slc46a-4

Overview
Nameslc46a-4 (AKN21696.1)
Smed IDSMED30033628
Length (bp)1791
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc46a-4 (SMED30033628) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc46a-4 (SMED30033628) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033628

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30033628SMESG000065066.1 dd_Smed_v4_15244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc46a-4 vs. Ensembl Human
Match: SLC46A1 (solute carrier family 46 member 1 [Source:HGNC Symbol;Acc:HGNC:30521])

HSP 1 Score: 56.6102 bits (135), Expect = 9.252e-8
Identity = 101/463 (21.81%), Postives = 192/463 (41.47%), Query Frame = 1
Query:  373 CRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRI--------VCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEE-------------KLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKY-LNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIG-ISTLNHHLKLK 1692
            CR    VE L+FL     + +  +  Q+++H+    L +      G   N S     ++     V+ L+ ++ + +++G  +  LF+S      +   GRR L++ + +G  ++++    ++     +  F+    L  L G    L +  F+ +A+ S   +R  R+        V G++AS LG        G+ ++  G+  PF +A  + +    Y  FC  ++  E +              +L + P   +  + +  A   L+ F V+ + FG        A +IL    +S P+C +S  IGY  + + L       L    L +Y L +  V  I L+F +L  +   +A     ++  +G   LS    P I+  LSKL     Q  LF  +  +       +  +   LY  TL   +   +L+     G+  + ++LIG +   + HL+ +
Sbjct:   21 CRGP--VEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRSADPTMQE-----VETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLG--------GHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSRKHL--ALYSLAIFVVITVHFG--------AQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLT--SLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNFMKGFPFLL---GAGLLLIPAVLIGMLEKADPHLEFQ 453          
BLAST of slc46a-4 vs. Ensembl Human
Match: SLC46A1 (solute carrier family 46 member 1 [Source:HGNC Symbol;Acc:HGNC:30521])

HSP 1 Score: 50.0618 bits (118), Expect = 9.408e-6
Identity = 68/318 (21.38%), Postives = 134/318 (42.14%), Query Frame = 1
Query:  373 CRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRI--------VCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEE-------------KLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEIL 1263
            CR    VE L+FL     + +  +  Q+++H+    L +      G   N S     ++     V+ L+ ++ + +++G  +  LF+S      +   GRR L++ + +G  ++++    ++     +  F+    L  L G    L +  F+ +A+ S   +R  R+        V G++AS LG        G+ ++  G+  PF +A  + +    Y  FC  ++  E +              +L + P   +  + +  A   L+ F V+ + FG        A +IL    +S P+C +S  IGY  + + L
Sbjct:   21 CRGP--VEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRSADPTMQE-----VETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLG--------GHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSRKHL--ALYSLAIFVVITVHFG--------AQDILTLYELSTPLCWDSKLIGYGSAAQHL 313          
BLAST of slc46a-4 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 62.7734 bits (151), Expect = 5.723e-10
Identity = 85/390 (21.79%), Postives = 174/390 (44.62%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLAN-ASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKP-EIEEKLDLKPTILEFSEII---FSAKNILSSFTVVLLMFGFFYVG--ETAASEILYYIFMSYPICMNSIQIGY--SISLEILVLNIGLILSGTILNKYLNELVVILICLSF-GLL-FNIQMI---YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLF 1503
            ++++ +E ++ +Y         +++Q++Y ++ L +      VS N    + +++    + ++VQ  +  + M   L   I  L  +   +  + + GR+I II   IG  I ++    + F   +L   I    +  L GG   +   CFS +A+     + + LR+    +   + A + S+STGY +   GF  PF  + I  V  + Y IF LE+++  +  E L     +   +  I   F+  +   ++ +VLL+  F  +    T    I     ++ P+C   I +GY  + S  I +         + +  +L  L +  I ++F G+L   + M+   +AKT  ++++     + +   FP ++  +SK+ + + Q  LF
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYRRLWLEITNSTYPVSENTSQCAANSSNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEETRVIDRSETLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVGYGSAASTSIFIT--------SFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALF 383          
BLAST of slc46a-4 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 62.3882 bits (150), Expect = 6.920e-10
Identity = 85/390 (21.79%), Postives = 174/390 (44.62%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLAN-ASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKP-EIEEKLDLKPTILEFSEII---FSAKNILSSFTVVLLMFGFFYVG--ETAASEILYYIFMSYPICMNSIQIGY--SISLEILVLNIGLILSGTILNKYLNELVVILICLSF-GLL-FNIQMI---YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLF 1503
            ++++ +E ++ +Y         +++Q++Y ++ L +      VS N    + +++    + ++VQ  +  + M   L   I  L  +   +  + + GR+I II   IG  I ++    + F   +L   I    +  L GG   +   CFS +A+     + + LR+    +   + A + S+STGY +   GF  PF  + I  V  + Y IF LE+++  +  E L     +   +  I   F+  +   ++ +VLL+  F  +    T    I     ++ P+C   I +GY  + S  I +         + +  +L  L +  I ++F G+L   + M+   +AKT  ++++     + +   FP ++  +SK+ + + Q  LF
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYRRLWLEITNSTYPVSENTSQCAANSSNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEETRVIDRSETLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVGYGSAASTSIFIT--------SFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALF 383          
BLAST of slc46a-4 vs. Ensembl Zebrafish
Match: SLC46A3 (si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-361])

HSP 1 Score: 62.3882 bits (150), Expect = 6.920e-10
Identity = 85/390 (21.79%), Postives = 174/390 (44.62%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLAN-ASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKP-EIEEKLDLKPTILEFSEII---FSAKNILSSFTVVLLMFGFFYVG--ETAASEILYYIFMSYPICMNSIQIGY--SISLEILVLNIGLILSGTILNKYLNELVVILICLSF-GLL-FNIQMI---YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLF 1503
            ++++ +E ++ +Y         +++Q++Y ++ L +      VS N    + +++    + ++VQ  +  + M   L   I  L  +   +  + + GR+I II   IG  I ++    + F   +L   I    +  L GG   +   CFS +A+     + + LR+    +   + A + S+STGY +   GF  PF  + I  V  + Y IF LE+++  +  E L     +   +  I   F+  +   ++ +VLL+  F  +    T    I     ++ P+C   I +GY  + S  I +         + +  +L  L +  I ++F G+L   + M+   +AKT  ++++     + +   FP ++  +SK+ + + Q  LF
Sbjct:    2 KRLYFIEPVVAIYAFASFMLYPLIQQYVYRRLWLEITNSTYPVSENTSQCAANSSNHTSRQEEVQKAASLFSMYTDLSSMIPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGTMLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEETRVIDRSETLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVGYGSAASTSIFIT--------SFVGVFLFSLCLPNIAIAFIGMLSVAVSMLMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALF 383          
BLAST of slc46a-4 vs. Ensembl Zebrafish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 56.225 bits (134), Expect = 7.341e-8
Identity = 88/428 (20.56%), Postives = 186/428 (43.46%), Query Frame = 1
Query:  442 VMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLAN--------ASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEK-----------SKPEIEEKLDLKP-----TILEFSEIIFSAKNILSSFTVVLLM--FGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLS 1647
            +++Q++Y ++   L  F    +  + ++  SN +       VQ  +  +++   L F I  L ++   +  +   GR++ I+   +G  + ++   L+   ++SL+  +    + GL GG   L   CF+ +A+           V    L ++ GV+       + S+ TG+ IK  GF  PF+ A  + +  + Y +  L++           S P   E   L+      T L+   ++F+A N   +  ++L++  F FF +       I     ++ P+C + + +GY  +L   +  +       +L++ L +  +IL+ L       I   +AKT   +++     +LS    P ++  +SK+ + + Q  +F  +  +E+    +S +V   +Y  T           L+ F+G +F+L+
Sbjct:   24 LLQQYVYRRLWFELSGFI--YTSESLSHCSSNHSYITLHQAVQKETSLFLLHSELCFLIPSLISALLLVSYSDYCGRKVAIVPPLVGEALHALSYVLVSRFSFSLNYLLASSFMSGLMGGPPTLIGGCFAYVADLCGEDLEGQKTVRMARLDMILGVLT-----GLASLCTGFFIKAAGFTWPFLTAVFLHLINLLYVLVVLKESLVLPNSAVSTSSPSASEAPRLRQTQALTTRLQGVYLLFAASNRRRNVVLLLMLAAFAFFKLALQGGWSIFILYELNTPLCWSEVFVGYGSALSTAIYLVSFA-GVALLSRCLPDAYIILLGLMSVAAGLIMAAFAKTTLLMFLVRLPLLLSIMPTPVLRSMMSKIVSGSEQGAMFACVAFVEMLSVGVSFTVFNSIYAAT-----------LSWFSGFSFLLA 432          
BLAST of slc46a-4 vs. Ensembl Xenopus
Match: slc46a1 (solute carrier family 46 (folate transporter), member 1 [Source:NCBI gene;Acc:100145771])

