SMED30033623

Overview
NameSMED30033623
Smed IDSMED30033623
Length (bp)1640
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30033623 (SMED30033623) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30033623 (SMED30033623) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033623

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30033623SMESG000050765.1 dd_Smed_v4_15551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033623SMESG000050765.1 dd_Smed_v4_15551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033623 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017962:1880..9750 +7677
Homology
BLAST of SMED30033623 vs. Ensembl Human
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 144.05 bits (362), Expect = 5.318e-37
Identity = 93/366 (25.41%), Postives = 188/366 (51.37%), Query Frame = -2
Query:   80 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1159
            DH    +FSFL            P N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N +V  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++ L  Y   +K L ++ C FV+D G+  +      LR LSI+ C ++T+  I+ ++   +++  +  R C  IT   ++ L      L+ +D+   C +   +  +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:   72 DHSMVQIFSFL------------PTNQLCRCARVCRRWYNLAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE 418          
BLAST of SMED30033623 vs. Ensembl Human
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 144.05 bits (362), Expect = 5.943e-37
Identity = 93/366 (25.41%), Postives = 188/366 (51.37%), Query Frame = -2
Query:   80 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1159
            DH    +FSFL            P N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N +V  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++ L  Y   +K L ++ C FV+D G+  +      LR LSI+ C ++T+  I+ ++   +++  +  R C  IT   ++ L      L+ +D+   C +   +  +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:   77 DHSMVQIFSFL------------PTNQLCRCARVCRRWYNLAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE 423          
BLAST of SMED30033623 vs. Ensembl Human
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 144.821 bits (364), Expect = 6.100e-37
Identity = 93/366 (25.41%), Postives = 188/366 (51.37%), Query Frame = -2
Query:   80 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1159
            DH    +FSFL            P N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N +V  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++ L  Y   +K L ++ C FV+D G+  +      LR LSI+ C ++T+  I+ ++   +++  +  R C  IT   ++ L      L+ +D+   C +   +  +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:  119 DHSMVQIFSFL------------PTNQLCRCARVCRRWYNLAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE 465          
BLAST of SMED30033623 vs. Ensembl Human
Match: FBXL20 (F-box and leucine rich repeat protein 20 [Source:HGNC Symbol;Acc:HGNC:24679])

HSP 1 Score: 88.9669 bits (219), Expect = 2.736e-18
Identity = 88/366 (24.04%), Postives = 169/366 (46.17%), Query Frame = -2
Query:   59 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT-FSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFIDPTPL 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV+NL       +A+   L   C ++  L+L+ C  I  + L ++  +  P+        L+ L++S+C Q+    I +       L+ L LK C  + D  +K +  +   L  L++  C  +TD+G+ ++    H L+ L  S C  IT+  + A+  +  ++  + +  CS +T      L RN   L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   +L+ I++ NC  I    L
Sbjct:   30 LPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSL-KALSEGCPL--------LEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASL 374          
BLAST of SMED30033623 vs. Ensembl Human
Match: FBXL20 (F-box and leucine rich repeat protein 20 [Source:HGNC Symbol;Acc:HGNC:24679])

HSP 1 Score: 88.9669 bits (219), Expect = 2.851e-18
Identity = 88/366 (24.04%), Postives = 169/366 (46.17%), Query Frame = -2
Query:   59 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT-FSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFIDPTPL 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV+NL       +A+   L   C ++  L+L+ C  I  + L ++  +  P+        L+ L++S+C Q+    I +       L+ L LK C  + D  +K +  +   L  L++  C  +TD+G+ ++    H L+ L  S C  IT+  + A+  +  ++  + +  CS +T      L RN   L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   +L+ I++ NC  I    L
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSL-KALSEGCPL--------LEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASL 372          
BLAST of SMED30033623 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 97.0561 bits (240), Expect = 3.222e-21
Identity = 94/382 (24.61%), Postives = 169/382 (44.24%), Query Frame = -2
Query:  179 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGI--------------------DTILKILSYRTP----------------------PFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---------------LKLIQSQIQYSPIFPRNTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEII-LRNCSSITFSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKI 1129
            L  ++L  +   L    LC  A+VC+ W  +  + + W ++D      D    + + +                    D+ L+  + R P                       +C+ L  ++L  C  ITD  +  I + CP L  +N++    +Q+  V  ++  C+ + TL L  C  + E               L L+Q   Q + I  +N  +    L++L +S C QI D  + S     + L+ L L  C ++ D G   LA+    L+ LD+  C  ++D  I+S+  N   LR LS+S C  IT+ SIQ +++ + +   ++ L NC  +T S+L  LR+   L+ IDL D   +S+++I +  +++R +++I
Sbjct:   60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQC-FQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCKALKRIDLYDCQNVSKEAIVRF-QHHRPNIEI 439          

HSP 2 Score: 67.0106 bits (162), Expect = 1.555e-11
Identity = 49/196 (25.00%), Postives = 100/196 (51.02%), Query Frame = -2
Query:   74 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 649
            NL+HL L  C+++ D+   +     ++L  L L+ C  ITD  MK +     +L YL+I+ C  + D+G+  ++ N   L  L +  C  +T N   ++      I ++ L  C  +T  +++ + N    L  + +S+  QIS +S+  + +++ ++LK+L ++    +       L + C +L+ +D+++C  I
Sbjct:  150 NLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHS-HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLI 344          

HSP 3 Score: 66.2402 bits (160), Expect = 2.192e-11
Identity = 55/205 (26.83%), Postives = 97/205 (47.32%), Query Frame = -2
Query:   53 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSLKL-LRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPT---PLRR 646
            LK L L  C  + DS + +F+     L  L L  C+ +TD   + L +Y   L YL++  C  +TD+ +  +      L  L+IS C  I +  +Q I ++   +  +ILR C  +T   F S++  +  ++ ++L    Q++  ++  IA N   +L+ L ++  + IS   L  L Q    LK +++  C  +      PL R
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIA-NGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLAR 328          
BLAST of SMED30033623 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 97.0561 bits (240), Expect = 3.222e-21
Identity = 94/382 (24.61%), Postives = 169/382 (44.24%), Query Frame = -2
Query:  179 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGI--------------------DTILKILSYRTP----------------------PFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---------------LKLIQSQIQYSPIFPRNTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEII-LRNCSSITFSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKI 1129
            L  ++L  +   L    LC  A+VC+ W  +  + + W ++D      D    + + +                    D+ L+  + R P                       +C+ L  ++L  C  ITD  +  I + CP L  +N++    +Q+  V  ++  C+ + TL L  C  + E               L L+Q   Q + I  +N  +    L++L +S C QI D  + S     + L+ L L  C ++ D G   LA+    L+ LD+  C  ++D  I+S+  N   LR LS+S C  IT+ SIQ +++ + +   ++ L NC  +T S+L  LR+   L+ IDL D   +S+++I +  +++R +++I
Sbjct:   60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQC-FQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCKALKRIDLYDCQNVSKEAIVRF-QHHRPNIEI 439          

HSP 2 Score: 67.0106 bits (162), Expect = 1.555e-11
Identity = 49/196 (25.00%), Postives = 100/196 (51.02%), Query Frame = -2
Query:   74 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 649
            NL+HL L  C+++ D+   +     ++L  L L+ C  ITD  MK +     +L YL+I+ C  + D+G+  ++ N   L  L +  C  +T N   ++      I ++ L  C  +T  +++ + N    L  + +S+  QIS +S+  + +++ ++LK+L ++    +       L + C +L+ +D+++C  I
Sbjct:  150 NLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHS-HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLI 344          

HSP 3 Score: 66.2402 bits (160), Expect = 2.192e-11
Identity = 55/205 (26.83%), Postives = 97/205 (47.32%), Query Frame = -2
Query:   53 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSLKL-LRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPT---PLRR 646
            LK L L  C  + DS + +F+     L  L L  C+ +TD   + L +Y   L YL++  C  +TD+ +  +      L  L+IS C  I +  +Q I ++   +  +ILR C  +T   F S++  +  ++ ++L    Q++  ++  IA N   +L+ L ++  + IS   L  L Q    LK +++  C  +      PL R
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIA-NGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLAR 328          
BLAST of SMED30033623 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 97.0561 bits (240), Expect = 3.222e-21
Identity = 94/382 (24.61%), Postives = 169/382 (44.24%), Query Frame = -2
Query:  179 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGI--------------------DTILKILSYRTP----------------------PFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---------------LKLIQSQIQYSPIFPRNTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEII-LRNCSSITFSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKI 1129
            L  ++L  +   L    LC  A+VC+ W  +  + + W ++D      D    + + +                    D+ L+  + R P                       +C+ L  ++L  C  ITD  +  I + CP L  +N++    +Q+  V  ++  C+ + TL L  C  + E               L L+Q   Q + I  +N  +    L++L +S C QI D  + S     + L+ L L  C ++ D G   LA+    L+ LD+  C  ++D  I+S+  N   LR LS+S C  IT+ SIQ +++ + +   ++ L NC  +T S+L  LR+   L+ IDL D   +S+++I +  +++R +++I
Sbjct:   60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQC-FQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCKALKRIDLYDCQNVSKEAIVRF-QHHRPNIEI 439          

HSP 2 Score: 67.0106 bits (162), Expect = 1.555e-11
Identity = 49/196 (25.00%), Postives = 100/196 (51.02%), Query Frame = -2
Query:   74 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 649
            NL+HL L  C+++ D+   +     ++L  L L+ C  ITD  MK +     +L YL+I+ C  + D+G+  ++ N   L  L +  C  +T N   ++      I ++ L  C  +T  +++ + N    L  + +S+  QIS +S+  + +++ ++LK+L ++    +       L + C +L+ +D+++C  I
Sbjct:  150 NLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHS-HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLI 344          

HSP 3 Score: 66.2402 bits (160), Expect = 2.192e-11
Identity = 55/205 (26.83%), Postives = 97/205 (47.32%), Query Frame = -2
Query:   53 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSLKL-LRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPT---PLRR 646
            LK L L  C  + DS + +F+     L  L L  C+ +TD   + L +Y   L YL++  C  +TD+ +  +      L  L+IS C  I +  +Q I ++   +  +ILR C  +T   F S++  +  ++ ++L    Q++  ++  IA N   +L+ L ++  + IS   L  L Q    LK +++  C  +      PL R
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIA-NGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLAR 328          
BLAST of SMED30033623 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 97.0561 bits (240), Expect = 3.222e-21
Identity = 94/382 (24.61%), Postives = 169/382 (44.24%), Query Frame = -2
Query:  179 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGI--------------------DTILKILSYRTP----------------------PFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---------------LKLIQSQIQYSPIFPRNTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEII-LRNCSSITFSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKI 1129
            L  ++L  +   L    LC  A+VC+ W  +  + + W ++D      D    + + +                    D+ L+  + R P                       +C+ L  ++L  C  ITD  +  I + CP L  +N++    +Q+  V  ++  C+ + TL L  C  + E               L L+Q   Q + I  +N  +    L++L +S C QI D  + S     + L+ L L  C ++ D G   LA+    L+ LD+  C  ++D  I+S+  N   LR LS+S C  IT+ SIQ +++ + +   ++ L NC  +T S+L  LR+   L+ IDL D   +S+++I +  +++R +++I
Sbjct:   60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQC-FQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCKALKRIDLYDCQNVSKEAIVRF-QHHRPNIEI 439          

HSP 2 Score: 67.0106 bits (162), Expect = 1.555e-11
Identity = 49/196 (25.00%), Postives = 100/196 (51.02%), Query Frame = -2
Query:   74 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 649
            NL+HL L  C+++ D+   +     ++L  L L+ C  ITD  MK +     +L YL+I+ C  + D+G+  ++ N   L  L +  C  +T N   ++      I ++ L  C  +T  +++ + N    L  + +S+  QIS +S+  + +++ ++LK+L ++    +       L + C +L+ +D+++C  I
Sbjct:  150 NLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHS-HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLI 344          

HSP 3 Score: 66.2402 bits (160), Expect = 2.192e-11
Identity = 55/205 (26.83%), Postives = 97/205 (47.32%), Query Frame = -2
Query:   53 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSLKL-LRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPT---PLRR 646
            LK L L  C  + DS + +F+     L  L L  C+ +TD   + L +Y   L YL++  C  +TD+ +  +      L  L+IS C  I +  +Q I ++   +  +ILR C  +T   F S++  +  ++ ++L    Q++  ++  IA N   +L+ L ++  + IS   L  L Q    LK +++  C  +      PL R
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIA-NGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLAR 328          
BLAST of SMED30033623 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 96.2857 bits (238), Expect = 4.791e-21
Identity = 94/382 (24.61%), Postives = 169/382 (44.24%), Query Frame = -2
Query:  179 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGI--------------------DTILKILSYRTP----------------------PFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---------------LKLIQSQIQYSPIFPRNTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEII-LRNCSSITFSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKI 1129
            L  ++L  +   L    LC  A+VC+ W  +  + + W ++D      D    + + +                    D+ L+  + R P                       +C+ L  ++L  C  ITD  +  I + CP L  +N++    +Q+  V  ++  C+ + TL L  C  + E               L L+Q   Q + I  +N  +    L++L +S C QI D  + S     + L+ L L  C ++ D G   LA+    L+ LD+  C  ++D  I+S+  N   LR LS+S C  IT+ SIQ +++ + +   ++ L NC  +T S+L  LR+   L+ IDL D   +S+++I +  +++R +++I
Sbjct:   60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQC-FQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCKALKRIDLYDCQNVSKEAIVRF-QHHRPNIEI 439          

HSP 2 Score: 66.6254 bits (161), Expect = 1.647e-11
Identity = 49/196 (25.00%), Postives = 100/196 (51.02%), Query Frame = -2
Query:   74 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 649
            NL+HL L  C+++ D+   +     ++L  L L+ C  ITD  MK +     +L YL+I+ C  + D+G+  ++ N   L  L +  C  +T N   ++      I ++ L  C  +T  +++ + N    L  + +S+  QIS +S+  + +++ ++LK+L ++    +       L + C +L+ +D+++C  I
Sbjct:  150 NLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHS-HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLI 344          

