR019349Ribosomal_S24/S35_mit