HSP 1 Score: 72.7886 bits (177), Expect = 6.174e-13
Identity = 91/422 (21.56%), Postives = 188/422 (44.55%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAA--IGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIF---------SAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLS------FGLLFNIQMI----YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQ 1593
            VE ++FL       +  +  Q+++ ++   + F  N      C  + S +T   Q + V+ L+ ++ + I+LG  +  LF+       + + GRR ++ +  IG  +++    +++++   +  F+    + G++G   ++ + CF+ +A+ S  ++R  R+   ++ + LG A  + S+  G+  K  G++ PF +   +++    Y  FC+E+S   +++K   +       +  F         + +  L  +++ LL+    ++G   A  +     +SYP+C +S  IGY  + E L          T L+  L  L +  +CL+       G + NI  +     A T   ++  +G    + +  P I+  LSK+     Q  LF  +  +E     L+ +V   LY  TL   Q
Sbjct:   34 VEPVLFLSMFALALQGPLTTQYLWDRLSADIGF--NGTRILDCTVNGSKSTGALQQE-VETLTSHWSLYINLGGFLVGLFSVMLLGPWSDKVGRRPVLFFPCIGLALQAALYLVVMYQELHVAYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVA--ILEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTAVYVYFCVEES---VKDKKPARLFTHRHYQTFFRLFTVSGENNRRRKLCLYSLALLVVVTVHMG---AKNLFVLYELSYPLCWDSDLIGYGSAAEHL----------TYLSS-LAGLRLFQLCLADSWVAEMGFISNISGLVVISLASTTPVMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSYLLATAVFNSLYPATLHFMQ 433          
BLAST of slc46a-4 vs. Ensembl Xenopus
Match: SLC46A3 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:100492828])

HSP 1 Score: 60.8474 bits (146), Expect = 3.293e-9
Identity = 82/412 (19.90%), Postives = 178/412 (43.20%), Query Frame = 1
Query:  442 VMKQFIYHK--VKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASK-VENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKS--KPEIEEKLDLKPTILE-FSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSY----PICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLS 1647
            +++Q++Y +  ++   D F N  + + C  +QS+    +Q +  +  SL +   + L   I  L  +   +    R GR+  I+   +G  +  +  C + F    L        + G  GG       CFS +A+ SK  + +N+RI    +   + + +  +++GY I+  GF   F++  ++ +  + Y  F LE++  + E ++ +  K    E F+ +    +N      VVL +    ++    A+     +F  Y    P+C +S+ +G+  +       +G      + ++ L +  ++ I ++  +   I + ++ T  ++ +     + ++   P ++  +SK+   N Q  LF  +  LE   G L+ ++   +Y  T           +  F G +F+LS
Sbjct:   37 LIQQYVYSRMLIEGSSDGFINGNNISHCETNQSDPAYIHQKEVQKRASL-FSSTLDLSALIPSLVMALILVSYGDRHGRKASILLPCLGALLSVLIYCAIAFFTLPLAVLYLSYVISGFMGGFATFIGGCFSYVADLSKDAQKKNIRIAFVDMVLGVSSGLAGIASGYFIRELGFNWSFLIPGLLHIINICYICFFLEETVQRSEFQQPVLSKEGFTELFTGVFLLFRNASCKKRVVLTLLLLAFMLYLLANFGAVSLFTLYELDAPLCWDSVLVGWGSAFSTFCF-VGSFFGVYLFSRCLKDAYIVFIGMTSWIGGIILVAFSTTTIAMMLVRIPLLFAAMPLPVLRSIMSKVVLENEQGALFACIACLESITGVLTITIFSAVYAAT-----------VMWFPGFSFLLS 435          
BLAST of slc46a-4 vs. Ensembl Mouse
Match: Slc46a1 (solute carrier family 46, member 1 [Source:MGI Symbol;Acc:MGI:1098733])

HSP 1 Score: 62.003 bits (149), Expect = 1.255e-9
Identity = 101/456 (22.15%), Postives = 194/456 (42.54%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQS--NATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRI--------VCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEK----LDLKPTILEFSEIIFSAKNI-------LSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGI-STLNHHLKLK 1692
            VE L+FL     + +  +  Q+++H+       F  E+  N   + ++  N +      +V+ L+ ++ + +++G  +  LF S      + R GRR L++ + +G  +++V    ++     +  F+    L  L G    L +  F+ +A+ S   +R  R+        V G +AS LG        G+ ++  G+  PF +A  + +    Y  FC  ++  E +      L    +I     +    K+        L+ F VV + FG        A +IL    +S P+C +S  IGY  + + L      +L   +L   L +  V  I L+F +L  +   +A     ++  +G   LS    P I+  LSKL + + Q  LF  +  +      ++  +   +Y  TL   +   +L+     G+ F+ ++LIG+   +N H + +
Sbjct:   25 VEPLVFLANFALVLQGPLTTQYLWHR-------FSTELGYNGTRHRENCGNQSADPLMKEVETLTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELHVGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLG--------GHWLRAQGYANPFWLALALLIVMALYAAFCFGETVKEPKSTRLFTLRHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTVHFG--------AQDILTLYELSAPLCWDSKLIGYGSAAQHLPYLT-SLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFLL---GAGLLFIPAILIGVLEKVNPHPEFQ 453          
BLAST of slc46a-4 vs. Ensembl Mouse
Match: Slc46a2 (solute carrier family 46, member 2 [Source:MGI Symbol;Acc:MGI:1353616])