HSP 3 Score: 66.6254 bits (161), Expect = 2.034e-11
Identity = 55/205 (26.83%), Postives = 97/205 (47.32%), Query Frame = -2
Query:   53 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSLKL-LRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPT---PLRR 646
            LK L L  C  + DS + +F+     L  L L  C+ +TD   + L +Y   L YL++  C  +TD+ +  +      L  L+IS C  I +  +Q I ++   +  +ILR C  +T   F S++  +  ++ ++L    Q++  ++  IA N   +L+ L ++  + IS   L  L Q    LK +++  C  +      PL R
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIA-NGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLAR 328          
BLAST of SMED30033623 vs. Ensembl Fly
Match: Fbxl7 (gene:FBgn0038385 transcript:FBtr0083201)

HSP 1 Score: 101.679 bits (252), Expect = 3.115e-22
Identity = 107/451 (23.73%), Postives = 194/451 (43.02%), Query Frame = -2
Query:   83 PNDMMSPGCSKNLNKKT----SKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRT-PPFCYCLKVIDLS-KCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDD-------------------SCIH------SFSPVF-NRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 1339
            P    S G + N+   T    + I+ +ST +  P    S++       S+  P  +++  P         LF  L  + +  I   L   +LC+ ARVC+++  + W   +W  +     H    +N  K +  I + L  ++    C  ++ + L+  C+I+D  L  +  +CPEL  + L   + + N ++   +  C  +  L+++ C Q++    I       P  PR  +  L++LDL+ C  IDD                    CI        F P F   L++L + +C  ITD G+  LAK G  L+YL +A C  V+D G+  +    + LR L+   C  ++++SI            ++ R+C             LR +D+   C +S   +  +AE+   +LK L +   D I+   ++ +   C  L+ ++I++C
Sbjct:  334 PTGHHSSGGAGNVTNSTTASGAGIMASSTPTTTPRRGASSNGLGGGAASAIGPPPWNRKGP----FRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVISLRGEH----LNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSS---ISPNPHMEP--PRRLL--LQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSIT-----------VLARSCP-----------RLRALDIG-KCDVSDAGLRALAESCP-NLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDC 745          
BLAST of SMED30033623 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0113067)

HSP 1 Score: 93.2041 bits (230), Expect = 1.186e-19
Identity = 105/408 (25.74%), Postives = 186/408 (45.59%), Query Frame = -2
Query:   44 NHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQM-CVR--LKYIDIKNCKFIDPTPLRRHIV 1234
            N   S    S  Q   F      DD+  KQ     L  ++L  +   L V  LC CA+VCK W  +  + + W K++          +  + I+  +++ +S R   F   LK + L  CQ   D  ++ +AN C  +E ++L+    + + S   +   C ++  +NL  C  I  N LK +            +   NL  +++S+C  I ++ + + +    +LRK   K C+ I D  + CLAKY   L  L++  C  +TD  I  +  N H L++L +SKC  +T+ ++ ++S  N+ +  + +  C + T    + L RN   L  +DL +  QI+  ++  +A     SL+ L ++  + I+ + +R L    C    L  +++ NC  I    L  H+V
Sbjct:  213 NMAGSAQDQSEDQSQTFLGATELDDELIKQ-----LPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINL--------FDFQRDIEGPVIENISQRCRGF---LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLS-----------DGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLA-TGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTL-EHLV 591          
BLAST of SMED30033623 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0088088)

HSP 1 Score: 92.4337 bits (228), Expect = 1.366e-19
Identity = 106/420 (25.24%), Postives = 189/420 (45.00%), Query Frame = -2
Query:   44 STESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQM-CVR--LKYIDIKNCKFIDPTPLRRHIV 1270
            +T  +       N   S    S  Q   F      DD+  KQ     L  ++L  +   L V  LC CA+VCK W  +  + + W K++          +  + I+  +++ +S R   F   LK + L  CQ   D  ++ +AN C  +E ++L+    + + S   +   C ++  +NL  C  I  N LK           +  +   NL  +++S+C  I ++ + + +    +LRK   K C+ I D  + CLAKY   L  L++  C  +TD  I  +  N H L++L +SKC  +T+ ++ ++S  N+ +  + +  C + T    + L RN   L  +DL +  QI+  ++  +A     SL+ L ++  + I+ + +R L    C    L  +++ NC  I    L  H+V
Sbjct:   14 TTPDVGLADQQRNMAGSAQDQSEDQSQTFLGATELDDELIKQ-----LPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINL--------FDFQRDIEGPVIENISQRCRGF---LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLK-----------YLSDGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLA-TGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTL-EHLV 404          
BLAST of SMED30033623 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0330632)

HSP 1 Score: 91.6633 bits (226), Expect = 2.185e-19
Identity = 101/392 (25.77%), Postives = 183/392 (46.68%), Query Frame = -2
Query:   44 FSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQM-CVR--LKYIDIKNCKFIDPTPLRRHIV 1186
            F QT     + D + L   L  ++L  +   L V  LC CA+VCK W  +  + + W K++          +  + I+  +++ +S R   F   LK + L  CQ   D  ++ +AN C  +E ++L+    + + S   +   C ++  +NL  C  I  N LK +            +   NL  +++S+C  I ++ + + +    +LRK   K C+ I D  + CLAKY   L  L++  C  +TD  I  +  N H L++L +SKC  +T+ ++ ++S  N+ +  + +  C + T    + L RN   L  +DL +  QI+  ++  +A     SL+ L ++  + I+ + +R L    C    L  +++ NC  I    L  H+V
Sbjct:   11 FDQTFLGATELDDE-LIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINL--------FDFQRDIEGPVIENISQRCRGF---LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLS-----------DGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCP-SLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTL-EHLV 377          
BLAST of SMED30033623 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0113069)

HSP 1 Score: 91.2781 bits (225), Expect = 2.349e-19
Identity = 99/392 (25.26%), Postives = 182/392 (46.43%), Query Frame = -2
Query:   44 FSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQM-CVR--LKYIDIKNCKFIDPTPLRRHIV 1186
            F QT     + D + L   L  ++L  +   L V  LC CA+VCK W  +  + + W K++          +  + I+  +++ +S R   F   LK + L  CQ   D  ++ +AN C  +E ++L+    + + S   +   C ++  +NL  C  I  N LK +            +   NL  +++S+C  I ++ + + +    +LRK   K C+ I D  + CLAKY   L  L++  C  +TD  I  +  N H L++L +SKC  +T+ ++ ++S  N+ +  + +  C + T    + L    + L  +DL +  QI+  ++  +A     SL+ L ++  + I+ + +R L    C    L  +++ NC  I    L  H+V
Sbjct:   11 FDQTFLGATELDDE-LIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINL--------FDFQRDIEGPVIENISQRCRGF---LKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLS-----------DGCPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCP-SLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTL-EHLV 377          
BLAST of SMED30033623 vs. Ensembl Zebrafish
Match: si:dkey-192l18.9 (si:dkey-192l18.9 [Source:ZFIN;Acc:ZDB-GENE-120709-25])

HSP 1 Score: 128.642 bits (322), Expect = 1.173e-31
Identity = 103/410 (25.12%), Postives = 199/410 (48.54%), Query Frame = -2
Query:   56 PVSIHSNHQTS-NSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLK-LLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLR 1252
            P ++ +  ++S   T++   P   +++      H   +L   L   +L HIL  L    LC CARVC++WY++ W+  +W  +      N   +N     D  LK+L++R    TP  C  L+ +  S C +++D  L  IA  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L  +  +Q++P+  +     L++L+++ C  ++D  + + +    RL  L L+ C  ITD  ++ LA +   L+ L ++ C  V D G+  V      LR LS++ C +IT+  ++ ++    ++  +  R C  +T   L  L RN   LR ID+   C +   +  ++  +    L+ L +   ++++   L  L + C  L+ ++++ C  + P  LR
Sbjct:   62 PQTVPNGRESSLGETVALIHPPPATRSKSTKPPH--TALIDILPDPVLLHILSYLSTPHLCLCARVCRRWYNLSWDPRLWSTIRL----NGELLN----ADRALKVLTHRLCQDTPNVCLTLETVVASGCRRLSDRGLRVIARCCPELRCLEVAGCYNVSNDAVFDVVSKCPNLEHLDVSGCPKVTCISLTEEGSVQHTPLHGQQI--GLRYLNMTDCVSLEDKGLKTIAIHCPRLTHLYLRRCIRITDESLRQLALHCTALRELSLSDCHLVGDFGLREVARLEGRLRYLSVAHCMRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLSYLARNCPRLRSIDVG-RCPLVSDAGLEVLAHCCKMLRRLSLRGCESLTGRGLMALAEGCPELQLLNVQECD-VPPEALR 457          
BLAST of SMED30033623 vs. Ensembl Zebrafish
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:NCBI gene;Acc:569430])

HSP 1 Score: 120.168 bits (300), Expect = 1.164e-28
Identity = 91/366 (24.86%), Postives = 173/366 (47.27%), Query Frame = -2
Query:  218 SFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQS-QIQYSP------------------------------------IFPRNTV--------------DNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1135
            +FLQ  I +H    LP N LC CARVC++WY++ W+  +W  +  +      G  +H  +D  L++L+ R    TP  C  ++ + +S C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L +   ++ SP                                    ++ R  V                ++ L +S CR I D  +   + +  RLR L +  C  ITD G++ +AKY   L+YL+  GC  +TD GI  +  +   L+ L I KC  +++  ++ ++ ++  +  + L++C SIT   L+++     +L+++++ D C +S +++
Sbjct:  119 AFLQ--IFTH----LPTNQLCRCARVCRRWYNLAWDPRLWRTIRLT------GDVLH--VDRALRVLTRRLCQDTPNVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIAKLEGRLRYLSIAHCSRITDVGVRYVAKYCSRLRYLNARGCEGLTDHGIEHLAKSCLKLKSLDIGKCPLVSDAGLEQLALNSFNLKRLSLKSCESITGRGLQVVAANCFDLQLLNVQD-CDVSLEAL 469          

HSP 2 Score: 55.8398 bits (133), Expect = 7.703e-8
Identity = 59/272 (21.69%), Postives = 124/272 (45.59%), Query Frame = -2
Query:   74 LTLNIHLQNASVCHLIITCRRIHTL----NLSKCIQIN--------ELKLIQSQI-QYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGC----CFVTDKGISSVIMNLH----CLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 814
            L +  HL    +C     CRR + L     L + I++          L+++  ++ Q +P    N    ++ + +S CR++ D  +++ +     LR+L +  C  +++  +  +     +L++LD++GC    C    + +S  +  LH     +R L ++ C  + +  +  I+    Q+  + LR C  +T   L+ L      +R + +SD   IS   + +IA+     L+ L I     I+   +R + + C RL+Y++ + C+ +
Sbjct:  121 LQIFTHLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGDVLHVDRALRVLTRRLCQDTP----NVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIAKLE-GRLRYLSIAHCSRITDVGVRYVAKYCSRLRYLNARGCEGL 387          
BLAST of SMED30033623 vs. Ensembl Zebrafish
Match: fbxl2 (F-box and leucine-rich repeat protein 2 [Source:ZFIN;Acc:ZDB-GENE-030925-12])

HSP 1 Score: 83.9593 bits (206), Expect = 7.979e-17
Identity = 98/403 (24.32%), Postives = 170/403 (42.18%), Query Frame = -2
Query:   53 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHND-SG---INIHKGIDTILKILSYRT------------PPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---LKLIQSQIQYSPIFPRNTVD----NLKHL----------DLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRR 1159
            ++D+  +   L  ++L  I   L V  LC CA+V K W  +  + + W K+D      D  G    NI K     L+ LS R                C  ++ ++L+ C +ITD   I ++  C +L  ++LT  + + N ++  L   CR +  LNLS C QI       L +       +F R         LKHL          ++  C QI D    S     ++L+ + +  C  ITD  +  L      LK L+ A C  VTD G + +  N H + ++ + +C  +T+N++  +S    ++  + L +C  IT   ++ L +           +  Q   Q+ E +   L         +I+ E L+     C RL+ I++ +C+ +    ++R
Sbjct:   14 NNDEAPINKKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGSNWQKIDLFNFQTDIEGRVVENISKRCGGFLRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTCISLSKFCFKLRHLDLTSCVSITNHALKALSEGCRMLENLNLSWCDQITSDGIEALSRGCTALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSS----------SVCGQERLQVVELDNCPL-------ITDITLEHLKN----CQRLERIELYDCQQVSRAGIKR 395          
BLAST of SMED30033623 vs. Ensembl Zebrafish
Match: fbxl20 (F-box and leucine-rich repeat protein 20 [Source:ZFIN;Acc:ZDB-GENE-081031-27])

HSP 1 Score: 80.8777 bits (198), Expect = 6.859e-16
Identity = 89/351 (25.36%), Postives = 160/351 (45.58%), Query Frame = -2
Query:  233 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHND-SGI---NIHKGIDTILKILSYRT------------PPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSP----IFPRNTV----DNLKH----------LDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN-------LRIIDLSDNCQI 1159
            ++D+  +   L  ++L  I   L V  LC CA+V + W  +  + + W ++D      D  G    NI K     L+ LS R                C  ++++ L+ C +ITD     ++  CP+L+ ++L     + N S+  L   C  +  LN+S C Q+ +   IQ+ ++  P    +F +       + LKH          L+L  C QI D  + +     +RL+ L +  C  ITD  +  L +    L+ L++A C  +TD G +S+  N H L ++ + +C +IT+ ++  +S    ++  + L +C  IT   ++ L +       L +I+L DNC +
Sbjct:   18 NNDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTK-DGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCHELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITDDGIRQLGSGPCAHDRLEVIEL-DNCPL 366          