HSP 1 Score: 60.4622 bits (145), Expect = 4.082e-9
Identity = 88/411 (21.41%), Postives = 181/411 (44.04%), Query Frame = 1
Query:  490 FENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKT-YGFLPPFIVATIISVGCVSYPIF------CLEKSKP-EIEEKLD-----------LKPTILEFSEIIFS----AKNILSSFTVVLLMFGFFYVGETAAS---EILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILI-CLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFM 1641
            F++E +G + NYS + +  +YQ D+ Q    N+ +  +L   +  L ++     ++ R+ R+I I  + +GF +  +   L +  +W ++       L+GL G     +S   +L +       R++R++   +   L    GS+++G++ K   G     ++ T  SVGC ++ +F       + +SKP ++   +D           L P   +   +  +     K   S   VV L+F    + + AA    +++    +  P+  N +Q+GY ++   ++  I   L   + ++   +  +I+I  LSFG    + + + K     YIA    + +      I+  +SKL   +    +F+ L +     G ++ ++   +YQ TL+ +      I TCF   +F+
Sbjct:   48 FKSE-AGGSSNYSANQSLVEYQEDQQQKAISNFNIIYNLVLGLTPLLSAYGLGWLSDRYHRKISICTAMLGFLLSRIGLLLKVMLDWPVEVMYGAAALNGLCGSFSAYWSGVMALGSLGCSEGRRSVRLILIDLVLGLAGFSGSMASGHLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPESKPNKVHPTVDTVSGMMGTYRTLDPDQQDKQNVPRNPRTPGKGKSSQREVVALLFVGAIIYDLAAVGTVDVMALFVLKEPLHWNQVQLGYGMASGYIIF-ITSFLGVLVFSRCFRDTTMIIIGMLSFGS-GALLLAFVKETYMFYIARAIMLFALIPITTIRSAMSKLIKDSSYGKIFVILQLCLTLTGVVTSTIYNKIYQLTLDKF------IGTCFVLSSFL 449          
BLAST of slc46a-4 vs. UniProt/SwissProt
Match: sp|Q6DCX5|PCFT_XENLA (Proton-coupled folate transporter OS=Xenopus laevis OX=8355 GN=slc46a1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.757e-13
Identity = 95/423 (22.46%), Postives = 190/423 (44.92%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAA--IGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSA-------------KNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLS------FGLLFNIQMI----YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLE 1584
            VE ++FL       +  +  Q+++ ++   + F      G A N S+S   E+    +V+ L+ ++ + I+LG  +  LF+       + + GRR +++   IG  +++    L++++   +  F+    + G++G   ++ + CF+ +A+ S  ++R  R+   V+ + LG A  + S+  G+  K  G++ PF +   +++    Y  FC+E+S   +++K   KP  L F+   + +             +  L  +++ LL+    ++G   A  +     +SYP+C +S  IGY  + E L          T L+  L  L +  +CL+       G + NI  +     A T   ++  +G    + +  P I+  LSK+     Q  LF  +  +E     L+  +   LY  TL 
Sbjct:   27 VEPVIFLSMFALALQGPLATQYLWDRLSADIGFNGTRTVGCAMNGSKSAGPEQ---QEVETLTAHWSLYINLGGFLVGLFSVMLLGPWSDKVGRRPVLMLPCIGLALQAAVYLLVMYQELHVGYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVA--VLEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTALYVYFCVEES---VKDK---KPARL-FTHRHYQSFFRLFTVQGENNRRRKLFLYSLALLVVVTVHMG---AKNLFVLYELSYPLCWDSDLIGYGSAAEHL----------TYLSS-LAGLRLFQLCLADSWVAEMGFISNISGLVVISLASTTPIMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSFLLATGLFNSLYPATLH 423          
BLAST of slc46a-4 vs. UniProt/SwissProt
Match: sp|Q5F4B8|S46A3_CHICK (Solute carrier family 46 member 3 OS=Gallus gallus OX=9031 GN=SLC46A3 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.417e-12
Identity = 101/457 (22.10%), Postives = 194/457 (42.45%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDK-------VQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVE-NRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASE------ILYYIFMSY------------------PICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMI-YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLS 1647
            RK+  VE ++F+Y       S V++QFIY K+      +E E +  A +   S+  E+ +S         +Q  +  + M + L  ++  L  +   +      GR+  ++   IG  I  +   ++ + +W          + GL G         F+ +A+    E  +  RI    +   + + +  +S+GY ++  GF   F  A+++ V  + Y  F L+ +   I E     P  L + E      ++  +F+ V ++F      +TA S+      +L +IFM+Y                  P+C   + IGY  +     +++   L   + +K L ++ ++ I + F  +  I M  +AKT   +++    ++ S    P ++  LSK+  P+ Q  +F  +  LEV  G +S SV  ++Y  T           +  F+G +F+LS
Sbjct:    2 RKVLLVEPVIFIYIFASSLTSPVVQQFIYRKL------WEEEYNSTAISSDNSSHCERNKSSPTYVMEKAIQEKTSFFNMQLDLTGAVPSLIVAFIIVANGDHQGRKKSLVLPSIGALIADIFLTIVSYFSWPTSVLFLATFISGLFGSMATFLGGGFAYIADQCHDEKQKTTRIAVIDLIFGVVSGLAGLSSGYFLREMGFTWTFATASLLHVVNIIYITFFLQDTV-HISEFQQQAP--LSYKE------HLKETFSGVYMLF------KTAPSKKRILIIVLLFIFMTYLFTMFGGSSLFTLYELDEPLCWTEVYIGYGAA-AFTSISLTSFLGVYLFSKCLKDIYIVFIGI-FSYIGGIVMAAFAKTTLLMFLVRVPSLFSIMPIPVLRSMLSKVVLPSEQGAVFACIACLEVLTGTISLSVFNVIYAAT-----------VAWFSGFSFLLS 424          
BLAST of slc46a-4 vs. UniProt/SwissProt
Match: sp|Q5EBA8|PCFT_RAT (Proton-coupled folate transporter OS=Rattus norvegicus OX=10116 GN=Slc46a1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 5.304e-10
Identity = 103/454 (22.69%), Postives = 194/454 (42.73%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRI--------VCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEK----LDLKPTILEFSEIIFSAKNI-------LSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGI-STLNHHLKLK 1692
            VE L+FL     + +  +  Q+I+H++   L +       N  N S     ++     V+ L+ ++ + +++G  +  LF S      + R GRR L++ + +G  +++V    ++     +  F+    L  L G    L +  F+ +A+ S   +R  R+        V G +AS LG        G+ ++  G+  PF +A  + +    Y  FC  ++  E +      L    +I++   +    K+        L+ F VV + FG        A +IL    +S P+C +S  IGY  + + L      +L   +L   L +  V  I L+F +L  +   +A     ++  +G   LS    P I+  LSKL + + Q  LF  +  +      ++  +   LY  TL   +   +L+     G+ F+ ++LIG+   +N H + +
Sbjct:   25 VEPLVFLANFALVLQGPLTTQYIWHRISTELGYNGTRHRENCGNQSADPVLKE-----VETLTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLQLHIGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLG--------GHWLRAQGYANPFWLALAVLIVMTLYAAFCFGETVKEPKSTRLFTLRHHRSIVQLYVVPAPEKSRMHLALYSLAIFVVVTVHFG--------AQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLT-SLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSLYPATLNFMKGFPFLL---GAGLLFIPAILIGVLEKVNPHPEFQ 453          
BLAST of slc46a-4 vs. UniProt/SwissProt
Match: sp|Q6PEM8|PCFT_MOUSE (Proton-coupled folate transporter OS=Mus musculus OX=10090 GN=Slc46a1 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 8.775e-9
Identity = 101/456 (22.15%), Postives = 194/456 (42.54%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQS--NATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRI--------VCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEK----LDLKPTILEFSEIIFSAKNI-------LSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGI-STLNHHLKLK 1692
            VE L+FL     + +  +  Q+++H+       F  E+  N   + ++  N +      +V+ L+ ++ + +++G  +  LF S      + R GRR L++ + +G  +++V    ++     +  F+    L  L G    L +  F+ +A+ S   +R  R+        V G +AS LG        G+ ++  G+  PF +A  + +    Y  FC  ++  E +      L    +I     +    K+        L+ F VV + FG        A +IL    +S P+C +S  IGY  + + L      +L   +L   L +  V  I L+F +L  +   +A     ++  +G   LS    P I+  LSKL + + Q  LF  +  +      ++  +   +Y  TL   +   +L+     G+ F+ ++LIG+   +N H + +
Sbjct:   25 VEPLVFLANFALVLQGPLTTQYLWHR-------FSTELGYNGTRHRENCGNQSADPLMKEVETLTSHWTLYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELHVGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLG--------GHWLRAQGYANPFWLALALLIVMALYAAFCFGETVKEPKSTRLFTLRHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTVHFG--------AQDILTLYELSAPLCWDSKLIGYGSAAQHLPYLT-SLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPATLNFMKGFPFLL---GAGLLFIPAILIGVLEKVNPHPEFQ 453          
BLAST of slc46a-4 vs. UniProt/SwissProt
Match: sp|Q8CA03|TSCOT_MOUSE (Thymic stromal cotransporter protein OS=Mus musculus OX=10090 GN=Slc46a2 PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 2.855e-8
Identity = 88/411 (21.41%), Postives = 181/411 (44.04%), Query Frame = 1
Query:  490 FENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKT-YGFLPPFIVATIISVGCVSYPIF------CLEKSKP-EIEEKLD-----------LKPTILEFSEIIFS----AKNILSSFTVVLLMFGFFYVGETAAS---EILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILI-CLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFM 1641
            F++E +G + NYS + +  +YQ D+ Q    N+ +  +L   +  L ++     ++ R+ R+I I  + +GF +  +   L +  +W ++       L+GL G     +S   +L +       R++R++   +   L    GS+++G++ K   G     ++ T  SVGC ++ +F       + +SKP ++   +D           L P   +   +  +     K   S   VV L+F    + + AA    +++    +  P+  N +Q+GY ++   ++  I   L   + ++   +  +I+I  LSFG    + + + K     YIA    + +      I+  +SKL   +    +F+ L +     G ++ ++   +YQ TL+ +      I TCF   +F+
Sbjct:   48 FKSE-AGGSSNYSANQSLVEYQEDQQQKAISNFNIIYNLVLGLTPLLSAYGLGWLSDRYHRKISICTAMLGFLLSRIGLLLKVMLDWPVEVMYGAAALNGLCGSFSAYWSGVMALGSLGCSEGRRSVRLILIDLVLGLAGFSGSMASGHLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPESKPNKVHPTVDTVSGMMGTYRTLDPDQQDKQNVPRNPRTPGKGKSSQREVVALLFVGAIIYDLAAVGTVDVMALFVLKEPLHWNQVQLGYGMASGYIIF-ITSFLGVLVFSRCFRDTTMIIIGMLSFGS-GALLLAFVKETYMFYIARAIMLFALIPITTIRSAMSKLIKDSSYGKIFVILQLCLTLTGVVTSTIYNKIYQLTLDKF------IGTCFVLSSFL 449          
BLAST of slc46a-4 vs. TrEMBL
Match: A0A0H3YJH7 (Slc46a-4 OS=Schmidtea mediterranea OX=79327 GN=slc46a-4 PE=2 SV=1)