HSP 2 Score: 69.3218 bits (168), Expect = 4.446e-12
Identity = 51/192 (26.56%), Postives = 93/192 (48.44%), Query Frame = -2
Query:   83 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 646
            L+ L L  C  + DS + +F+     +  L L  C  ITD     L+K+   LK+LD+A C  +T+  + ++      L +L+IS C ++T + IQA+      +  + L+ C+ +   +LK +      L  ++L    QI+ + +  I     + L+ L ++   NI+   L  L Q C RL+ +++  C
Sbjct:   93 LRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNLQTCSQITDEGLITICRGC-HRLQSLCVSGCANITDAILNALGQNCPRLRILEVARC 283          
BLAST of SMED30033623 vs. Ensembl Zebrafish
Match: fbxl13 (F-box and leucine-rich repeat protein 13 [Source:ZFIN;Acc:ZDB-GENE-140106-120])

HSP 1 Score: 78.5666 bits (192), Expect = 8.276e-15
Identity = 97/388 (25.00%), Postives = 176/388 (45.36%), Query Frame = -2
Query:   80 PNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKI------------------LSYRTPPFCYCLKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIIT-CRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRI---IDLSDNCQISRQSIFQIAEN-NRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1171
            P  D  D  SL   L   +   I + L V DL  CA+VC+ W ++    ++W ++DFS    +S     + ++ IL++                  LS+R    C  L+ +DLS+C   +D+ +K I   C  L  +NL    H+ NA++  L    C  + +LNL+ CI  ++  L     QY  +        L+HL+LS C QI      S +   N L++++L +   +TD  ++ L      L  + +     ++D    +V   +  L ++ I     IT++S++A+  S  ++ E+ L  C  +T +  K L NL     +++S   +++   +  I E  +   L+ L ++    I+   LR + Q C+ L  + +  C+
Sbjct:  215 PQGDGQDNLSL---LPNRLFLKIFQSLGVRDLLKCAQVCQSWKAITQISSLWTEIDFSP---ESSWITDQMVERILRLHRVYVISVNLCGCNMVQRLSFRRISQCRNLQELDLSECPTVNDENMKMILEGCQSLLSLNLACT-HIANATIKVLASRCCVMLRSLNLAYCIHFSDKGL-----QY--LTTGTGCRRLRHLNLSGCSQITVDGFTSVAETCNSLQQIVLNDLPTLTDICVQVLVSRCRMLTVISLLESLNLSDVAFKAVAEVID-LTKILIEGNDVITDSSVKALCRSCLKLSELHLSCCPRVTDACFKTLGNLTKLCNLNISGCFKVTDMGLHYITEGPSAGQLRELDLSYCLKITDLSLRRISQKCISLTNLALCFCE 587          
BLAST of SMED30033623 vs. Ensembl Xenopus
Match: med13l (mediator complex subunit 13-like [Source:Xenbase;Acc:XB-GENE-6045769])

HSP 1 Score: 139.428 bits (350), Expect = 3.907e-35
Identity = 90/349 (25.79%), Postives = 182/349 (52.15%), Query Frame = -2
Query:   80 HILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1108
             I   LP N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N ++  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  ITD G++ +  Y   +K L ++ C FV+D G+  +      LR LSI+ C +IT+  I+ I+   +++  +  R C  IT   ++ L      L+ +D+   C +      +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:  123 QIFSYLPTNQLCRCARVCRRWYNIAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYIIAQCCPELRRLEVSNCYNISNEAIFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPMHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCIRITDEGLRYIMIYCTSIKELSVSDCRFVSDFGMREIAKLESRLRYLSIAHCGRITDVGIRYIAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDIGLEFLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCE 464          
BLAST of SMED30033623 vs. Ensembl Xenopus
Match: med13l (mediator complex subunit 13-like [Source:Xenbase;Acc:XB-GENE-6045769])

HSP 1 Score: 138.658 bits (348), Expect = 4.748e-35
Identity = 90/349 (25.79%), Postives = 182/349 (52.15%), Query Frame = -2
Query:   80 HILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1108
             I   LP N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N ++  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  ITD G++ +  Y   +K L ++ C FV+D G+  +      LR LSI+ C +IT+  I+ I+   +++  +  R C  IT   ++ L      L+ +D+   C +      +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:   91 QIFSYLPTNQLCRCARVCRRWYNIAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYIIAQCCPELRRLEVSNCYNISNEAIFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPMHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCIRITDEGLRYIMIYCTSIKELSVSDCRFVSDFGMREIAKLESRLRYLSIAHCGRITDVGIRYIAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDIGLEFLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCE 432          
BLAST of SMED30033623 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 95.1301 bits (235), Expect = 2.714e-20
Identity = 100/401 (24.94%), Postives = 184/401 (45.89%), Query Frame = -2
Query:   56 HQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSL-KLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFIDPTPLR 1231
            HQ  N  IS     +FS       ++D+  +   L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV+NL     + +A+   L   C ++  L+L+ C  I  L L ++  +  P         L+ L++S+C QI    I +       LR L LK C  + D  +K +  +   L  L++  C  +TD G+ ++    H L+ L  S C  IT++ + A+  +  ++  + +  CS +T   F++L K    L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   RL+ I++ NC  I    L 
Sbjct:    2 HQPMNGQIS-----MFS-------NNDEALINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSL-KAISEGCP--------QLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDASLE 369          
BLAST of SMED30033623 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 95.5153 bits (236), Expect = 3.351e-20
Identity = 91/361 (25.21%), Postives = 170/361 (47.09%), Query Frame = -2
Query:   74 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSL-KLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFI 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV+NL     + +A+   L   C ++  L+L+ C  I  L L ++  +  P         L+ L++S+C QI    I +       LR L LK C  + D  +K +  +   L  L++  C  +TD G+ ++    H L+ L  S C  IT++ + A+  +  ++  + +  CS +T   F++L K    L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   RL+ I++ NC  I
Sbjct:  107 LPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSL-KAISEGCP--------QLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLI 446          
BLAST of SMED30033623 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 93.9745 bits (232), Expect = 5.650e-20
Identity = 92/367 (25.07%), Postives = 171/367 (46.59%), Query Frame = -2
Query:   56 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSL-KLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFIDPTPLR 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV+NL     + +A+   L   C ++  L+L+ C  I  L L ++  +  P         L+ L++S+C QI    I +       LR L LK C  + D  +K +  +   L  L++  C  +TD G+ ++    H L+ L  S C  IT++ + A+  +  ++  + +  CS +T   F++L K    L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   RL+ I++ NC  I    L 
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSL-KAISEGCP--------QLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDASLE 373          
BLAST of SMED30033623 vs. Ensembl Mouse
Match: Fbxl7 (F-box and leucine-rich repeat protein 7 [Source:MGI Symbol;Acc:MGI:3052506])

HSP 1 Score: 144.05 bits (362), Expect = 6.831e-37
Identity = 94/366 (25.68%), Postives = 188/366 (51.37%), Query Frame = -2
Query:   80 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1159
            DH    +FSFL            P N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N +V  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++ L  Y   +K L ++ C FV+D G+  +      LR LSI+ C +IT+  I+ ++   +++  +  R C  IT   ++ L      L+ +D+   C +   +  +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:  119 DHSMVQIFSFL------------PTNQLCRCARVCRRWYNLAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCE 465          
BLAST of SMED30033623 vs. Ensembl Mouse
Match: Fbxl20 (F-box and leucine-rich repeat protein 20 [Source:MGI Symbol;Acc:MGI:1919444])

HSP 1 Score: 87.0409 bits (214), Expect = 8.698e-18
Identity = 87/366 (23.77%), Postives = 169/366 (46.17%), Query Frame = -2
Query:   59 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT-FSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFIDPTPL 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV++L       +A+   L   C ++  L+L+ C  I  + L ++  +  P+        L+ L++S+C Q+    I +       L+ L LK C  + D  +K +  +   L  L++  C  +TD+G+ ++    H L+ L  S C  IT+  + A+  +  ++  + +  CS +T      L RN   L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   +L+ I++ NC  I    L
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSL-KALSEGCPL--------LEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASL 372          
BLAST of SMED30033623 vs. Ensembl Mouse
Match: Fbxl2 (F-box and leucine-rich repeat protein 2 [Source:MGI Symbol;Acc:MGI:1919429])

HSP 1 Score: 80.8777 bits (198), Expect = 7.405e-16
Identity = 85/368 (23.10%), Postives = 166/368 (45.11%), Query Frame = -2
Query:   59 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCV---RLKYIDIKNCKFIDPTPL 1129
            L  ++L  I   L +  LC CA++ K W  +  + + W ++D          N    ++  +++ +S R   F   L+ + L  C  + D  L   A  C  +E +NL     + +++   L   C ++  L+L+ C+ +  + LK I    +           NL++L+LS+C QI    I +       L+ L+L+ C  + D  +K +  +   L  L++  C  +TD G+  +    H L+ L +S C  +T+ S+ A+  +  ++  +    CS +T +   LL RN   L  +DL +   I+  ++ Q++ +    L+ L ++  + I+ E +  L        RL+ +++ NC  +    L
Sbjct:   15 LPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDL--------FNFQTDVEGRVVENISKRCGGF---LRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCR-----------NLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQLSIHC-PKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDASL 359          
BLAST of SMED30033623 vs. Ensembl Mouse
Match: Fbxl2 (F-box and leucine-rich repeat protein 2 [Source:MGI Symbol;Acc:MGI:1919429])

HSP 1 Score: 80.8777 bits (198), Expect = 7.405e-16
Identity = 85/368 (23.10%), Postives = 166/368 (45.11%), Query Frame = -2
Query:   59 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCV---RLKYIDIKNCKFIDPTPL 1129
            L  ++L  I   L +  LC CA++ K W  +  + + W ++D          N    ++  +++ +S R   F   L+ + L  C  + D  L   A  C  +E +NL     + +++   L   C ++  L+L+ C+ +  + LK I    +           NL++L+LS+C QI    I +       L+ L+L+ C  + D  +K +  +   L  L++  C  +TD G+  +    H L+ L +S C  +T+ S+ A+  +  ++  +    CS +T +   LL RN   L  +DL +   I+  ++ Q++ +    L+ L ++  + I+ E +  L        RL+ +++ NC  +    L
Sbjct:   15 LPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDL--------FNFQTDVEGRVVENISKRCGGF---LRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCR-----------NLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQLSIHC-PKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDASL 359          
BLAST of SMED30033623 vs. Ensembl Mouse
Match: Fbxl14 (F-box and leucine-rich repeat protein 14 [Source:MGI Symbol;Acc:MGI:2141676])

HSP 1 Score: 76.2554 bits (186), Expect = 2.100e-14
Identity = 89/367 (24.25%), Postives = 150/367 (40.87%), Query Frame = -2
Query:  281 DILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMW----YKLDFSQCHNDSGINIH-KGIDTILKILSYRTP----------------PFCY----------------CLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE-----------------LKLIQSQIQ-------YSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGC-------------------------CFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLK 1120
            ++L+ I   L V D    A+VC  W    +++++W     KL   + +     ++  +GI  + +ILS R                    CY                 L+ ++LS C QITD  L +IA     LEV+ L    ++ N  +  +    +R+ +LNL  C  +++                 L L Q  +Q        S       +  L+ L+LS+C  I D+ +   S +   LR L L+ C  I+D G+  LA   L L  LD++ C                         C ++D GI+ ++  +H LR L+I +C +IT+  ++ I+   +Q+  I L  C+ IT   L+
Sbjct:   11 ELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRV-QILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHM-GSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLE 375          

HSP 2 Score: 67.3958 bits (163), Expect = 1.634e-11
Identity = 57/209 (27.27%), Postives = 102/209 (48.80%), Query Frame = -2
Query:   59 NLKHLDLSYCRQIDDSCI-HSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSI---QAISTSNNQIC----EIILRNCSSITFSSLK----LLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPL 649
            N++ L+LS C  + D+ + H+F      LR L L  C+ ITD  +  +A+Y   L+ L++ GC  +T+ G+  +   L  L+ L++  C  +++  I     ++ S  + C    ++ L++C  +T  SLK     L  LR+++LS    IS   +  ++     SL+ L +   DNIS   +  L    +RL  +D+  C  +    L
Sbjct:   91 NIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMG--SLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSL 297          
BLAST of SMED30033623 vs. UniProt/SwissProt
Match: sp|Q9UJT9|FBXL7_HUMAN (F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.930e-36
Identity = 93/366 (25.41%), Postives = 188/366 (51.37%), Query Frame = -2
Query:   80 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1159
            DH    +FSFL            P N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N +V  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++ L  Y   +K L ++ C FV+D G+  +      LR LSI+ C ++T+  I+ ++   +++  +  R C  IT   ++ L      L+ +D+   C +   +  +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:  119 DHSMVQIFSFL------------PTNQLCRCARVCRRWYNLAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE 465          
BLAST of SMED30033623 vs. UniProt/SwissProt
Match: sp|Q5BJ29|FBXL7_MOUSE (F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.778e-36
Identity = 94/366 (25.68%), Postives = 188/366 (51.37%), Query Frame = -2
Query:   80 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCK 1159
            DH    +FSFL            P N LC CARVC++WY++ W+  +W  +  +       IN+ + +  + + L   TP  C  L+ + +S C ++TD  L  IA  CPEL  + ++   ++ N +V  ++  C  +  L++S C ++  + L  ++ I+ SP+  +    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++ L  Y   +K L ++ C FV+D G+  +      LR LSI+ C +IT+  I+ ++   +++  +  R C  IT   ++ L      L+ +D+   C +   +  +    N ++LK L +   ++I+ + L+ +   C  L+ +++++C+
Sbjct:  119 DHSMVQIFSFL------------PTNQLCRCARVCRRWYNLAWDPRLWRTIRLT----GETINVDRALKVLTRRLCQDTPNVCLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQI--SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIG-KCPLVSDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCE 465          
BLAST of SMED30033623 vs. UniProt/SwissProt
Match: sp|A1A5X2|FBXL7_DANRE (F-box/LRR-repeat protein 7 OS=Danio rerio OX=7955 GN=fbxl7 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 8.786e-28
Identity = 91/366 (24.86%), Postives = 173/366 (47.27%), Query Frame = -2
Query:  218 SFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQS-QIQYSP------------------------------------IFPRNTV--------------DNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1135
            +FLQ  I +H    LP N LC CARVC++WY++ W+  +W  +  +      G  +H  +D  L++L+ R    TP  C  ++ + +S C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L +   ++ SP                                    ++ R  V                ++ L +S CR I D  +   + +  RLR L +  C  ITD G++ +AKY   L+YL+  GC  +TD GI  +  +   L+ L I KC  +++  ++ ++ ++  +  + L++C SIT   L+++     +L+++++ D C +S +++
Sbjct:  119 AFLQ--IFTH----LPTNQLCRCARVCRRWYNLAWDPRLWRTIRLT------GDVLH--VDRALRVLTRRLCQDTPNVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIAKLEGRLRYLSIAHCSRITDVGVRYVAKYCSRLRYLNARGCEGLTDHGIEHLAKSCLKLKSLDIGKCPLVSDAGLEQLALNSFNLKRLSLKSCESITGRGLQVVAANCFDLQLLNVQD-CDVSLEAL 469          