HSP 1 Score: 932.169 bits (2408), Expect = 0.000e+0
Identity = 467/467 (100.00%), Postives = 467/467 (100.00%), Query Frame = 1
Query:  310 MNIEAETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEHQET 1710
            MNIEAETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEHQET
Sbjct:    1 MNIEAETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEHQET 467          
BLAST of slc46a-4 vs. TrEMBL
Match: A0A0H3YFD5 (Slc46a-3 OS=Schmidtea mediterranea OX=79327 GN=slc46a-3 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 6.949e-92
Identity = 171/434 (39.40%), Postives = 274/434 (63.13%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDF-FENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIE-EKLDLKPTILEFSEIIFSA---------KNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFML 1644
            R+ FGVE L+  YG   L +++VM+QFIY++V +  +    N+     CN + S +++K ++DK+Q ++ +++M ISLG SIA + T+PF+ + + R+GRR++ +  G G F+KSV E L I+  W +  FIY+ET +GLTG    + S+ FS +A+ S    R  RI    I  A+GA + S+S+GYMI TY +  PF+ +T+ +  C+ YP+F +  SKP  +  K+++KP +  + ++   A         ++ILS   +VL++F F+ VGE +  ++     MSYPICM SIQIG    L I+ +N+G  LS  +LN+  ++LVVI++CL FG+ FN+QM +A +  + +IA GSN+LS SAFPF +G+LSK T    Q  LF GL ++E   G ++K +++  YQ+TL+ +   V++ + CF+ VAF+L
Sbjct:   34 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRT-SGSSDKDKTDKLQEINSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPGTGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILS--ILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIVLCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFIL 464          
BLAST of slc46a-4 vs. TrEMBL
Match: A0A0H3YJM6 (Slc46a-2 OS=Schmidtea mediterranea OX=79327 GN=slc46a-2 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.619e-66
Identity = 154/450 (34.22%), Postives = 243/450 (54.00%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFS--------AKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEH 1701
            R+   VE LM +Y +I   + +VM Q++Y++V   L+   N      CN + +  +EK ++DK+Q +     M I L  SI  + T+PF+ + + RFGR+++ I  G G F+KSV E L+I   W L  F+  E  +GL GG     S+ +S +A+ S  + R  R+    +   LGA + S+ +G  IK   +  P+I   ++++ C  YPIF L K  P+I    D K TI+   E + S         K   +   +V ++F F+YV E +   +     MSYPICM++IQ+    +  +L LN+G+ ++   L+K+ ++L ++  CL  G+ + +QM +A +V  +YIA  SN+ S SAFPFI+GY+SK   PN Q  LF GL + E   G ++K + I  Y+ T   +   VYL+LT F+ +A +L L      L    KLK E 
Sbjct:   39 RRCVTVEPLMLMYVVILYLQMTVMGQYVYYRVGKDLNLTTNGNLAYVCNRNVTGGSEKEKTDKLQEIYTYNTMFIQLSSSIFTILTAPFYSVFSDRFGRKLMFILPGGGAFVKSVIEILIIVYEWPLYIFVITEGFYGLFGGFNFATSLSYSYIADISTQKERTKRMGIMGVLMGLGALLVSLVSGIWIKYRNYKEPYIFTGVVALLCFLYPIFLL-KEPPKIN---DPKKTIISPIEQMKSIVKVYWDKPKEYRALLILVFVLFNFYYVSEMSGLSLSGTYLMSYPICMDTIQLSIFGASNMLALNLGIGITIIFLSKFFSDLFLVFFCLLSGIAYLLQMAFAVSVTQVYIAAASNLFSFSAFPFIRGYMSKRMGPNEQGALFGGLALSETVCGAITKVITIYFYRETFRIFHGMVYLLLTGFSVIACVLILF----ALPIDRKLKAEE 480          
BLAST of slc46a-4 vs. TrEMBL
Match: A0A401SAI9 (MFS domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0005820 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.399e-18
Identity = 101/444 (22.75%), Postives = 209/444 (47.07%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKV---KLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISL-----GFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIE-TLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILS--------SFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILI---CLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLS 1647
            +++F VE ++ LY + +L +  +M+Q+IY ++   +    + +NE   N+  Y   +    ++ + VQ LS ++ M ++L      F +  +  S      +  +GRR+ ++   IG  I S+    + + +W +  F++I   L    GG   ++   F+ +A+ S  E++N+R+    +   L   IG++++GY++ T GF   F++A++I+   V Y IF L++S     ++ +      +F EI     N+ +          +++LL F  + +    +  +     ++ P+C N++ IGY  S   L+  +   L   + ++YL +  ++LI    L+ G+   I  ++A     +++     + +    P ++  +SK+ +P  Q  LF  +  LE     +S  V   +Y  T+             FTG +FML+
Sbjct:   23 KRLFLVEPVVALYTLPNLADELLMQQYIYRRIWTRETNSSYVQNE--NNSYCYQNHSDPVYFKQEVVQELSSHFFMYVTLIKFLPNFIVTFVLGS-----YSDHYGRRLSLLLPTIGALISSLAFLAMTYFSWPIH-FLFIPVALSACFGGFTTVFGGAFAYVADVSSSEHKNMRMALLDMIVGLMGGIGTITSGYLLNTLGFNWLFLIASLINFANVVYIIFFLDESVQVSRDEQNEGSGNGKFREIFAGILNLWTGSNFRKRVQISLMLLTFSVYALASFGSGGLFTLYELNAPLCWNAVLIGYG-SAAGLITFLTSFLGVALFSRYLEDHFIVLIGTLSLAGGM---IVAVFATITLVMFLVRLVCLFAVMPLPVLRSMMSKIVSPKDQGVLFACVACLENLSATISSVVFNNVYAATIHG-----------FTGFSFMLA 443          
BLAST of slc46a-4 vs. TrEMBL
Match: V3ZU71 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_73586 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.319e-18
Identity = 108/433 (24.94%), Postives = 188/433 (43.42%), Query Frame = 1
Query:  385 FGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVS------GNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANAS-KVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCL-----EKSKPEIEEKLDLKPTI-LEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYL-NELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFM 1641
            F V F + LY +  ++   +  Q+I  ++ L L    N  +       NACN S     +     +   LSL Y +   +      L   P    +    GRRIL I   +G F+K V   L+++ + +L+       + GL G    +    F+  A+ +   +NR + I C     A+ A++G++S+G++IK+ G+  P ++  I +   ++   FCL     EK +PE      +K      FS     +K +L S  + +  FG   V    + E +Y   +  P C NS++IGY  +L + V     ILS   L  Y  +E + IL         +I ++               ++ SS  P  +  +SK+T P  Q  LF  + ++E      S S+  ++Y  T+E ++  V+ ++  F  +A M
Sbjct:    1 FVVGFGIILYMLSAISIVPLTSQYIVSRLSLSLKV-NNSTNISVVNVSNACNGSILGPEQIKIQKEASLLSLYYALTSGVAAIAINLILGPLSDFI----GRRILFIIPIVGLFLKCVITSLIVYFDLNLNLMYLASAVDGLCGSYYAILVASFTYSADVTVPGKNRTVAIACMEGCLAVAASVGALSSGFLIKSTGYFYPVLMFAIAAAINLTLTFFCLPETLTEKKQPEKSPLYHIKKVFGFYFSN---GSKRLLYSVLMGMFFFGVVVVLGRTSLETIYQ--LGEPFCWNSVKIGYFGALRLTVQFSCSILSIKFLQNYFKDEYISIL---------SIPVV--------------GIIGSSTVPIARSLMSKMTPPEKQGALFASIAIVETVCNSASNSLYNLVYNATVEHFKGAVWFMMAGFCIIAIM 400          
BLAST of slc46a-4 vs. Ensembl Cavefish
Match: si:dkey-5g14.1 (solute carrier family 46 member 3-like [Source:NCBI gene;Acc:103033173])

HSP 1 Score: 58.5362 bits (140), Expect = 1.105e-8
Identity = 97/470 (20.64%), Postives = 203/470 (43.19%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKV--KLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLAN-ASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSK----PEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMF------GFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGI------STLNHHLKLKIEHQET*SNSDV 1728
            +K + VE ++ +Y         +++Q++Y ++  ++    +    + + C+ + SN T  +   +VQ  +  + M   L   I  L  +   +  + + GR+I II   +G  +  +    + F   +L   I    +  L GG   +   CFS +A+     + + LR+    +   L + +  +S+GY ++  GF  P + A  + +  + Y +F LE+S+       E+       I   +  I++   + S    VLL+F       F +      + +  Y+ ++ P+C + I IGY+ +L   V     +     L++ L ELV++ I +       + M +AKT   +++     VL+   FP ++  +SK+ + + Q  LF  +  ++     L+ +    +Y  T+  +    +L+     G+  +   L+GI         ++   L +E  +T  N+ V
Sbjct:    2 KKFYFVEPVVAVYSFACFLLYPLVQQYVYRRLWQEITNTSYPALDTSSRCDTNSSNHTSHHY--EVQQAASLFSMYSELFSLIPSLIATLVLVAYSDQRGRKITIILPLVGSLVYCLAFLAVSFFELNLYLLIIASFVSSLFGGIGTMLGGCFSYVADLCEDGKQKTLRMAGVDMVIGLFSGVALISSGYFLRETGFNWPLVTAGTVHLVNLLYSVFFLEESRVIESSVAEDNRTCGEAIRRLTFGIYNLFALGSRRRNVLLVFLITIISTFSFANFGGLTVVTLYV-LNEPLCWSEILIGYASALSTTVFVTSFV-GVYFLSRCLPELVIVFIGMLSVFTGMVMMAFAKTTLMMFLVRIPMVLAIMPFPVLRSMMSKVVSKSEQGALFAWVAFVDSLSTNLASAAFNSVYSSTVAWFPGFAFLLA---AGICLIPMALLGILRCLQLREEDNTENLLVEDTQTTENAPV 464          
BLAST of slc46a-4 vs. Ensembl Cavefish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 55.4546 bits (132), Expect = 1.133e-7
Identity = 97/460 (21.09%), Postives = 195/460 (42.39%), Query Frame = 1
Query:  442 VMKQFIYHKVKLCLDFFENEVSGNA--CNYSQSNATEKYQS----DKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSL--------LANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCL-EKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFG------------------FFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQM-IYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSL---LIGISTLNHHLKLKIEHQET 1710
            +++Q+IY ++         ++SG+    N +QS+ +  Y +      VQ  + ++++   L F +  LFTSP  +  +   GR+  ++   +G    +    ++   + +L   +    L GL GG   L   CFS         LA    V    L +V GV++      +GS+ TG+ I+  GF  PF+ A+I+ +  + Y +  L E     +        +++E   +   A+ +      V L+F                   F+ V       I     ++ P+C N + + Y  +L  L+  +       +L+++L +  + L+ L   +   + M  +AKT   +++     +LS    P ++  +SKL   + Q  LF  +  +E+    L+  V   +Y  T           ++ F+G +F+L+    +I I+ +   L L+++ +E+
Sbjct:   24 LLQQYIYRRLW-------QQLSGHPYPSNQNQSHCSSNYTNLSLQQAVQTETSHFLLQSELCFILPSLFTSPLLVSYSDYGGRKSAMVPPLLGDLFFTFHYFIVSRFSLNLSYVLAAAFLTGLLGGPTTLTGGCFSYVADYCREELAGQKTVRMARLDMVLGVLS-----GLGSLCTGFFIRAAGFSWPFLCASILHLLNLIYVLIILKEPPGQNLPPSPSSPGSVIEPPRLS-QAQAMTGRLQGVYLLFAASTRRRRTVLLLLLTAYIFYKVSNMGGMSIFILYELNAPLCWNEVLVSYGSALSTLIY-LSSFTGVALLSRWLPDAPIALLGL-LSIAVGLSMAAFAKTTLLMFLVRLPLLLSMMPAPVMRAMMSKLVLSSEQGALFACVAFVEMLSMGLAFPVFSSVYAAT-----------ISWFSGFSFLLAAGVTIIPITLIGCVLWLRLDVEES 457          
BLAST of slc46a-4 vs. Ensembl Cavefish
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 55.4546 bits (132), Expect = 1.133e-7
Identity = 97/460 (21.09%), Postives = 195/460 (42.39%), Query Frame = 1
Query:  442 VMKQFIYHKVKLCLDFFENEVSGNA--CNYSQSNATEKYQS----DKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSL--------LANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCL-EKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFG------------------FFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQM-IYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSL---LIGISTLNHHLKLKIEHQET 1710
            +++Q+IY ++         ++SG+    N +QS+ +  Y +      VQ  + ++++   L F +  LFTSP  +  +   GR+  ++   +G    +    ++   + +L   +    L GL GG   L   CFS         LA    V    L +V GV++      +GS+ TG+ I+  GF  PF+ A+I+ +  + Y +  L E     +        +++E   +   A+ +      V L+F                   F+ V       I     ++ P+C N + + Y  +L  L+  +       +L+++L +  + L+ L   +   + M  +AKT   +++     +LS    P ++  +SKL   + Q  LF  +  +E+    L+  V   +Y  T           ++ F+G +F+L+    +I I+ +   L L+++ +E+
Sbjct:   24 LLQQYIYRRLW-------QQLSGHPYPSNQNQSHCSSNYTNLSLQQAVQTETSHFLLQSELCFILPSLFTSPLLVSYSDYGGRKSAMVPPLLGDLFFTFHYFIVSRFSLNLSYVLAAAFLTGLLGGPTTLTGGCFSYVADYCREELAGQKTVRMARLDMVLGVLS-----GLGSLCTGFFIRAAGFSWPFLCASILHLLNLIYVLIILKEPPGQNLPPSPSSPGSVIEPPRLS-QAQAMTGRLQGVYLLFAASTRRRRTVLLLLLTAYIFYKVSNMGGMSIFILYELNAPLCWNEVLVSYGSALSTLIY-LSSFTGVALLSRWLPDAPIALLGL-LSIAVGLSMAAFAKTTLLMFLVRLPLLLSMMPAPVMRAMMSKLVLSSEQGALFACVAFVEMLSMGLAFPVFSSVYAAT-----------ISWFSGFSFLLAAGVTIIPITLIGCVLWLRLDVEES 457          
BLAST of slc46a-4 vs. Ensembl Cavefish
Match: si:ch211-262i1.4 (si:ch211-262i1.4 [Source:ZFIN;Acc:ZDB-GENE-140106-10])