HSP 2 Score: 55.8398 bits (133), Expect = 5.815e-7
Identity = 59/272 (21.69%), Postives = 124/272 (45.59%), Query Frame = -2
Query:   74 LTLNIHLQNASVCHLIITCRRIHTL----NLSKCIQIN--------ELKLIQSQI-QYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGC----CFVTDKGISSVIMNLH----CLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 814
            L +  HL    +C     CRR + L     L + I++          L+++  ++ Q +P    N    ++ + +S CR++ D  +++ +     LR+L +  C  +++  +  +     +L++LD++GC    C    + +S  +  LH     +R L ++ C  + +  +  I+    Q+  + LR C  +T   L+ L      +R + +SD   IS   + +IA+     L+ L I     I+   +R + + C RL+Y++ + C+ +
Sbjct:  121 LQIFTHLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGDVLHVDRALRVLTRRLCQDTP----NVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIAKLE-GRLRYLSIAHCSRITDVGVRYVAKYCSRLRYLNARGCEGL 387          
BLAST of SMED30033623 vs. UniProt/SwissProt
Match: sp|P34284|FBXL_CAEEL (F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 6.095e-20
Identity = 94/382 (24.61%), Postives = 169/382 (44.24%), Query Frame = -2
Query:  179 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGI--------------------DTILKILSYRTP----------------------PFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINE---------------LKLIQSQIQYSPIFPRNTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEII-LRNCSSITFSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKI 1129
            L  ++L  +   L    LC  A+VC+ W  +  + + W ++D      D    + + +                    D+ L+  + R P                       +C+ L  ++L  C  ITD  +  I + CP L  +N++    +Q+  V  ++  C+ + TL L  C  + E               L L+Q   Q + I  +N  +    L++L +S C QI D  + S     + L+ L L  C ++ D G   LA+    L+ LD+  C  ++D  I+S+  N   LR LS+S C  IT+ SIQ +++ + +   ++ L NC  +T S+L  LR+   L+ IDL D   +S+++I +  +++R +++I
Sbjct:   60 LPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQC-FQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLRHCKALKRIDLYDCQNVSKEAIVRF-QHHRPNIEI 439          

HSP 2 Score: 66.6254 bits (161), Expect = 2.095e-10
Identity = 49/196 (25.00%), Postives = 100/196 (51.02%), Query Frame = -2
Query:   74 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 649
            NL+HL L  C+++ D+   +     ++L  L L+ C  ITD  MK +     +L YL+I+ C  + D+G+  ++ N   L  L +  C  +T N   ++      I ++ L  C  +T  +++ + N    L  + +S+  QIS +S+  + +++ ++LK+L ++    +       L + C +L+ +D+++C  I
Sbjct:  150 NLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHS-HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLI 344          

HSP 3 Score: 66.6254 bits (161), Expect = 2.587e-10
Identity = 55/205 (26.83%), Postives = 97/205 (47.32%), Query Frame = -2
Query:   53 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT---FSSLKL-LRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPT---PLRR 646
            LK L L  C  + DS + +F+     L  L L  C+ +TD   + L +Y   L YL++  C  +TD+ +  +      L  L+IS C  I +  +Q I ++   +  +ILR C  +T   F S++  +  ++ ++L    Q++  ++  IA N   +L+ L ++  + IS   L  L Q    LK +++  C  +      PL R
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIA-NGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLAR 328          
BLAST of SMED30033623 vs. UniProt/SwissProt
Match: sp|Q96IG2|FXL20_HUMAN (F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 1.369e-17
Identity = 88/366 (24.04%), Postives = 169/366 (46.17%), Query Frame = -2
Query:   59 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSIT-FSSLKLLRN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELF-QMCV--RLKYIDIKNCKFIDPTPL 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D+ L   A  C  +EV+NL       +A+   L   C ++  L+L+ C  I  + L ++  +  P+        L+ L++S+C Q+    I +       L+ L LK C  + D  +K +  +   L  L++  C  +TD+G+ ++    H L+ L  S C  IT+  + A+  +  ++  + +  CS +T      L RN   L  +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   +L+ I++ NC  I    L
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSL-KALSEGCPL--------LEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASL 372          
BLAST of SMED30033623 vs. TrEMBL
Match: A0A4Y2B503 (F-box/LRR-repeat protein 7 OS=Araneus ventricosus OX=182803 GN=Fbxl7_1 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.031e-37
Identity = 106/376 (28.19%), Postives = 191/376 (50.80%), Query Frame = -2
Query:   83 KQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI---------------QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 1150
            K SLF  L  +++  I   L  N LC CARVC++WY + W   +W  +    C +   IN+ +G+ T+ ++L   +P  C  ++ I LS C ++TD  L+ IA KCPEL+ + +     + NA +  ++  C  +  L+L+ C Q+  ++                  S +   P    +    L++LDL+ C  ++D  + +      +L  L L+ C  ITDGG+K +A Y   LK L I+ C  VTD GI  +      LR LS++KC +I++  I+ I+    ++  + +R C +++  S++LL      LR +D+   C ++   +  ++E+   +LK L +   D I+ + ++ +   C  L+ ++I++C
Sbjct:  174 KSSLFDRLPDELILRIFSFLSSNQLCVCARVCRRWYFLAWEPQLWTTV----CLSSEKINVDRGLKTLFRLLCRDSPTVCLAVERISLSGCGKLTDKGLLTIARKCPELKTLEIKGCSLVTNAGIAEVMARCVSVARLDLTGCQQVTTIQPRSISSDRSDSVLDHPSSSALHLPPQIVHHHQLFLQYLDLTDCYCLEDLGLITILRNSPQLSHLYLRRCVQITDGGVKAIASYCTMLKELSISDCILVTDFGIYELAKLGSNLRYLSVAKCDQISDAGIKQIARHCYRLRYLNVRGCEAVSDHSMELLARSCSRLRALDIG-KCDVTDSGLRVLSEHCP-NLKKLSVKSCDLITDQGIQSIAFYCRGLQQLNIQDC 543          
BLAST of SMED30033623 vs. TrEMBL
Match: V4A9T7 (F-box domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_164359 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.033e-37
Identity = 107/362 (29.56%), Postives = 193/362 (53.31%), Query Frame = -2
Query:   83 KQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVD-NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 1150
            K S F  L  D++  I   LP + LC C+RV ++WY  VW   +W K+      N+S I+I K I  + K LSY TP  C  L+ ++L+ C+ +TD  L  IA +CPEL  + L    ++ N +V  L+  C  +  L+LS C  +  + L+   + +    PR+     L++LD++ C  +DD  +   +   ++L+ L L+ C  +TD  M+ LA Y   L+ L ++ C  +TD G+  +      LR LS++KC ++++  ++ ++   +++  + +R C  ++  SL+LL      LR +D+   C IS Q +  +++N    L+ L +   D+I+ + + +L   C  L+ ++I++C
Sbjct:   26 KPSSFDHLPDDVVLKIFSYLPSDHLCRCSRVSRRWYEFVWEPFLWTKIVI----NNSVIDIDKAIKILTKRLSYNTPYVCVILERVNLNGCEMLTDKGLYTIAKRCPELRHLQLQGCHNISNMAVFELVSNCVNLEHLDLSGCPSVTCISLLDGGLSHGA--PRHQQQIYLRYLDMTDCFALDDDGLGVIAMHCSQLQFLYLRRCVQLTDESMQYLANYCSTLRELSVSDCRNITDLGLRDLSKLGDNLRYLSVAKCDRMSDVGVRYLAKFCSKLRYLNVRGCEGVSDESLELLSASCPRLRSLDVG-KCDISDQGLVVLSQNCP-QLRKLSLKACDSITDKGVVQLAYYCRGLQQLNIQDC 379          
BLAST of SMED30033623 vs. TrEMBL
Match: A0A1S3HGJ8 (F-box/LRR-repeat protein 7-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154362 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.234e-36
Identity = 102/361 (28.25%), Postives = 195/361 (54.02%), Query Frame = -2
Query:   83 SLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVD-NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 1144
            SLF     D++  I + LP + LC CARVCK+WY++VW  ++W ++      N+   NI + +  + + LSY TP  C  ++ I+++ C+ +TD  L  IA +CPEL  + +    ++ N ++  ++  C  +  LN++ C  I  + L   +++QY     +N     L+HLD++ C  ++DS +   +    +L+ + L+ C  ITD G++ +A Y   LK   ++ C  VTD G+  +      LR LS++KC K+++  ++ I+    ++  + +R C +++  +L+LL    R L+ +D+   C ++ + +  +AE+    LK L +   D I+   +  + Q C  L+ ++I++C
Sbjct:  303 SLFDLCPDDVILKIFQHLPTDQLCRCARVCKRWYTLVWEPSLWTQITI----NNEIANIDRALKFLTRRLSYNTPHVCIMVEKINMNSCERLTDKGLHLIAKRCPELRHLEIQGCANITNLALFEVVSRCTNLEHLNVTGCALITCISLTPDAKLQYG----QNPCTIYLRHLDMTDCYALEDSGLKIIASHCTQLQYMYLRRCMRITDIGVQAIALYCTMLKEFSVSDCRRVTDFGLRELSKLGSSLRYLSVAKCDKVSDVGVKYIAKYCKKLRYLNVRGCEAVSDDALQLLAENCRRLKSLDVG-KCDVTDEGLEILAEHCP-QLKKLSLKSCDAITDSGVVAIAQKCRHLQQLNIQDC 653          
BLAST of SMED30033623 vs. TrEMBL
Match: A0A3B3SD40 (F-box domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.831e-36
Identity = 113/453 (24.94%), Postives = 221/453 (48.79%), Query Frame = -2
Query:   83 YESKSSFVALPNDMMSPGCSKNLNKKTSK-------ILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDD-------DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 1369
            Y S+    +  +  +S G + +  +KT K       IL  S++S  P++  +   +SN + S +   +     P D        D + ++  + L   +L  I   LP + LC CARVC++WY + W+  +W  +         G  +H  ID  L++L+ R    TP  C  L+ + +S C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L  ++ ++ SP   R    ++++LD++ C  ++D  +H+ +    +L  L L+ C  +TD G++CL  Y   ++ L ++ C FV+D G+  +      LR LS++ C +IT+  ++ I+    Q+  +  R C  +T   L+ L      L+ +D+   C +   +  ++   + + LK L +   ++I+   LR L   C  L+ +++++C
Sbjct:    9 YGSEGKISSSVSSDVSSGGTDHTPEKTPKDACTEEVILTPSSDSQSPLTSLNGRTSSNYSSSVTAETVALVHSPPDSPKTHIGSDKEHRTPINRLPDHVLLQIFACLPTDQLCRCARVCRRWYDLAWDPRLWRTIRLP------GELLH--IDRALRVLTSRLCQDTPNVCLMLETVVVSCCRRLTDRSLYTLAQYCPELRRLEMAGCYNISNEAVFEVVSRCPNLEHLDISGCSKVTCISLTREASLKLSPAHGRQI--SIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCARLTDEGLRCLVLYCPGVRELSVSDCRFVSDFGLREIAKLEARLRYLSVAHCSRITDVGLRYIAKYCGQLRYVNARGCEGLTDHGLEYLAKSCPRLKSLDVG-KCPLVSDAGLELLALHCFHLKRLSLKACESITDRGLRVLAANCFDLQLLNVQDC 450          
BLAST of SMED30033623 vs. TrEMBL
Match: A0A1S3HDN6 (F-box/LRR-repeat protein 7-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154362 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.884e-36
Identity = 102/361 (28.25%), Postives = 195/361 (54.02%), Query Frame = -2
Query:   83 SLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVD-NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 1144
            SLF     D++  I + LP + LC CARVCK+WY++VW  ++W ++      N+   NI + +  + + LSY TP  C  ++ I+++ C+ +TD  L  IA +CPEL  + +    ++ N ++  ++  C  +  LN++ C  I  + L   +++QY     +N     L+HLD++ C  ++DS +   +    +L+ + L+ C  ITD G++ +A Y   LK   ++ C  VTD G+  +      LR LS++KC K+++  ++ I+    ++  + +R C +++  +L+LL    R L+ +D+   C ++ + +  +AE+    LK L +   D I+   +  + Q C  L+ ++I++C
Sbjct:  329 SLFDLCPDDVILKIFQHLPTDQLCRCARVCKRWYTLVWEPSLWTQITI----NNEIANIDRALKFLTRRLSYNTPHVCIMVEKINMNSCERLTDKGLHLIAKRCPELRHLEIQGCANITNLALFEVVSRCTNLEHLNVTGCALITCISLTPDAKLQYG----QNPCTIYLRHLDMTDCYALEDSGLKIIASHCTQLQYMYLRRCMRITDIGVQAIALYCTMLKEFSVSDCRRVTDFGLRELSKLGSSLRYLSVAKCDKVSDVGVKYIAKYCKKLRYLNVRGCEAVSDDALQLLAENCRRLKSLDVG-KCDVTDEGLEILAEHCP-QLKKLSLKSCDAITDSGVVAIAQKCRHLQQLNIQDC 679          
BLAST of SMED30033623 vs. Ensembl Cavefish
Match: si:dkey-192l18.9 (F-box/LRR-repeat protein 7-like [Source:NCBI gene;Acc:103043891])

HSP 1 Score: 142.51 bits (358), Expect = 1.780e-36
Identity = 112/452 (24.78%), Postives = 207/452 (45.80%), Query Frame = -2
Query:   56 FINPYESKSSFVALPNDMMSPGCSKNLNKKTSKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQ-SQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLR 1381
             ++P  S  S   +PN   SP  S  +  +T  I+               H   ++ +S           P+   H    L  FL   +L  +   L    LC CARVC++WY++ W+  +W  +        +G ++H   D  LKIL++R    TP  C  L+ +  S C +++D  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L Q + +Q SPI  + T   L++LD+  C  ++D  +H+ +    RL  L L+ C  ++D  ++ LA +   L+ L ++ C  ++D G+  V      LR LS++ C +IT+  ++ ++    ++  +  R C  +T   L  L      LR +D+   C +      +I  +    L+ L +   +++    LR L   C  L+ ++++ C+ + P  LR
Sbjct:   56 ILSPRSSPLSPQTVPNGHESPSPSSTIPGETVAIV---------------HAPPSTQVSKR---------PSKTHHTP--LIDFLPDPVLLQVFSHLSTPQLCRCARVCRRWYNLAWDPRLWRTIQL------TGESLHA--DRALKILTHRLCQDTPNVCLTLETVVASGCRRLSDRGLHVVAQSCPELRRLEVAGCYNVTNEAVFDVVSRCPNLEHLDVSGCPKVTCISLTQETSVQLSPIQGQQT--GLRYLDMGDCVSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLALHCPALRELSLSDCRLISDFGLREVARMEGRLRYLSVAHCTRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLGHLARSCPRLRSLDVG-RCPLVSDMGLEILAHCCPGLRRLSLRGCESVIGRGLRALAAGCPELQMLNVQECE-VPPEALR 469          
BLAST of SMED30033623 vs. Ensembl Cavefish
Match: si:dkey-192l18.9 (F-box/LRR-repeat protein 7-like [Source:NCBI gene;Acc:103043891])

HSP 1 Score: 142.51 bits (358), Expect = 1.873e-36
Identity = 112/452 (24.78%), Postives = 207/452 (45.80%), Query Frame = -2
Query:   56 FINPYESKSSFVALPNDMMSPGCSKNLNKKTSKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQ-SQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLR 1381
             ++P  S  S   +PN   SP  S  +  +T  I+               H   ++ +S           P+   H    L  FL   +L  +   L    LC CARVC++WY++ W+  +W  +        +G ++H   D  LKIL++R    TP  C  L+ +  S C +++D  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L Q + +Q SPI  + T   L++LD+  C  ++D  +H+ +    RL  L L+ C  ++D  ++ LA +   L+ L ++ C  ++D G+  V      LR LS++ C +IT+  ++ ++    ++  +  R C  +T   L  L      LR +D+   C +      +I  +    L+ L +   +++    LR L   C  L+ ++++ C+ + P  LR
Sbjct:   59 ILSPRSSPLSPQTVPNGHESPSPSSTIPGETVAIV---------------HAPPSTQVSKR---------PSKTHHTP--LIDFLPDPVLLQVFSHLSTPQLCRCARVCRRWYNLAWDPRLWRTIQL------TGESLHA--DRALKILTHRLCQDTPNVCLTLETVVASGCRRLSDRGLHVVAQSCPELRRLEVAGCYNVTNEAVFDVVSRCPNLEHLDVSGCPKVTCISLTQETSVQLSPIQGQQT--GLRYLDMGDCVSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLALHCPALRELSLSDCRLISDFGLREVARMEGRLRYLSVAHCTRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLGHLARSCPRLRSLDVG-RCPLVSDMGLEILAHCCPGLRRLSLRGCESVIGRGLRALAAGCPELQMLNVQECE-VPPEALR 472          
BLAST of SMED30033623 vs. Ensembl Cavefish
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:NCBI gene;Acc:569430])

HSP 1 Score: 118.627 bits (296), Expect = 2.485e-28
Identity = 88/368 (23.91%), Postives = 175/368 (47.55%), Query Frame = -2
Query:  218 SFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQ-SQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSF----------------------------------------------------SPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1135
            +FLQ  I SH    LP N LC CARVC++WY++ W+  +W  +  +      G  +H  +D  L++L+ R    TP  C  L+ + +S C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C ++  + L Q + ++ SP+  +    ++++LD++ C  ++D  +H+                                                     + +   LR L +  C  ITD G++ +AKY + L+YL+  GC  +TD GI  +  +   L+ L I KC  +++  ++ ++ ++  +  + ++ C SIT   L+++     +L+++++ D C +  +++
Sbjct:   89 AFLQ--IFSH----LPTNQLCRCARVCRRWYNLAWDPRLWRTVQLA------GDVLH--VDRALRVLTRRLCQDTPNVCLTLETVVVSGCRRLTDRGLYTVAQCCPELRRLEMAGCYNVSNEAVFEVVSRCPNLEHLDISGCSKVTCISLTQEASVKLSPLHGQQI--SIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCTSIRELSVSDCRFVSDFGLREIAKLEGHLRYLSIAHCGRITDVGVRYIAKYCIRLRYLNARGCEGLTDHGIEHLAKSCLKLKSLDIGKCPLVSDAGLELLALNSFNLKRLSVKACESITGRGLQVVAANCFDLQLLNVQD-CDVPLEAL 439          

HSP 2 Score: 60.077 bits (144), Expect = 3.545e-9
Identity = 59/267 (22.10%), Postives = 124/267 (46.44%), Query Frame = -2
Query:   74 HLQNASVCHLIITCRRIHTL----NLSKCIQI--------NELKLIQSQI-QYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGC----CFVTDKGISSVIMNLH----CLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 799
            HL    +C     CRR + L     L + +Q+          L+++  ++ Q +P    N    L+ + +S CR++ D  +++ +     LR+L +  C  +++  +  +     +L++LDI+GC    C    +  S  +  LH     +R L ++ C  + +  +  I+    Q+  + LR C  +T   L+ L     ++R + +SD   +S   + +IA+   + L+ L I     I+   +R + + C+RL+Y++ + C+ +
Sbjct:   96 HLPTNQLCRCARVCRRWYNLAWDPRLWRTVQLAGDVLHVDRALRVLTRRLCQDTP----NVCLTLETVVVSGCRRLTDRGLYTVAQCCPELRRLEMAGCYNVSNEAVFEVVSRCPNLEHLDISGCSKVTCISLTQEASVKLSPLHGQQISIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCTSIRELSVSDCRFVSDFGLREIAKLEGH-LRYLSIAHCGRITDVGVRYIAKYCIRLRYLNARGCEGL 357          
BLAST of SMED30033623 vs. Ensembl Cavefish
Match: fbxl7 (F-box and leucine-rich repeat protein 7 [Source:NCBI gene;Acc:569430])

HSP 1 Score: 118.627 bits (296), Expect = 1.046e-27
Identity = 90/366 (24.59%), Postives = 173/366 (47.27%), Query Frame = -2
Query:  218 SFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKC-------------IQINELKLIQSQIQY------------------------SPIFPRNTV--------------DNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1135
            +FLQ  I SH    LP N LC CARVC++WY++ W+  +W  +  +      G  +H  +D  L++L+ R    TP  C  L+ + +S C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  L++S C             ++++ L   Q  I+Y                        + ++ R  V               +++ L +S CR + D  +   + +   LR L +  C  ITD G++ +AKY + L+YL+  GC  +TD GI  +  +   L+ L I KC  +++  ++ ++ ++  +  + ++ C SIT   L+++     +L+++++ D C +  +++
Sbjct:  318 AFLQ--IFSH----LPTNQLCRCARVCRRWYNLAWDPRLWRTVQLA------GDVLH--VDRALRVLTRRLCQDTPNVCLTLETVVVSGCRRLTDRGLYTVAQCCPELRRLEMAGCYNVSNEAVFEVVSRCPNLEHLDISGCSKVTCISLTQEASVKLSPLHGQQISIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCTSIRELSVSDCRFVSDFGLREIAKLEGHLRYLSIAHCGRITDVGVRYIAKYCIRLRYLNARGCEGLTDHGIEHLAKSCLKLKSLDIGKCPLVSDAGLELLALNSFNLKRLSVKACESITGRGLQVVAANCFDLQLLNVQD-CDVPLEAL 668          

HSP 2 Score: 62.003 bits (149), Expect = 1.170e-9
Identity = 60/267 (22.47%), Postives = 125/267 (46.82%), Query Frame = -2
Query:   74 HLQNASVCHLIITCRRIHTL----NLSKCIQI--------NELKLIQSQI-QYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVT----DKGISSVIMNLHC----LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 799
            HL    +C     CRR + L     L + +Q+          L+++  ++ Q +P    N    L+ + +S CR++ D  +++ +     LR+L +  C  +++  +  +     +L++LDI+GC  VT     +  S  +  LH     +R L ++ C  + +  +  I+    Q+  + LR C  +T   L+ L     ++R + +SD   +S   + +IA+   + L+ L I     I+   +R + + C+RL+Y++ + C+ +
Sbjct:  325 HLPTNQLCRCARVCRRWYNLAWDPRLWRTVQLAGDVLHVDRALRVLTRRLCQDTP----NVCLTLETVVVSGCRRLTDRGLYTVAQCCPELRRLEMAGCYNVSNEAVFEVVSRCPNLEHLDISGCSKVTCISLTQEASVKLSPLHGQQISIRYLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRFLVIYCTSIRELSVSDCRFVSDFGLREIAKLEGH-LRYLSIAHCGRITDVGVRYIAKYCIRLRYLNARGCEGL 586          
BLAST of SMED30033623 vs. Ensembl Cavefish
Match: fbxl20 (F-box and leucine rich repeat protein 20 [Source:NCBI gene;Acc:103040563])

HSP 1 Score: 80.4925 bits (197), Expect = 8.265e-16
Identity = 83/373 (22.25%), Postives = 168/373 (45.04%), Query Frame = -2
Query:   56 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRI----------IDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQM-CV--RLKYIDIKNCKFIDPTPLR 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D          +  + I+  +++ +S R   F   L+ + L  C  + D  L   A  C  +E+++L     + +++   L   C ++  L+L+ C  I  L L ++  +  P+        L+ L++S+C Q+    I +       L+ L LK C  + D  +K +  +   L  L++  C  +TD+G+ ++    H L+ L +S C  IT+  + A+            +NC  + ++ +   +++ I          +DL +  QI+  ++ Q++ +    L++L ++  + I+ + +R L    C   RL+ I++ NC  I    L 
Sbjct:   14 LPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDL--------FDFQRDIEGRVVENISKRCGGF---LRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSL-KALSEGCPL--------LEQLNISWCDQVTKDGIQALVRCCPGLKGLFLKGCTQLEDEALKHIGAHCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILNALG-----------QNCPRLRYTHVHTRKHIDIKCCNCHELEKMDLEECVQITDATLIQLSIHC-PRLQVLSLSHCELITDDGIRHLGSGPCAHDRLEVIELDNCPLITDASLE 354          
BLAST of SMED30033623 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 150.214 bits (378), Expect = 2.403e-40
Identity = 97/367 (26.43%), Postives = 181/367 (49.32%), Query Frame = -2
Query:   56 FLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHND-SGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLI-QSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC-LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLR 1132
            +L   ++  +L  LPV  LC  ARVC++WY +VW+  +W  +   +  ++ SG N+ + +D +   L   TP  C  L+ + LS    + D  L+ +A +CPEL  + ++    + N  +  ++  C  +  L++S C +I  + LI ++  Q  P+  R+ +  L+HLD+S C  + D  + + +    RL +L L+ C  + DGG++ LA++   L+ L +  C   TD G+  V   L   LR LS++ C ++T+ +++ +      +  +  R C  +T   L+ L      LR +D+   C +      ++       LK L +   + +S   LR +   C  L+ + +++C  + P  LR
Sbjct:   39 WLPDAVMLRVLTHLPVESLCRSARVCRRWYWLVWDPRLWQTVQLGRPWDEGSGPNVERALDALTARLCRDTPFVCLSLETLVLSGSPALGDAGLLTVARRCPELRRLEVSGCGEISNRGLLEVVTRCPNLEHLDVSDCPEITCVSLIPEASCQACPLHSRHLL--LRHLDMSGCSGLTDEGLLAVARHCPRLARLYLRRCPGVADGGLRALARHCTALRELSLCDCPTATDAGLRDVAAALGPRLRYLSLAHCERVTDVTLRCLGRRCPGLRYLNARGCLGVTDRGLESLGRGCPRLRSLDVG-RCPLVTDVGLEVLARGCPGLKRLGLKGCEGVSERGLRGVALCCPGLQLLSVQDCN-LSPDTLR 401          
BLAST of SMED30033623 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008139.1 (pep scaffold:Pmarinus_7.0:GL476334:657211:690462:-1 gene:ENSPMAG00000007325.1 transcript:ENSPMAT00000008139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 2.793e-23
Identity = 90/376 (23.94%), Postives = 176/376 (46.81%), Query Frame = -2
Query:   59 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCV---RLKYIDIKNCKFIDPTPL 1159
            D D+  +   L  ++L  I   L V  LC CA+V + W  +  + + W ++D          N  + I+  +++ +S R   F   L+ + L  CQ + D  L   A  C  +E++NL     + + +   L   C ++  L+L+ C  I    L         +   +    L+HL++S+C  + +  I +       ++ L+LK C M+ DG +K + KY   L  L++  C  +TD+G+ ++    H L+ LS+S C  +T+  + A+  +  Q+  + + +CS ++ +  ++L RN   L  +DL +   I+  ++ Q++ N    L +L ++  + I+ + +R L        RL  +++ NC  +    L
Sbjct:   14 DGDEALINKKLPKELLLRIFSCLDVVTLCRCAQVSRSWNVLALDGSNWQRIDL--------FNFQRDIEGRVVENISKRCGGF---LRQLGLRGCQGVGDSALRTFAQNCRNIEILNLNGCTKITDNTCSSLGKFCSKLKQLDLTSCTSITNHSL-------KALRCSDGCKGLEHLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGALKQVGKYSPGLITLNLQNCSRLTDEGVITMCRGCHKLQSLSLSGCTALTDAVLNALGHNCPQLRILEVSSCSQLSDAGFQVLARNCHELEKMDLEECILITDATLMQLSINC-PRLTVLSLSHCELITDDGIRHLTNGACSHERLTVLELDNCPLVTDASL 370          