HSP 1 Score: 49.6766 bits (117), Expect = 5.963e-6
Identity = 68/262 (25.95%), Postives = 119/262 (45.42%), Query Frame = 1
Query:  472 KLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTS-PFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLD-AFIYI-ETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVS--YPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGY 1242
            KL   FFE  ++     Y+ S  T   Q D+ Q  S  + +  S+  ++A + ++ P   +  RR G ++ +I S +G  +  +C  LL+F  W L   F+++   ++GL+GGA   ++   +L A +SK  +R L++   ++  A    +G + +GY+ +  G     ++   IS   VS  Y  F L  S    E+K  L            +A  +L S  V+      F +G   A  IL    +  P+  +S+  GY
Sbjct:   16 KLGTSFFEMSLTLTV--YNVSLETADGQVDQAQAASSRFFLIHSIICTVAAMLSTVPLGRVADRR-GPKVFLIMSQLGS-VMGMC-VLLVFLFWKLPLEFLFLGSAVYGLSGGAPAYWAGVVALAALSSKQRHRTLKLNVPLLLFA--GVLGGLLSGYVYQI-GHKGVVLIGMAISFSVVSLLYSTFLLSGSVQNSEDKELLLSRAGRSERTNRAAVGLLISAMVL------FMLGMIGAENILTLYVLKPPLSWDSVWAGY 263          
BLAST of slc46a-4 vs. Ensembl Sea Lamprey
Match: slc46a3 (solute carrier family 46 member 3 [Source:ZFIN;Acc:ZDB-GENE-100105-2])

HSP 1 Score: 75.0998 bits (183), Expect = 1.299e-14
Identity = 93/425 (21.88%), Postives = 192/425 (45.18%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSS----FTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNV-LSSSAFP--FIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFML 1644
            VE ++ L+       S + +Q+IY +     +F  N+ +G+ C+ + S+  ++ + +     SL  V    +GF  AVL  S    + +   GRR+++I   IG+ ++S+   L++     L        L G TGG   + +  F+ L + +   N N+R+ C  +   +   IG+V +G+M++  G+   ++   +I V C+ Y    LE++  +          +   + + F       S      ++L+ F F+ + E   S  +    M  P+C +++ +GY  ++   +  I   +  T+L++ L++  + LI +S    F + M     V++  + F   + L  +  P   ++  +SK   P+ Q  LF  +  LE+  G +   V   +Y  T+  +   V+L+ +    + F++
Sbjct:    7 VEPIVALFAFAVFLSSPLNQQYIYRRFG---NFSTNDSTGSTCSPNGSDVEDELEKEAQAAASLFQVRLDLVGFLPAVL-ASLVLGVYSDTSGRRLMMILPCIGYSLESIVYILIVSLELPLPWLYLGCLLRGATGGYASILAGSFAYLTDVANPANLNMRVACLDMLIGISGGIGAVISGHMLQAMGYAFVYLCVCLILVLCIIYVACVLEETITKDIHVRSCTTPLRATTTVPFVQPGGPGSKRWRLALLLVAFTFYLLAEIGGSLPVSLFEMKAPLCWDALLLGYGSAVGFAIF-ITSFVGVTVLSRCLSDPPIALIGIS---TFTVGMAMICGVQTTLMMFLVRLPLMFTIMPVAVMRSMMSKTVLPSEQGTLFSLVGSLELLAGIVGSVVFNNVYAVTVGWFACLVFLLSSAVAVIPFLI 423          
BLAST of slc46a-4 vs. Ensembl Nematostella
Match: EDO38916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBG4])

HSP 1 Score: 66.6254 bits (161), Expect = 9.234e-12
Identity = 86/395 (21.77%), Postives = 172/395 (43.54%), Query Frame = 1
Query:  403 MFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNAC-NYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASAL---GAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSK-PE--IEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMF--GFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEV---FLGCLSKS 1551
            +++YGI  L    V++QF+Y K+     FF +  S   C N ++ N+T      +VQ  +    +GI++  S+  +  S      +   GR+  I+   IG  +++VC  ++++ +  +        L+G +G    L     + +A+++    R LR+    I  AL   G  +  +++G  I   GF  P+       V    Y IF + +++ P+   E+        L+    ++S         ++LL        V       ++    +  P+C ++  +GY  ++  LV+  G +     L K+++EL +  + L   +   +   ++ T   ++I     +L+ +  P  KG LS++ + + Q  LF  +  LE    F+G L+ S
Sbjct:    7 LYVYGI--LMHGPVIQQFVYSKIAKQKGFFYDPSSHTGCGNETRYNSTLHNLEQEVQATAAYVQIGITMFESLPSIVLSLMVGSWSDCHGRKPAILLPVIGSMLEAVCVLIVMYCDLDVYVLFIGALLNGCSGYLPTLLMGIMAYIADSTDESQRALRL---AIMEALVFTGGMVSQLTSGLWIDKLGFTGPYWFIFGCLVIAFFYTIFLVPETRFPDENTEKSRFFSCKTLKRIWKVYSTPRDGGRKNMLLLTLNDALTQVAIQGVGPVMTLYILHSPLCFSADDLGYFSAVRFLVMGFGAVFGLKFLVKWIDELSISRLGLLTTIGTYVLFGFSTTRAMVFIVGAVGLLNGAVAPVFKGMLSRIVSRDEQGALFSFVASLETLCSFIGALTLS 396          
BLAST of slc46a-4 vs. Ensembl Nematostella
Match: EDO42708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0P7])

HSP 1 Score: 59.6918 bits (143), Expect = 1.903e-9
Identity = 74/407 (18.18%), Postives = 168/407 (41.28%), Query Frame = 1
Query:  394 EFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNAC-NYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPF-IVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVL--------------LMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFG-------------SNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEV 1527
            E ++FLY         V++Q++Y ++     F  +      C N +  NAT ++   +VQ L+    +GI +  ++  +  S          GRR  +    +G  ++S+   L+++  W +       +++GL G    +     + +A+ +  + R+LR+         GA +  +++G  I+ Y F+ P+  + + +S+ C+   I  + +S+P         P +++      S +++ + + V +              L  G   +     + ++    +  P+C +   +GY  +L  L + +G +L   +L ++L+             + NI  +   +  + YI FG             + +      P ++G +S++ + + Q  LF  +  LE+
Sbjct:   13 EIVVFLYAYGLFMHVPVIQQYVYSRIAKSKGFPYDAHKKTGCGNITILNATMQHIEQEVQSLASYVHLGIVMFAALPSVVMSLLIGSWTDSRGRRPALFLPALGSTLESIVVILVMYFEWPIYVLFVGASINGLCGSFTTIIMGTMAYIADTTHEDQRSLRLAILEFMVFFGAMVSQLTSGLWIEKYSFIIPYWFILSCLSLSCILV-IAIVPESRP---------PDVIQNKTAFCSCRSLQNVYKVYMTPREGGRRNLFLLTLSSGVTNLILQGVAGVIVLFVLHTPLCFSPKLVGYLSALRYLSIGVGAVLGIKVLGRWLS-------------VINISRVGMLSTMASYILFGFSTKIFIVFLVPFAGLFMGCVVPILRGIMSRIVSQDEQGALFSAVASLEM 396          
BLAST of slc46a-4 vs. Ensembl Nematostella
Match: EDO32892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS4])