HSP 2 Score: 50.8322 bits (120), Expect = 5.148e-7
Identity = 40/159 (25.16%), Postives = 75/159 (47.17%), Query Frame = -2
Query:   29 KYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRRHIVYKSVL 505
            + G  L+ L + GC  V D  + +   N   +  L+++ C KIT+N+  ++    +++ ++ L +C+SIT  SLK LR       SD C+                L+ L ++  DN+S + +  L + C  +K + +K C  ++   L++   Y   L
Sbjct:   84 RCGGFLRQLGLRGCQGVGDSALRTFAQNCRNIEILNLNGCTKITDNTCSSLGKFCSKLKQLDLTSCTSITNHSLKALR------CSDGCK---------------GLEHLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGALKQVGKYSPGL 221          
BLAST of SMED30033623 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003881.1 (pep scaffold:Pmarinus_7.0:GL477033:429527:460683:1 gene:ENSPMAG00000003530.1 transcript:ENSPMAT00000003881.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 4.340e-21
Identity = 85/375 (22.67%), Postives = 174/375 (46.40%), Query Frame = -2
Query:   59 DKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAEN-NRYSLKILIINKFDNISREFLRELFQMCV---RLKYIDIKNCKFIDPTPL 1153
            D+ ++   L  ++L  I   L V  LC CA+V + W  +  + + W K+D          N  + I+  +++ +S R   F   L+ + L  C  + D  L   +  C  +E ++L     + + +   L   C ++  L+L+ C  I           +S     +    L+HL++S+C Q+ +  I + +   + ++ L+LK C M+ D  +K + KY   L  L++  C  VTD G+ +V    H L+ LS+S C+ +T+  + A+  +   +  + +  CS ++ +  ++L     +L  +DL +  QI+  ++ Q++ +  R  + +  ++  + I+ + +R L        RL  +++ NC  +    L
Sbjct:   21 DEVAINRKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQKIDL--------FNFQRDIEGRVVENISKRCGGF---LRQLSLRGCLGVGDSALRTFSQNCRNIETLSLNGCTKITDNTCASLGKFCSKLKQLDLTSCTAIT---------NHSLKALSDGCKGLEHLNVSWCDQVTEDGITALARECHSMKVLLLKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTDDGVITVCRGCHKLQSLSVSGCNALTDALLNALGHNCYHLRILEVAGCSQLSDTGFQMLARNCHDLEKMDLEECIQITDATLIQLSLHCPRLQVLMQSLSHCELITDDGIRHLGNGACSHERLTVLELDNCPLVTDASL 375          
BLAST of SMED30033623 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 75.8702 bits (185), Expect = 1.986e-15
Identity = 61/288 (21.18%), Postives = 125/288 (43.40%), Query Frame = -2
Query:   56 LSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKL----IQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC-LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLR 889
            LS C  +TD  L  +A++C +L  + ++    +    +  +++ CR +H L+ S C  +  L L        ++  P        +L+ LDLS C  ++ + + S +     L  L ++ C  + DG ++ LA+    L+ +  + C   +D G+  V   L   L  L  + C +IT+  ++ +      +  + +R C ++T + +  L      L  +D+    ++S   +  +A      L+ + +     +S   LR L   C +L+ + ++ C       LR
Sbjct:    3 LSGCASLTDAGLRTVASRCSDLRRLEVSGCGGITEEGLREVVLQCRSLHHLDASDCPCVCGLGLHTRADHMALRALPAVSCGASLSLRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGARLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAARQ-PGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLR 289          

HSP 2 Score: 74.7146 bits (182), Expect = 5.284e-15
Identity = 60/268 (22.39%), Postives = 113/268 (42.16%), Query Frame = -2
Query:  269 KQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYC-----LKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN 1054
            +    VV      + LD S C    G+ +H   D     ++ R  P   C     L+ +DLS C   +   ++ +A  CP L  + +     L + ++  L   C R+  ++ S C   ++L L +                L +L  ++C +I D  +         LR + ++ C  +TD G+  LA+  L L  LD+  C  V+D G+ ++      LR + +  C  ++   ++A++    Q+  + ++ C   T  SL+ +R 
Sbjct:   38 EGLREVVLQCRSLHHLDASDCPCVCGLGLHTRADH----MALRALPAVSCGASLSLRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGA--------RLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAARQPGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLRYVRR 293          

HSP 3 Score: 57.7658 bits (138), Expect = 2.236e-9
Identity = 43/205 (20.98%), Postives = 85/205 (41.46%), Query Frame = -2
Query:   74 LILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVI-------------------MNLHC--------------------LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 559
            L+L  C  +TD G++ +A     L+ L+++GC  +T++G+  V+                   + LH                     LRRL +S C  +   ++++++     +  + +R C ++   +L+ L      LR I  SD    S   + ++A      L  L       I+   +R L Q C  L+Y++++ C+ +
Sbjct:    1 LVLSGCASLTDAGLRTVASRCSDLRRLEVSGCGGITEEGLREVVLQCRSLHHLDASDCPCVCGLGLHTRADHMALRALPAVSCGASLSLRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGARLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAV 205          
BLAST of SMED30033623 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 72.7886 bits (177), Expect = 2.253e-14
Identity = 60/291 (20.62%), Postives = 126/291 (43.30%), Query Frame = -2
Query:   56 KVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLS---KCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC-LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLR 901
            +V+ LS C  +TD  L  +A++C +L  + ++    +    +  +++ CR +H L+ S    C+ +     + +    S          L+ LDLS C  ++ + + S +     L  L ++ C  + DG ++ LA+    L+ +  + C   +D G+  V   L   L  L  + C +IT+  ++ +      +  + +R C ++T + +  L      L  +D+    ++S   +  +A      L+ + +     +S   LR L   C +L+ + ++ C       LR
Sbjct:    1 RVLVLSGCASLTDAGLRTVASRCSDLRRLEVSGCGGITEEGLREVVLQCRSLHHLDASGNGGCLAVLSSGHLVAHASLS----------LRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGARLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAARQ-PGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLR 280          

HSP 2 Score: 67.3958 bits (163), Expect = 1.354e-12
Identity = 48/213 (22.54%), Postives = 95/213 (44.60%), Query Frame = -2
Query:  269 LKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN 904
            L+ +DLS C   +   ++ +A  CP L  + +     L + ++  L   C R+  ++ S C   ++L L +                L +L  ++C +I D  +         LR + ++ C  +TD G+  LA+  L L  LD+  C  V+D G+ ++      LR + +  C  ++   ++A++    Q+  + ++ C   T  SL+ +R 
Sbjct:   80 LRRLDLSGCPSLEAAALRSLAVHCPNLTHLYVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGA--------RLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAARQPGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLRYVRR 284          
BLAST of SMED30033623 vs. Ensembl Yeast
Match: GRR1 (F-box protein component of an SCF ubiquitin-ligase complex; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCF(Grr1) complex; SCF(Grr1) acts as a ubiquitin-protein ligase directing ubiquitination of substrates such as: Gic2p, Mks1p, Mth1p, Cln1p, Cln2p and Cln3p; involved in carbon catabolite repression, glucose-dependent divalent cation transport, glucose transport, morphogenesis, and sulfite detoxification [Source:SGD;Acc:S000003850])

HSP 1 Score: 65.4698 bits (158), Expect = 1.303e-11
Identity = 55/220 (25.00%), Postives = 111/220 (50.45%), Query Frame = -2
Query:  263 LKVIDLSKCQITDDDLIKI-ANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPR--NTVDN---LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLR 904
            LK I ++     +D+L+++ ANKCP L  +++TL+ ++ ++S+  L           L++ +Q+ E ++  +      +F      VD+   L+ +DLS C  I D  I S   +  +LR + L +C  ITD  +  L+K G +L+ +    C  +TD G+ ++  +   ++ +  + C  +TN ++  ++    ++  I L  C+ +T   L  + +LR
Sbjct:  494 LKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKL-----------LTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPKLRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFACCTNLTNRTLYELADL-PKLKRIGLVKCTQMTDEGLLNMVSLR 701          
BLAST of SMED30033623 vs. Ensembl Nematostella
Match: EDO45889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU9])

HSP 1 Score: 87.8113 bits (216), Expect = 8.179e-19
Identity = 83/356 (23.31%), Postives = 160/356 (44.94%), Query Frame = -2
Query:   77 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKF 1129
            L  D+L +I   L   +LC  + VC +W  + W+  +W  +     H +S IN  + +   L  L   T  +C  ++ I L+  + ++D  L  I+  C +LE + L     + +  +  +++ C  +  LN++ C  +N   +         I        L+HLDLS C   DD  + +       L  L L+ C  +TD G++ +A     LK L  + C  V D  +  +  N+  L+ LS++KC  +++  I+ I      +  + +R C ++T + +  +      LR +D+   C I+  ++  I  +    LK L +   D +S   ++ +   C  ++Y++++ C  
Sbjct:    6 LPEDLLLNIFSYLTTPELCLASGVCCKWQYLCWDPVLWTSIKILN-HQNSDIN--RVLRNTLTKLGSSTQGYCLTVRSIKLNGSELVSDKGLGCISRFCIDLEHLELIGCCCVTSKGIQEVLMNCSSLRHLNVAGCSCLNS--ICPPSFNGFSITENGQFLKLRHLDLSDCVAFDDMGLRTVGLSCGLLENLYLRRCTQVTDVGIRHIANNCRQLKELSTSDCYKVRDFSLKEMAKNIPTLKYLSVAKC-PVSDTGIKYIGRYCVHLKYLNVRGCEAVTDAGIAFVVQNCLKLRSLDIG-KCAITDSALNTIGIHCP-QLKKLSMKGCDRVSVNGIKCIANQCCNIQYLNVQECNL 353          

HSP 2 Score: 62.3882 bits (150), Expect = 1.775e-10
Identity = 48/202 (23.76%), Postives = 98/202 (48.51%), Query Frame = -2
Query:   74 LRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKC-------------HKITNN--------------------SIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 568
            +R + L    +++D G+ C++++ + L++L++ GCC VT KGI  V+MN   LR L+++ C               IT N                     ++ +  S   +  + LR C+ +T   ++ +    R L+ +  SD  ++   S+ ++A+N   +LK L + K   +S   ++ + + CV LKY++++ C+ +
Sbjct:   78 VRSIKLNGSELVSDKGLGCISRFCIDLEHLELIGCCCVTSKGIQEVLMNCSSLRHLNVAGCSCLNSICPPSFNGFSITENGQFLKLRHLDLSDCVAFDDMGLRTVGLSCGLLENLYLRRCTQVTDVGIRHIANNCRQLKELSTSDCYKVRDFSLKEMAKNIP-TLKYLSVAKCP-VSDTGIKYIGRYCVHLKYLNVRGCEAV 277          
BLAST of SMED30033623 vs. Ensembl Nematostella
Match: EDO38838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBR5])

HSP 1 Score: 82.4185 bits (202), Expect = 6.110e-18
Identity = 63/231 (27.27%), Postives = 111/231 (48.05%), Query Frame = -2
Query:  440 DILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILK-ILSYRTPPFCYCLKVIDLS--KCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGI 1120
            DI   I     V +  S ARVC++W  +  +   W  +DF  CH    I      D I++ +++Y        +++ID S  +C  +TD  L  +AN CP L+ +NLT    + N  +  +  +C  +  L LS C ++++ + +++     P         L+ L LS C ++ D  + + S   + L+ L L  C  ITD G+K L++Y  HL  +++     ++ +GI
Sbjct:    4 DIWLQIFSYFSVKERASLARVCREWNILCRDSRFWGAVDFRSCHVSGEIT-----DKIVESVVAYSCK-----IRIIDFSSKRCHAVTDTSLTHVANHCPGLQRLNLTGKSLITNRGLGAIARSCGDLEQLFLSGCSRVSD-RGVRTLASKCP--------KLEKLSLSNCLRLTDKSLSAISRKCSSLKTLDLSGCVKITDRGIKALSRYSEHLTDINLKDTTGISIEGI 215          

HSP 2 Score: 55.0694 bits (131), Expect = 1.215e-8
Identity = 34/125 (27.20%), Postives = 67/125 (53.60%), Query Frame = -2
Query:  275 NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL 649
             L+ L+L+    I +  + + +     L +L L  C  ++D G++ LA     L+ L ++ C  +TDK +S++      L+ L +S C KIT+  I+A+S  +  + +I L++ + I+   ++LL
Sbjct:   94 GLQRLNLTGKSLITNRGLGAIARSCGDLEQLFLSGCSRVSDRGVRTLASKCPKLEKLSLSNCLRLTDKSLSAISRKCSSLKTLDLSGCVKITDRGIKALSRYSEHLTDINLKDTTGISIEGIELL 218          