HSP 1 Score: 58.9214 bits (141), Expect = 3.117e-9
Identity = 80/393 (20.36%), Postives = 168/393 (42.75%), Query Frame = 1
Query:  391 VEFLMFLYGIIDLTESSVMKQFIYHKV---KLCLDFFENEVSGNACNYSQ-SNATEKYQ--SDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPE-IEEKLDLKPTILEFSE---IIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNV-----LSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLE 1524
            VE ++F Y    +    V++Q+I+ ++   K     + N  S   C   Q +N++E+      +VQ  +    MG+ L  S   L  +      + R GRR  +     G  ++S    ++++    +   +  E ++G  G    +    FS +A+ ++   R  R+      + +   +  +++G+ I   GF  P+ +  I++   + Y  F L +S+ + + EK  ++   L+      +IF+        T+ +++ G   V       +     +  P+C N+I IGY + L   V  +G +L    L   L+E  ++ + +   +   + M +  + K++++  G ++     L     P I+  +SK+   + Q  LF  +  LE
Sbjct:    5 VEPVIFCYAFGIILHVPVIQQYIHQRLSEGKGLTYEYNNTDSRTTCEPIQMANSSEETLELQKEVQAEASYMQMGLVLSVSTPSLLVALLLGAWSDRAGRRRAMAMPIFGSAVESAIILVIMYFELPVTFLLLAEFINGSCGFFPTMVLSVFSYIADITEESQRAFRLGILEAIAFISGMLSHLTSGWWINNLGFRAPYWLLLILNTFALLYVTFILPESRAKHVMEKSKVRVLSLDHIRAIVMIFTKSRDPQRMTIFMVISGLMIVSSIGFGSVFVLYALDRPLCCNAILIGYYLGLSFFVQAVGAVLGLKYLRLCLSETALMQVGMVSIISSLVVMAFVTSKKTLFV--GKSLPFVACLGGVPTPTIRAMMSKMVDADGQGALFAAVASLE 395          
BLAST of slc46a-4 vs. Ensembl Nematostella
Match: EDO48562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS8])

HSP 1 Score: 52.373 bits (124), Expect = 3.885e-7
Identity = 84/426 (19.72%), Postives = 180/426 (42.25%), Query Frame = 1
Query:  343 RP-TQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVS--YPIFCLEKSKPEIEEKLDLKPTILEFSEIIF----SAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILS---GTILNKYLNELVVILICLSFGLLFNIQMI-YAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLED 1587
            RP + L  P    +   VE  +F Y    + E  V++Q++Y +    L    N  +   C+ +  N+T +  +D VQ  +  Y++  +L   +  + T+      + + GR+ L++    G  + +      ++ +  L   I    ++G+ G    +     + +A+ +  + R +++      + L   +G  S+G  I   G+   F    I+S+  ++  Y +F L +S P+   +   K   LE  + ++      ++      V+ L+  FF   +   + +       YP+C ++  +GY +   + V   G +L    G+++   L       I   F L+  + MI +++T   ++++  +N+ S    P I+  +S++     Q  LF  L  LE      S+ +   LY  ++ +
Sbjct:    6 RPISWLKNP---HRAVTVEITIFFYIAGMILELPVLQQYLYERAAKELKI-NNTSNTTICSPNDLNSTGQSANDAVQEKASQYILAYNLALQLPAVLTACLLGTWSDKNGRKPLMLIVAFGAIVDASVALFTVYTDGPLYPLIIGGGINGVMGFYPTMVLALLAYIADTTPSKRRAIKLAVLEALAFLSGTLGHFSSGIYIHHLGYKATFW--GILSLHLINFIYLLFFLPESMPKQRIEQSGKCLTLEQVKSVYMVYLKKRDGRWILCVLSLLSVFFLFAQYIVTTLGVLYGKRYPLCWSAELVGYFLGTLLCVKAFGAVLGIWLGSLMK--LTNYTAAQIGTLF-LIAGLTMIGFSQTTFLMFMSCVANLFSGVPQPCIRAQMSQMVGKEEQGALFAILASLESLTNFTSQLIFNPLYAWSIAN 422          
BLAST of slc46a-4 vs. Ensembl Nematostella
Match: EDO27580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8V4])

HSP 1 Score: 50.0618 bits (118), Expect = 5.607e-7
Identity = 54/220 (24.55%), Postives = 101/220 (45.91%), Query Frame = 1
Query:  379 KIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLI-FRNWSLDAFIYIETLHGLTGG-AMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKS 1032
            K   VE ++FLY       S +++Q  Y K+  C + +   V  N  +Y         + + VQ  + N++   +L  ++  + +S      + R GR+ ++I   +G  + ++   L + F + +++  I    + G  GG A  L SV FS +A+ +   +R LRI        LG ++G +  G M+   GF+  F +A  ++    +Y  F L +S
Sbjct:    8 KSITVEPVLFLYMFCTFMSSPLLQQLAYRKI--CKEHYNTSVCNNLSDYQN-------EQNYVQTSTSNWMRYQALALALPSIASSLVLGAWSDRVGRKAIMILPPVGNILMNINYMLNVHFFSLNVNYLIIGIVIAGTFGGFATTLLSV-FSYMADITDKSHRTLRISILESMVFLGGSVGELVAGVMLDHSGFMATFGLALGLNCCIAAYVTFILPES 217          
BLAST of slc46a-4 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:101171853])

HSP 1 Score: 68.1662 bits (165), Expect = 1.082e-11
Identity = 115/465 (24.73%), Postives = 208/465 (44.73%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSD---KVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIET--LHGLTGGAMILYSVCFSLLANASKVE-NRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKS--KP-------EIEEKLDLKPTIL----EFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFM-LSLLIGISTLNHHLKLKIEHQET 1710
            ++++ VE ++ LY         +++Q+IY ++ L L      +S N+   + SN++   Q+D   +VQ  +  + M   L  +I  L  +   +  + R GR+I II   IG  I +     L    + L+ ++ I +  L  L GG       CF+ +A+  K E  R LR+    +   L + + ++STGY ++  GF  PF+ + +     + Y IF LE++   P       E   +  LK  +      FS +    K +L+    +   F F YVG  +   ++    ++ P+C N + IGY  +L   V          +    + +L++IL+ +       I M +AKT   ++I     +LS   FP ++  +SK  + + Q  LF  L+ LE     +S  V   +Y  T+  Y   V+++     G+ F+ LS L  ++ +   +  +I   ET
Sbjct:    2 KRLYLVEPVVALYAFSSFLIYPLVQQYIYRRLWLQLTNTAYPISSNSSRCAPSNSSSN-QTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYA--SSFLTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCFAYIADLCKNERQRTLRMAGVDMMIGLLSGVAAISTGYFLRAAGFNWPFLTSLLCQCLTLLYAIFILEETVKAPNEGDIFDESTRRHALKYMVCGVYQTFSGLTSKCKILLALMMFIFTSFSFAYVGGIS---LVTLYELNEPLCWNEVLIGYGSALSTTVFLTSFAGVAALTYCRVPQLLIILLGILSVASGMILMSFAKTTVLMFIVRIPMLLSIMPFPVLRSMMSKNISKSEQGALFACLSFLESLTNNVSSGVFNSIYAATVAWYPGFVFIL---SAGLCFIPLSALGVVALIGTDVSTEIGRPET 457          
BLAST of slc46a-4 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:NCBI gene;Acc:101171853])

HSP 1 Score: 68.1662 bits (165), Expect = 1.082e-11
Identity = 115/465 (24.73%), Postives = 208/465 (44.73%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSD---KVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIET--LHGLTGGAMILYSVCFSLLANASKVE-NRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKS--KP-------EIEEKLDLKPTIL----EFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFM-LSLLIGISTLNHHLKLKIEHQET 1710
            ++++ VE ++ LY         +++Q+IY ++ L L      +S N+   + SN++   Q+D   +VQ  +  + M   L  +I  L  +   +  + R GR+I II   IG  I +     L    + L+ ++ I +  L  L GG       CF+ +A+  K E  R LR+    +   L + + ++STGY ++  GF  PF+ + +     + Y IF LE++   P       E   +  LK  +      FS +    K +L+    +   F F YVG  +   ++    ++ P+C N + IGY  +L   V          +    + +L++IL+ +       I M +AKT   ++I     +LS   FP ++  +SK  + + Q  LF  L+ LE     +S  V   +Y  T+  Y   V+++     G+ F+ LS L  ++ +   +  +I   ET
Sbjct:    2 KRLYLVEPVVALYAFSSFLIYPLVQQYIYRRLWLQLTNTAYPISSNSSRCAPSNSSSN-QTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYA--SSFLTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCFAYIADLCKNERQRTLRMAGVDMMIGLLSGVAAISTGYFLRAAGFNWPFLTSLLCQCLTLLYAIFILEETVKAPNEGDIFDESTRRHALKYMVCGVYQTFSGLTSKCKILLALMMFIFTSFSFAYVGGIS---LVTLYELNEPLCWNEVLIGYGSALSTTVFLTSFAGVAALTYCRVPQLLIILLGILSVASGMILMSFAKTTVLMFIVRIPMLLSIMPFPVLRSMMSKNISKSEQGALFACLSFLESLTNNVSSGVFNSIYAATVAWYPGFVFIL---SAGLCFIPLSALGVVALIGTDVSTEIGRPET 457          
BLAST of slc46a-4 vs. Ensembl Medaka
Match: si:dkey-5g14.1 (solute carrier family 46 member 3 [Source:HGNC Symbol;Acc:HGNC:27501])

HSP 1 Score: 66.2402 bits (160), Expect = 4.094e-11
Identity = 106/434 (24.42%), Postives = 198/434 (45.62%), Query Frame = 1
Query:  442 VMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSD---KVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIET--LHGLTGGAMILYSVCFSLLANASKVE-NRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKS--KP-------EIEEKLDLKPTIL----EFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVIL---ICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILT--CFTGVAFMLSLLIGISTL 1671
            +++Q+IY ++ L L      +S N+   + SN++   Q+D   +VQ  +  + M   L  +I  L  +   +  + R GR+I II   IG  I +     L    + L+ ++ I +  L  L GG       C++ +A+  K E  R LR+    + S L + + ++STGY ++  GF  PF+ + +     + Y IF LE++   P       E   +  LK  +      FS +    K +L+    +   F F ++G    S +  Y  ++ P+C N + IGY  +L   V  I       +    + +L+++L   + ++ G+   I M +AKT   ++I     +LS+  FP ++  +SK  + +    LF   + LE+    +S  V   +Y  T+  Y   V+ +    CF  +++ + +++  S L
Sbjct:   24 LVQQYIYRRLWLQLTNTTYPISSNSSRCAPSNSSSN-QTDFHKEVQKQASLFSMYSELLSTIPSLIVTLLLVAYSDRGGRKITIIMPLIGSLIYA--SSFLTVSFFELNIYLLIGSSFLSSLFGGLGTFLGGCYAYIADLCKNERQRTLRMAGVDMMSGLLSGVAAISTGYFLRAAGFNWPFLTSLLCQCLTLLYAIFILEETVKAPNEGDIFDESTRRHALKFLVCGVYQTFSGLSSKCKILLALMMFIFTSFSFAFIG--GISLVTLYE-LNKPLCWNEVLIGYGSALSTTVSLISFAGVAALTYCRVPQLLIVLLGILSVASGM---ILMSFAKTTVLMFIVNIPMLLSNMPFPVLRSMMSKNISKSEHGALFACFSFLEILTINVSFGVFNSIYAATVAWYPGFVFSLSAGLCFIPLSWNMVIIVTFSAL 448          
BLAST of slc46a-4 vs. Planmine SMEST
Match: SMESG000065066.1 (SMESG000065066.1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 463/467 (99.14%), Postives = 466/467 (99.79%), Query Frame = 1
Query:  310 MNIEAETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEHQET 1710
            MNI+AETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETL+GLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEI+FSAKNILSSFTVVLLMFGFFYVGETAASEILYYI MSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEHQET
Sbjct:    1 MNIQAETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLYGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEILFSAKNILSSFTVVLLMFGFFYVGETAASEILYYILMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEHQET 467          
BLAST of slc46a-4 vs. Planmine SMEST
Match: SMESG000065064.1 (SMESG000065064.1)

HSP 1 Score: 299.671 bits (766), Expect = 7.102e-95
Identity = 171/434 (39.40%), Postives = 273/434 (62.90%), Query Frame = 1
Query:  376 RKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDF-FENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIE-EKLDLKPTILEFSEIIFSA---------KNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFML 1644
            R+ FGVE L+  YG   L +++VM+QFIY++V +  +    N+     CN + S +++K ++DK+Q ++ +++M ISLG SIA + T+PF+ + + R+GRR++ +  G G F+KSV E L I+  W +  FIY+ET +GLTG    + S+ FS +A+ S    R  RI    I  A+GA + S+S+GYMI TY +  PF+ +T+ +  C+ YP+F +  SKP  +  K+++KP +  + ++   A         ++ILS   +VL++F F+ VGE +  ++     MSYPICM SIQIG    L I+ +N+G  LS  +LN+  ++LVVI +CL FG+ FN+QM +A +  + +IA GSN+LS SAFPF +G+LSK T    Q  LF GL ++E   G ++K +++  YQ+TL+ +   V++ + CF+ VAF+L
Sbjct:   34 RRFFGVEPLLLFYGFASLMQTTVMQQFIYYRVGIIYNITAPNQTLAFVCNRT-SGSSDKDKTDKLQEINSHFLMLISLGSSIASILTAPFYSVFSDRYGRRLMFLIPGSGIFVKSVLELLAIYYLWPITTFIYMETFYGLTGAYNFVISLGFSYVADRSGHGTRTCRIAFVGIMIAIGAFVASLSSGYMITTYRYFVPFLASTVAAFLCLIYPLFLMMDSKPISDLSKVNMKPIMAVWKQLTSLATVHKKQSRNESILS--ILVLIIFAFYNVGEMSGVDLQTPYLMSYPICMTSIQIGLYGILNIVAINLGAGLSTAMLNRCFSDLVVIALCLIFGMAFNLQMAFATSPLAAFIATGSNLLSFSAFPFFRGFLSKRTKSTEQGALFGGLVLIETVCGAITKVLMLYFYQKTLQTFNGLVFIFIGCFSLVAFIL 464          
BLAST of slc46a-4 vs. Planmine SMEST
Match: SMESG000065078.1 (SMESG000065078.1)