HSP 3 Score: 52.373 bits (124), Expect = 1.029e-7
Identity = 46/175 (26.29%), Postives = 86/175 (49.14%), Query Frame = -2
Query:  200 KLIQSQIQYSPIFPRNTVDNLKHLDLS--YCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAEN 706
            K+++S + YS          ++ +D S   C  + D+ +   +     L++L L    +IT+ G+  +A+    L+ L ++GC  V+D+G+ ++      L +LS+S C ++T+ S+ AIS   + +  + L  C  IT   +K L     +L  I+L D   IS + I  +A  
Sbjct:   55 KIVESVVAYSC--------KIRIIDFSSKRCHAVTDTSLTHVANHCPGLQRLNLTGKSLITNRGLGAIARSCGDLEQLFLSGCSRVSDRGVRTLASKCPKLEKLSLSNCLRLTDKSLSAISRKCSSLKTLDLSGCVKITDRGIKALSRYSEHLTDINLKDTTGISIEGIELLARG 221          
BLAST of SMED30033623 vs. Ensembl Nematostella
Match: EDO45813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRS0])

HSP 1 Score: 82.8037 bits (203), Expect = 6.077e-17
Identity = 94/394 (23.86%), Postives = 172/394 (43.65%), Query Frame = -2
Query:   53 DHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSG----INIHKGIDTILKILSYRTPPFC--YCLKVID----------LSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQIN--ELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL----RNLRIIDLSDNCQISRQSIFQIAEN--NRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRR 1159
            + D+ ++   L  +++  +   L V  LC CARV K W  +  + + W ++D      D       N+ K     LK LS R       Y L++            L  C+ ITD   I ++  C  L ++N++    + + S+  L   C ++H LN+S C QI+   LKL+    +    F               C  + D  +   +    +L+ + +  C  + + G++ ++KY   L++L ++GC  +TD  +  +      LR L +++C + T+   QA+    + +  + L  C  IT S+L  L      L+ + LS    I+   I Q+  +      L+ L ++    I+   L  L Q C +LK I++ +C+ I  T +R+
Sbjct:   31 NEDQATINKKLPKELILRVFSFLDVVSLCRCARVSKLWNVLALDGSNWQRVDLFDFQTDIEEYVVSNLSKRCGGFLKKLSLRGCKSVGDYALRIFAQNCRNIEDLVLEDCKKITDSTCISLSTYCSRLSLLNVSSCGQVTDNSLNALSKGCSKLHHLNISWCCQISTQGLKLLAQGCRQLITFIAKG-----------CALLTDEGLLHLTKSCTQLQVINIHSCENVRNAGVEQISKYCKDLRFLCVSGCIQLTDVALQHLGAGCPELRTLEVAQCSQFTDAGFQALCRGCHNLQRMDLEECVLITDSTLNHLSLWCSGLQKLSLSHCELITDDGIHQLGASPCATEHLEFLELDNCPLITDNALDYLVQ-CHQLKRIELYDCQLITRTGIRK 412          

HSP 2 Score: 52.7582 bits (125), Expect = 2.523e-7
Identity = 49/220 (22.27%), Postives = 102/220 (46.36%), Query Frame = -2
Query:   26 IFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSL----KLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRRHIVYKSVLK 673
            IF +N   N++ L L  C++I DS   S S   +RL  L +  C  +TD  +  L+K    L +L+I+ CC ++ +G+  +      L       C  +T+  +  ++ S  Q+  I + +C ++  + +    K  ++LR + +S   Q++  ++  +       L+ L + +    +    + L + C  L+ +D++ C  I  + L    ++ S L+
Sbjct:  124 IFAQN-CRNIEDLVLEDCKKITDSTCISLSTYCSRLSLLNVSSCGQVTDNSLNALSKGCSKLHHLNISWCCQISTQGLKLLAQGCRQLITFIAKGCALLTDEGLLHLTKSCTQLQVINIHSCENVRNAGVEQISKYCKDLRFLCVSGCIQLTDVALQHLGAGCP-ELRTLEVAQCSQFTDAGFQALCRGCHNLQRMDLEECVLITDSTLNHLSLWCSGLQ 341          
BLAST of SMED30033623 vs. Ensembl Nematostella
Match: EDO48070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK01])

HSP 1 Score: 80.4925 bits (197), Expect = 6.318e-16
Identity = 91/392 (23.21%), Postives = 165/392 (42.09%), Query Frame = -2
Query:   47 DKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCI----QINELKLIQSQIQYSPI-----FPRNTVDNLK---------HLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIM--NLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL---RNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRRHI 1153
            D +   S L   +   I   + + DL  CARVC+ W  ++    +W K+D SQ         H+  +     L ++  PF   L  ++L  C     + +KI  +C  L+ +NL+    + +  +  + + C  +  LNLS C+     +  L    + +QY  +     F    +  L          +LDLS C QI D          + L  +IL +   + D  ++ L      L+ + I    F++D    S+ +   LH LR   I   ++IT+ S++ ++ S +Q+  + + +C  +T  SLK L   R+L +I+++D  +I    + QI E    S                         ++K +++ NC  + PT +RR +
Sbjct:  226 DGKDEISSLPRHVALRIFSYITIGDLSRCARVCRSWKILIHANILWSKIDMSQVK-------HRATNKATAKLIHKCRPF---LGHLNLKNCYNLTRESLKIIGQCRNLQDLNLSEVKGVTDEVMKDIAMGCTSLLYLNLSSCLISDSTLRYLARYCTNMQYLSLAYCTKFSNKGLSYLANGKGCHKVIYLDLSGCEQITDDGYKFVGMGCSSLNTIILNDLPGLRDACIQSLTSECRTLRTVSILNSPFLSDTAYKSLALCRKLHKLR---IEGNNRITDASVKVLAKSCSQLEHVYMVDCPRLTDLSLKALASVRHLNVINVADCVRIQDTGVRQIVEGPSGS-------------------------KIKELNLTNCVRVMPTVIRRFV 579          

HSP 2 Score: 61.2326 bits (147), Expect = 6.571e-10
Identity = 58/224 (25.89%), Postives = 111/224 (49.55%), Query Frame = -2
Query:  272 QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLI--ITCRRIHTLNLSKCIQINEL------------KLIQSQIQY------SPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNR--LRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR 877
            ++TD  L  +A+    L VIN+   + +Q+  V  ++   +  +I  LNL+ C+++                L+ +   Y      + +    T+ NL  +D+S C   D    H  S + N   +R +++ EC  ITD G++ + +    L+ LDI+ C  +TD  I +++     LR L++S C K+T++S+Q +S   + +  + L NC+ ++  +L+ LR
Sbjct:  516 RLTDLSLKALAS-VRHLNVINVADCVRIQDTGVRQIVEGPSGSKIKELNLTNCVRVMPTVIRRFVYCFRCHNLVYASFCYCEHVTDAGVELLGTLPNLISIDMSGCNISD----HGVSSLGNNAMMRDVVIAECSAITDLGLQKMCQQCRFLENLDISHCTNLTDNAIKNLVFCCRLLRTLNLSGCDKLTDSSLQYLSGVCHYLEMLDLSNCTLVSDKALRYLR 734          

HSP 3 Score: 50.8322 bits (120), Expect = 1.200e-6
Identity = 51/204 (25.00%), Postives = 81/204 (39.71%), Query Frame = -2
Query:  359 PPFCYCLKV----------------IDLSKCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQ 922
              FCYC  V                ID+S C I+D  +  + N     +V+                I  C  I  L L K  Q         Q ++           L++LD+S+C  + D+ I +       LR L L  C  +TD  ++ L+    +L+ LD++ C  V+DK +  +      L+ L+I  C  IT N++Q
Sbjct:  590 ASFCYCEHVTDAGVELLGTLPNLISIDMSGCNISDHGVSSLGNNAMMRDVV----------------IAECSAITDLGLQKMCQ---------QCRF-----------LENLDISHCTNLTDNAIKNLVFCCRLLRTLNLSGCDKLTDSSLQYLSGVCHYLEMLDLSNCTLVSDKALRYLRKGCKRLQSLTILYCRNITKNAVQ 757          
BLAST of SMED30033623 vs. Ensembl Nematostella
Match: EDO41009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5H2])

HSP 1 Score: 71.2478 bits (173), Expect = 1.526e-13
Identity = 86/360 (23.89%), Postives = 155/360 (43.06%), Query Frame = -2
Query:   74 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKG---IDTILKILSYRTPPFCYCLKVIDLSKCQITDDDLIK-IANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNR----LRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFI 1129
            L  +++S+I   LP+ D+ S ARVC  W     +  +W         N +     K     D+++  L  ++      L  +D+S C+   D  +K +A   P +  ++L     +  +S   L    + +  L++S+   I ++ L++        F      +L+ +DLS C+Q+ D+ +  F P        L+ LIL  C M TD  +K      ++L+ LDI+ C  V D G+  +   L  L+ L IS C  IT+            + +  L N S       + LR+LR +  +    ++   +  IA+     L+ L  +K D +S   +  L +   RL ++D+  C  +
Sbjct:    1 LPQEVVSYIFSFLPLADIKSSARVCHLWAKASDDPLLW--------KNTTATLYTKSKTFPDSLIYSLQCKSQQCLTSLSKLDISWCKGLGDSAVKTVATALPSISHLSLAGCKEVHLSSWQSLGKNLKSLSFLDISRS-DITDVILLK--------FAEVPTLSLRSIDLSACKQLTDNGVKFFIPDSKSSVLPLQTLILNGCTMATDNFLKRCLPAMVNLQQLDISSCLHVGDSGMHVITELLTNLKMLKISWCANITD------------VTDATLVNVS-------RHLRSLRELSFNGCSLVTDTGVIAIAQ-GLSQLQTLDASKCDGVSDLSVFHLAKHSSRLTHLDLSMCSHV 323          
BLAST of SMED30033623 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 119.013 bits (297), Expect = 2.200e-28
Identity = 94/384 (24.48%), Postives = 173/384 (45.05%), Query Frame = -2
Query:  218 PNDDDHDKQSLFSFLQ-VDILS-----HILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQ-SQIQYSPIFP----------------------------------------RNTVDNLKHL----------DLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1171
            P      +QS    L  +D+L       I   L  N LC CARVC++WY++ W+  +W  +  +      G  +H   D  +++L++R    TP  C  L+ + ++ C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  LNLS C ++  + L Q + +Q SP+                                          R T + L+HL           LS CR + D  +   + +   LR L +  C  ITD G++ +A+Y   L+YL+  GC  +TD G+  +  +   L+ L + KC  ++++ ++ ++     +  + LR C S++   LK L      L+++++ D C++S +++
Sbjct:   97 PGSHTRSRQSKAHHLAPIDLLPDHTLLQIFSRLSTNQLCRCARVCRRWYNLAWDPRLWVSVRLT------GELLHA--DRAIRVLTHRLCQDTPNVCLTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKVTCISLTQEASLQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVARLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMYCQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQD-CEVSPEAL 471          
BLAST of SMED30033623 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 118.242 bits (295), Expect = 3.967e-28
Identity = 94/384 (24.48%), Postives = 173/384 (45.05%), Query Frame = -2
Query:  218 PNDDDHDKQSLFSFLQ-VDILS-----HILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQ-SQIQYSPIFP----------------------------------------RNTVDNLKHL----------DLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1171
            P      +QS    L  +D+L       I   L  N LC CARVC++WY++ W+  +W  +  +      G  +H   D  +++L++R    TP  C  L+ + ++ C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  LNLS C ++  + L Q + +Q SP+                                          R T + L+HL           LS CR + D  +   + +   LR L +  C  ITD G++ +A+Y   L+YL+  GC  +TD G+  +  +   L+ L + KC  ++++ ++ ++     +  + LR C S++   LK L      L+++++ D C++S +++
Sbjct:   88 PGSHTRSRQSKAHHLAPIDLLPDHTLLQIFSRLSTNQLCRCARVCRRWYNLAWDPRLWVSVRLT------GELLHA--DRAIRVLTHRLCQDTPNVCLTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKVTCISLTQEASLQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVARLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMYCQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQD-CEVSPEAL 462          
BLAST of SMED30033623 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 117.472 bits (293), Expect = 4.703e-28
Identity = 94/384 (24.48%), Postives = 173/384 (45.05%), Query Frame = -2
Query:  218 PNDDDHDKQSLFSFLQ-VDILS-----HILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYR----TPPFCYCLKVIDLSKCQ-ITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQ-SQIQYSPIFP----------------------------------------RNTVDNLKHL----------DLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSI 1171
            P      +QS    L  +D+L       I   L  N LC CARVC++WY++ W+  +W  +  +      G  +H   D  +++L++R    TP  C  L+ + ++ C+ +TD  L  +A  CPEL  + +    ++ N +V  ++  C  +  LNLS C ++  + L Q + +Q SP+                                          R T + L+HL           LS CR + D  +   + +   LR L +  C  ITD G++ +A+Y   L+YL+  GC  +TD G+  +  +   L+ L + KC  ++++ ++ ++     +  + LR C S++   LK L      L+++++ D C++S +++
Sbjct:   55 PGSHTRSRQSKAHHLAPIDLLPDHTLLQIFSRLSTNQLCRCARVCRRWYNLAWDPRLWVSVRLT------GELLHA--DRAIRVLTHRLCQDTPNVCLTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKVTCISLTQEASLQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVARLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMYCQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQD-CEVSPEAL 429          
BLAST of SMED30033623 vs. Ensembl Medaka
Match: fbxl2 (F-box/LRR-repeat protein 2 [Source:NCBI gene;Acc:101157070])