HSP 1 Score: 216.853 bits (551), Expect = 5.630e-64
Identity = 142/424 (33.49%), Postives = 228/424 (53.77%), Query Frame = 1
Query:  454 FIYHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLDLKPTILEFSEIIFS--------AKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLLFNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEH 1701
            ++Y++V   L+   N      CN + +  +EK ++DK+Q +     M I L  SI  + T+PF+ + + RFGR+++ I  G G F+KSV E L+I   W L  F+  E  +GL GG     S+ +S +A+ S  + R  R+    +   LGA + S+ +G  IK   +  P+I   ++++ C  YPIF L K  P+I    D K TI+   E + S         K   +   +V ++F F+YV E +   +     MSYPICM++IQ+    +  +L LN+G+ ++   L+K+ ++L ++  CL  G+ + +QM +A +V  +Y+A  SN+ S SAFPFI+G++SK   PN Q  LF GL + E   G ++K + I  Y+ T   +   VYL+LT F+ +A +L L      L    KLK E 
Sbjct:    2 YVYYRVGKDLNLTTNGNLAYVCNRNVTGGSEKEKTDKLQEIYTYNTMFIQLSSSIFTILTAPFYSVFSDRFGRKLMFILPGGGAFVKSVIEILIIVYEWPLYIFVITEGFYGLFGGFNFATSLSYSYIADISTQKERTKRMGIMGVLMGLGALLVSLVSGIWIKYRNYKEPYIFTGVVALLCFLYPIFLL-KEPPKIN---DPKKTIISPIEQMKSIVKVYWDKPKEYRALLILVFVLFNFYYVSEMSGLSLSGTYLMSYPICMDTIQLSIFGASNMLALNLGIGITIIFLSKFFSDLFLVFFCLLSGIAYLLQMAFAVSVTQVYLAAASNLFSFSAFPFIRGFMSKRMGPNEQGALFGGLALSETVCGAITKVITIYFYRETFRIFHGMVYLLLTGFSVIACVLILF----ALPIDRKLKAEE 417          
BLAST of slc46a-4 vs. Planmine SMEST
Match: SMESG000080390.1 (SMESG000080390.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.261e-18
Identity = 129/463 (27.86%), Postives = 209/463 (45.14%), Query Frame = 1
Query:  325 ETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFIYHKVKLCLDFFENEVSGNAC---NYSQ--SNATEKYQSDKVQYLSLNYVMGISLGFSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLDAFIYIETLHGLTG--GAMILYSVCFSLLANASKVENRNLRIVCGVIASALGAAIGSVSTGYMIKTYGFLPPFIVATII-SVGCVSYPIFCLEKSKPEIEEK---LDLKPTILEFSEIIFSAKN-----ILSSFTVVLLMFGFFYVGETAASEILYYIFMSYPICMNSIQIGYSISLEILVLNIGLILSGTILNKY--LNELVVI----LICLSFGLLFNIQMIYAKTV-KSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFML 1644
            E +     T +S  S+      +   M L  I +L + ++M Q+IY+++    D   NE S + C   N+S   SN   + QS   QY   N    +S G  I  +    F  +++  +GR+++I+ S IG FI ++   LLI  N  L  +I  + L GL G  GAM++    FSL+++++   NRN  I+   IA  L         G  ++   FL P +   II S+  V Y      ++K     +     +K TI +  E+ ++ K      I S+ +  +  F FF       + I  Y+F   P C NS  +GY  S+   ++  G+ILS  +L KY  +NE+++I    L  +   LLF I   YAK++   + I  G ++ S ++   ++   SK  +P     LF  ++  E     L   V   +Y  TL  Y   VY        +AF+L
Sbjct:    3 EDNIKDNKTMMSSKSYAV----IGLFMVLCYIGNLGQYTIMGQYIYYRISSDEDLVRNE-SVSQCSKVNFSSNFSNTQNRVQSSAAQY---NIYAQLSSG--IPSMIVVIFSGVLSDFYGRKLVILISWIGSFIGTIFNILLISLNGPLWVYIVGQFLSGLGGNYGAMLV--GVFSLVSDSTGHRNRNFGIIIIEIALGLSMITSQALLGKWLRLNNFLWPIVTFGIIFSLSGVMYLFLKETRNKRMTGNRNIQFHMKMTISKMIELFYNNKKFNFLLIFSTISFFIHTFNFF----GNMTLITVYLF-GRPFCWNSEILGYYRSISSAIVQFGIILSFLML-KYMRMNEILIIEVGFLTNILSKLLFAIAPSYAKSICDYLIIIAGFDLFSGASVSLLRSVSSKHVSPEDYGTLFGMMSSFETLSSLLGGVVYNGIYDATLSFYYGFVYCFAVVLLSIAFVL 447          
BLAST of slc46a-4 vs. Planmine SMEST
Match: SMESG000065078.1 (SMESG000065078.1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.500e-12
Identity = 40/99 (40.40%), Postives = 55/99 (55.56%), Query Frame = 1
Query: 1405 IAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIGLTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIGISTLNHHLKLKIEH 1701
            +A  SN+ S SAFPFI+G++SK   PN Q  LF GL + E   G ++K + I  Y+ T   +   VYL+LT F+ +A +L L      L    KLK E 
Sbjct:   62 MAAASNLFSFSAFPFIRGFMSKRMGPNEQGALFGGLALSETVCGAITKVITIYFYRETFRIFHGMVYLLLTGFSVIACVLILF----ALPIDRKLKAEE 156          
The following BLAST results are available for this feature:
BLAST of slc46a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC46A19.252e-821.81solute carrier family 46 member 1 [Source:HGNC Sym... [more]
SLC46A19.408e-621.38solute carrier family 46 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc46a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc46a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SLC46A35.723e-1021.79si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
SLC46A36.920e-1021.79si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
SLC46A36.920e-1021.79si:dkey-5g14.1 [Source:ZFIN;Acc:ZDB-GENE-091204-36... [more]
slc46a37.341e-820.56solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc46a16.174e-1321.56solute carrier family 46 (folate transporter), mem... [more]
SLC46A33.293e-919.90solute carrier family 46 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slc46a11.255e-922.15solute carrier family 46, member 1 [Source:MGI Sym... [more]
Slc46a24.082e-921.41solute carrier family 46, member 2 [Source:MGI Sym... [more]
back to top
BLAST of slc46a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCX5|PCFT_XENLA1.757e-1322.46Proton-coupled folate transporter OS=Xenopus laevi... [more]
sp|Q5F4B8|S46A3_CHICK2.417e-1222.10Solute carrier family 46 member 3 OS=Gallus gallus... [more]
sp|Q5EBA8|PCFT_RAT5.304e-1022.69Proton-coupled folate transporter OS=Rattus norveg... [more]
sp|Q6PEM8|PCFT_MOUSE8.775e-922.15Proton-coupled folate transporter OS=Mus musculus ... [more]
sp|Q8CA03|TSCOT_MOUSE2.855e-821.41Thymic stromal cotransporter protein OS=Mus muscul... [more]
back to top
BLAST of slc46a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJH70.000e+0100.00Slc46a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFD56.949e-9239.40Slc46a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJM62.619e-6634.22Slc46a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A401SAI93.399e-1822.75MFS domain-containing protein OS=Chiloscyllium pun... [more]
V3ZU715.319e-1824.94Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-5g14.11.105e-820.64solute carrier family 46 member 3-like [Source:NCB... [more]
slc46a31.133e-721.09solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
slc46a31.133e-721.09solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
si:ch211-262i1.45.963e-625.95si:ch211-262i1.4 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc46a31.299e-1421.88solute carrier family 46 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc46a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO389169.234e-1221.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427081.903e-918.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328923.117e-920.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485623.885e-719.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275805.607e-724.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc46a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-5g14.11.082e-1124.73solute carrier family 46 member 3 [Source:NCBI gen... [more]
si:dkey-5g14.11.082e-1124.73solute carrier family 46 member 3 [Source:NCBI gen... [more]
si:dkey-5g14.14.094e-1124.42solute carrier family 46 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc46a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065066.10.000e+099.14SMESG000065066.1[more]
SMESG000065064.17.102e-9539.40SMESG000065064.1[more]
SMESG000065078.15.630e-6433.49SMESG000065078.1[more]
SMESG000080390.11.261e-1827.86SMESG000080390.1[more]
SMESG000065078.13.500e-1240.40SMESG000065078.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033628
GenBankAKN21696.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033628 ID=SMED30033628|Name=slc46a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1791bp
ATTTTCTTTCATCTATTCCATTGTAATTTTAATATAAATATTTAGTTGTA
GTGACAAACTGTGAAGAATTATATCCGTAAGCATCTGGTAACATCTGAAT
GAACTATTTATTTATTTCATTCGTAATCTCTTGAAAAGTGTCCGTCTATT
AACATAACATACAAGTTTGACGAACCAGATAGTGAATCGAAAGACAAATC
ACGTTGCGAGAGCGAATTATTCGAGAAAAGTTTCTACGAGTGTTCATTAT
AGACTTTATTCACATCGTTCCGCTTGAATTGTAATTACATCTTTTACGGC
ATTGTTGCAATGAATATTGAGGCCGAAACCGACTGCTTGTTGCGCCCAAC
CCAATTGTCCAAACCATCATTTTGTCGGAAAATATTCGGAGTTGAATTTT
TAATGTTCTTATATGGAATAATCGACTTGACTGAATCTAGCGTAATGAAA
CAATTTATTTATCACAAAGTCAAACTTTGTTTAGATTTTTTCGAAAATGA
AGTCTCAGGCAACGCTTGCAATTATAGTCAGTCAAATGCCACAGAAAAAT
ATCAAAGTGATAAAGTTCAATACCTTTCCTTAAATTATGTAATGGGGATA
AGTTTGGGGTTTTCTATTGCCGTTTTATTTACGTCTCCATTTCATTTAAT
TGTGGCGAGACGATTCGGTCGGAGGATTTTGATAATTTATTCTGGAATAG
GATTTTTTATCAAATCAGTCTGTGAGTGCTTACTAATATTTCGGAACTGG
TCTTTGGATGCATTCATTTACATTGAAACTTTGCATGGATTAACTGGGGG
AGCCATGATTCTTTATAGCGTTTGCTTTAGTTTATTAGCTAATGCGTCGA
AAGTAGAAAACAGAAATCTTCGAATTGTTTGTGGAGTCATTGCCAGTGCT
CTTGGCGCTGCAATAGGGTCAGTCTCCACGGGTTACATGATCAAAACGTA
TGGTTTTCTTCCTCCATTCATTGTGGCAACAATTATTTCGGTGGGATGTG
TTTCCTACCCGATATTTTGTCTTGAGAAATCAAAACCTGAAATTGAAGAA
AAATTAGATTTGAAACCAACGATCTTGGAATTTTCTGAAATTATTTTCTC
AGCGAAAAACATTTTGTCGAGTTTTACAGTGGTGCTTTTGATGTTTGGGT
TCTTCTATGTCGGAGAAACTGCTGCCAGTGAAATTTTATATTATATTTTC
ATGTCTTACCCGATATGCATGAATTCTATACAGATTGGATACAGTATTTC
TTTGGAAATTTTGGTTTTGAATATAGGACTGATACTTTCTGGAACCATTC
TAAATAAATATTTGAATGAACTTGTCGTTATCTTGATATGCCTAAGTTTC
GGTCTCTTATTCAATATCCAGATGATCTATGCTAAAACAGTTAAATCAAT
TTATATTGCTTTCGGGTCGAATGTTTTATCATCAAGTGCTTTTCCATTCA
TCAAAGGATACCTTTCCAAGCTGACAGCACCAAATCTTCAAACTTACCTA
TTCATTGGGTTGACTGTACTAGAAGTTTTTCTAGGGTGTTTATCAAAGTC
AGTAGTGATCATTTTATACCAAAGAACCTTGGAAGACTACCAAGAAACGG
TTTATTTAATTTTAACATGTTTCACTGGAGTCGCTTTCATGTTATCACTA
TTAATAGGAATTTCGACCCTAAATCACCATTTGAAGCTAAAGATTGAACA
TCAAGAAACATAATCAAATTCAGATGTTTGGTTTAAAGATTTCTCAGAAA
TAATTTTTTTATAAATAAATTTGATATACACTTTAGTTAAC
back to top

protein sequence of SMED30033628-orf-1

>SMED30033628-orf-1 ID=SMED30033628-orf-1|Name=SMED30033628-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MNIEAETDCLLRPTQLSKPSFCRKIFGVEFLMFLYGIIDLTESSVMKQFI
YHKVKLCLDFFENEVSGNACNYSQSNATEKYQSDKVQYLSLNYVMGISLG
FSIAVLFTSPFHLIVARRFGRRILIIYSGIGFFIKSVCECLLIFRNWSLD
AFIYIETLHGLTGGAMILYSVCFSLLANASKVENRNLRIVCGVIASALGA
AIGSVSTGYMIKTYGFLPPFIVATIISVGCVSYPIFCLEKSKPEIEEKLD
LKPTILEFSEIIFSAKNILSSFTVVLLMFGFFYVGETAASEILYYIFMSY
PICMNSIQIGYSISLEILVLNIGLILSGTILNKYLNELVVILICLSFGLL
FNIQMIYAKTVKSIYIAFGSNVLSSSAFPFIKGYLSKLTAPNLQTYLFIG
LTVLEVFLGCLSKSVVIILYQRTLEDYQETVYLILTCFTGVAFMLSLLIG
ISTLNHHLKLKIEHQET*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 95..392
e-value: 3.2E-14
score: 52.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 81..450
e-value: 4.7E-19
score: 70.4
NoneNo IPR availablePANTHERPTHR23507FAMILY NOT NAMEDcoord: 23..452
NoneNo IPR availableCDDcd17386MFS_SLC46coord: 98..449
e-value: 1.77446E-18
score: 84.6367
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 430..452
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
NoneNo IPR availableTMHMMTMhelixcoord: 338..358
NoneNo IPR availableTMHMMTMhelixcoord: 155..177
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 309..331
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
NoneNo IPR availableTMHMMTMhelixcoord: 21..38
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 89..457