HSP 1 Score: 90.8929 bits (224), Expect = 3.069e-19
Identity = 92/376 (24.47%), Postives = 171/376 (45.48%), Query Frame = -2
Query:   59 DKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDT-ILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQI--NELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLL-RN---LRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCV---RLKYIDIKNCKFIDPTPL 1153
            D+  +   L  ++L  I   L V  LC CA+V K W  +  + + W K+D          N    I+  +++ +S R   F   L+ + L  C  + D  +   A  C  +EV+NL     + +++   L   C ++  L+L+ C+ I  + LK +    +            L+ L+LS+C QI    I + +     LR L L+ C  + DG +K   K+   L  +++  C  +TD+G+ S+    H L+ L +S C  IT+ S+ A+  +  ++  +    CS +T +   +L RN   L  +DL +   ++  ++ Q++ +    L+ L ++  + I+ + +R L        RL  +++ NC  I    L
Sbjct:   16 DEAPINKKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGSNWQKIDL--------FNFQTDIEGRVVENISKRCGGF---LRQLSLRGCLSVGDASMKTFAQNCRNIEVLNLNGCTKITDSTCLSLSKFCSKLRQLDLTSCVSISNHSLKALSDGCRM-----------LETLNLSWCDQITRDGIEALARGCMGLRALFLRGCTQLDDGALKHFQKHCPELTTINMQSCTQITDEGLVSLCRGCHKLQVLCVSGCGNITDASLTALGLNCPRLKILEAARCSHVTDAGFTVLARNCHELEKMDLEECILVTDNTLVQLSIHC-PRLQALSLSHCELITDDGIRALSSSTCGQERLTVLELDNCPLITDVTL 368          
BLAST of SMED30033623 vs. Ensembl Medaka
Match: fbxl20 (F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:101160411])

HSP 1 Score: 79.7221 bits (195), Expect = 1.754e-15
Identity = 85/341 (24.93%), Postives = 152/341 (44.57%), Query Frame = -2
Query:  233 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHND-SG---INIHKGIDTILKILSYRT------------PPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSP----IFPRNTVD--------------NLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRN-------LRIIDLSDNCQI 1129
            L  ++L  I   L V  LC CA+V + W  +  + + W ++D      D  G    NI K     L+ LS R                C  ++++ L+ C +ITD     ++  CP+L+ ++L     + N S+  L   C  +  LN+S C Q+ +   IQ+ ++  P    +F +                   L  L+L  C QI D  + +     +RL+ L +  C  ITD  +  L +    L+ L++A C  +TD G +++  N H L ++ + +C +IT+ ++  +S    ++  + L +C  IT   ++ L +       L +I+L DNC +
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCSSLSKFCPKLKHLDLASCTSITNLSLKALSEGCHSLEQLNISWCDQVTK-DGIQALVRSCPGLKGLFLKGCTQLEDEALKQIGAYCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILHALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGSGPCAHDCLEVIEL-DNCPL 366          

HSP 2 Score: 75.0998 bits (183), Expect = 4.291e-14
Identity = 53/192 (27.60%), Postives = 95/192 (49.48%), Query Frame = -2
Query:   83 LKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNC 646
            L+ L L  C  + DS + +F+     +  L L  C  ITD     L+K+   LK+LD+A C  +T+  + ++    H L +L+IS C ++T + IQA+  S   +  + L+ C+ +   +LK +      L  ++L    QI+ + +  I     + L+ L ++   NI+   L  L Q C RL+ +++  C
Sbjct:   93 LRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCSSLSKFCPKLKHLDLASCTSITNLSLKALSEGCHSLEQLNISWCDQVTKDGIQALVRSCPGLKGLFLKGCTQLEDEALKQIGAYCPELVTLNLQTCSQITDEGLITICRGC-HRLQSLCVSGCANITDAILHALGQNCPRLRILEVARC 283          
BLAST of SMED30033623 vs. Planmine SMEST
Match: SMESG000050765.1 (SMESG000050765.1)

HSP 1 Score: 1028.47 bits (2658), Expect = 0.000e+0
Identity = 528/531 (99.44%), Postives = 531/531 (100.00%), Query Frame = -2
Query:   20 MQCTRNVXXXXXXXXXXXXXXXKQTNENYTVHSQETNSSSGIISDLSDRSQIYRQLNNCSVQSNLPWINTGRNSINSFINPYESKSSFVALPNDMMSPGCSKNLNKKTSKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRRHIVYKSVLKSE 1612
            MQCTRNVKFCGFKFSKKSKKGKKQTNENYTVHSQETNSSSGIISDLSDRSQIYRQLNNCSVQSNLPWINTGR+SINSFINPYESKSSFVALPNDMMSPGCSKNLNKKTSKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLF+FLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLK+IDLSKCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRRHIVYKSVLKSE
Sbjct:    1 MQCTRNVKFCGFKFSKKSKKGKKQTNENYTVHSQETNSSSGIISDLSDRSQIYRQLNNCSVQSNLPWINTGRHSINSFINPYESKSSFVALPNDMMSPGCSKNLNKKTSKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPNDDDHDKQSLFAFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKMIDLSKCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRRHIVYKSVLKSE 531          
BLAST of SMED30033623 vs. Planmine SMEST
Match: SMESG000053104.1 (SMESG000053104.1)

HSP 1 Score: 127.872 bits (320), Expect = 4.264e-31
Identity = 100/355 (28.17%), Postives = 189/355 (53.24%), Query Frame = -2
Query:   86 ILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQ-CHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELK-LIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNL-HCLRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFS---SLKLLRNLRIIDLSDNC--QISRQSIFQIAENNRY--SLKILIINKFDNISREFLRELFQMCVRLKYIDIKN 1117
            IL  I + L + D+ +C++ C+ WY + W   +W  +DFSQ        +I+  I  +L +L     P+C  +  + L KC ++TD+ +I I+N CP ++  ++     + N S+ H++  C  +  L++  C  I+ +  L +S I     F       L  L+LS+C+ +DD+ +  F+P F  + KL+L+ C  I+D G+  + +Y  +L+ + +     ++D+ I ++   L   LR LS++ C +IT+NS+ +++ +   +  + L  C  IT S   SL +    R+I L+ +   QI+ +S+  ++   RY  +++ L +NK   IS E + E+ +  ++LK I+I N
Sbjct:  202 ILIKIFKNLQIKDILNCSQTCRNWYFIAWQPVLWSNIDFSQWVLKTKPTDINFKIKKLLILLGGNRNPYCPLVHSVKLDKCTELTDESVIFISNSCPNIKNFSIRKCFLISNISIFHILSKCGELKRLSVEGCKLISAINTLPESDIVKFKEFV------LSDLNLSFCQMVDDASLIIFAPKFKNMEKLLLRNCHRISDTGISYIVRYCQNLREISLNHLEKISDESICNISEKLNENLRYLSLANCTRITDNSLMSLADNCCNLQYLNLHKCKLITDSGIMSLAISIQTRLISLNVSYCPQITSRSVSVLS---RYCPNIQQLDMNKCPLISDEAVEEICEHIIKLKMINIDN 547          
BLAST of SMED30033623 vs. Planmine SMEST
Match: SMESG000081003.1 (SMESG000081003.1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.051e-16
Identity = 98/421 (23.28%), Postives = 175/421 (41.57%), Query Frame = -2
Query:   53 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSC--IHSFSPVFNRLR--------------------KLILKEC----RMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC----------------------------LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDN---ISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRR 1129
            L  ++   I   L +  LC C++VCK WY + ++ + W  ++      D   N+   I  I       +  F   L+ + +  C  I+D D+  +A +CP +E + L+  ++L N S   +   C  + +L +  C +IN+            I       NL  LDLS+C   D+    I    P+   LR                    KL L  C     ++TD  +  LA+Y   L+ L ++  C +TD G+ ++  N+                              L  + +S+C +IT+  I  ++ + +++ ++ L +C+S+T  SL  L      LRI+ LS   QI+   + ++ E      + L     DN   ++ E L  L + C  LK +D+ +C+ I    ++R
Sbjct:   43 LPKELFIMIFGYLDITALCRCSQVCKFWYEIAFDGSNWKTINLFDFQKDITSNVVSKITEI-------SGRF---LRELRMKGCIHISDKDIKNLAEQCPLIEDLTLSECVNLTNESSVSVTRNCTNLTSLYIDSCTKIND----------DGIKEIANCKNLMKLDLSFCDISDEGLRYIARGCPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSN-CNITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRC-RITDTGISLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSIQR 441          

HSP 2 Score: 58.5362 bits (140), Expect = 7.140e-9
Identity = 81/303 (26.73%), Postives = 132/303 (43.56%), Query Frame = -2
Query:  209 SCARVCKQWYSVVWNQNMWYKLDFSQCH-NDSGIN-IHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLT-LNIHLQNASVCHLIITCRRIHTLNLSKC-IQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC--LRRLSISKCHKITNNSIQAISTSNNQICE----IILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQI 1072
            SC ++       + N     KLD S C  +D G+  I +G               C  L  + L  C +IT D + +IA  CP+L ++N   +   L + ++  L   C  + TL +S C I    LK +   I    I       +   +D      + ++ +  F      L  + +  CR ITD G+  LA     L+ LD+  C  +TD  ++   +++HC  LR L +S C +IT+N +Q +    +  C     + L NC  +T  SL  L      L+ +DL D   I++QSI ++
Sbjct:  167 SCTKINDDGIKEIANCKNLMKLDLSFCDISDEGLRYIARG---------------CPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSNCNITDAGLKALAGNISAFSI-------DKSDIDSGEGDNMHNNGLKQFG--CRELTVVEVSRCR-ITDTGISLLAGACSRLEKLDLEDCASLTDGSLT--FLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSIQRV 442          
BLAST of SMED30033623 vs. Planmine SMEST
Match: SMESG000081003.1 (SMESG000081003.1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.437e-16
Identity = 98/421 (23.28%), Postives = 175/421 (41.57%), Query Frame = -2
Query:   53 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWYKLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSC--IHSFSPVFNRLR--------------------KLILKEC----RMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC----------------------------LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLR----NLRIIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDN---ISREFLRELFQMCVRLKYIDIKNCKFIDPTPLRR 1129
            L  ++   I   L +  LC C++VCK WY + ++ + W  ++      D   N+   I  I       +  F   L+ + +  C  I+D D+  +A +CP +E + L+  ++L N S   +   C  + +L +  C +IN+            I       NL  LDLS+C   D+    I    P+   LR                    KL L  C     ++TD  +  LA+Y   L+ L ++  C +TD G+ ++  N+                              L  + +S+C +IT+  I  ++ + +++ ++ L +C+S+T  SL  L      LRI+ LS   QI+   + ++ E      + L     DN   ++ E L  L + C  LK +D+ +C+ I    ++R
Sbjct:   92 LPKELFIMIFGYLDITALCRCSQVCKFWYEIAFDGSNWKTINLFDFQKDITSNVVSKITEI-------SGRF---LRELRMKGCIHISDKDIKNLAEQCPLIEDLTLSECVNLTNESSVSVTRNCTNLTSLYIDSCTKIND----------DGIKEIANCKNLMKLDLSFCDISDEGLRYIARGCPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSN-CNITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRC-RITDTGISLLAGACSRLEKLDLEDCASLTDGSLTFLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSIQR 490          

HSP 2 Score: 57.7658 bits (138), Expect = 1.235e-8
Identity = 81/303 (26.73%), Postives = 132/303 (43.56%), Query Frame = -2
Query:  209 SCARVCKQWYSVVWNQNMWYKLDFSQCH-NDSGIN-IHKGIDTILKILSYRTPPFCYCLKVIDLSKC-QITDDDLIKIANKCPELEVINLT-LNIHLQNASVCHLIITCRRIHTLNLSKC-IQINELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLRKLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC--LRRLSISKCHKITNNSIQAISTSNNQICE----IILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQI 1072
            SC ++       + N     KLD S C  +D G+  I +G               C  L  + L  C +IT D + +IA  CP+L ++N   +   L + ++  L   C  + TL +S C I    LK +   I    I       +   +D      + ++ +  F      L  + +  CR ITD G+  LA     L+ LD+  C  +TD  ++   +++HC  LR L +S C +IT+N +Q +    +  C     + L NC  +T  SL  L      L+ +DL D   I++QSI ++
Sbjct:  216 SCTKINDDGIKEIANCKNLMKLDLSFCDISDEGLRYIARG---------------CPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMNCNYVGELLTDKALALLARYCSELRTLCVSNCNITDAGLKALAGNISAFSI-------DKSDIDSGEGDNMHNNGLKQFG--CRELTVVEVSRCR-ITDTGISLLAGACSRLEKLDLEDCASLTDGSLT--FLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSIQRV 491          
BLAST of SMED30033623 vs. Planmine SMEST
Match: SMESG000081003.1 (SMESG000081003.1)

HSP 1 Score: 71.633 bits (174), Expect = 4.388e-13
Identity = 94/356 (26.40%), Postives = 152/356 (42.70%), Query Frame = -2
Query:  209 LQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQN----MWYKLDFSQC---HNDSGINIHKG--------IDTILKILSYRTPPFCYC--LKVIDLSKCQITDDDLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQINEL---KLIQSQIQYSPIFPRNTVDNLKHLDLSY--------CRQIDDSCIHSFSPVF---NRLRKLILKE--------CRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC--LRRLSISKCHKITNNSIQAISTSNNQICE----IILRNCSSITFSSLKLLRN----LRIIDLSDNCQISRQSIFQI 1129
            L  ++   I   L +  LC C++VCK WY + ++      +   L  S+C    N+S +++ +         ID+  KI          C  L  +DLS C I+D+ L  IA  CP L  + L   + + +  +  +  +C ++  +N   C  + EL   K +    +Y        V N    D              ID S I S        N L++   +E        CR ITD G+  LA     L+ LD+  C  +TD  ++   +++HC  LR L +S C +IT+N +Q +    +  C     + L NC  +T  SL  L      L+ +DL D   I++QSI ++
Sbjct:   43 LPKELFIMIFGYLDITALCRCSQVCKFWYEIAFDGTEQCPLIEDLTLSECVNLTNESSVSVTRNCTNLTSLYIDSCTKINDDGIKEIANCKNLMKLDLSFCDISDEGLRYIARGCPLLTFLRLKGCLKITSDGISEIAKSCPKLRLMN---CNYVGELLTDKALALLARYCSELRTLCVSNCNITDAGLKALAGNISAFSIDKSDIDSGEGDNMHNNGLKQFGCRELTVVEVSRCR-ITDTGISLLAGACSRLEKLDLEDCASLTDGSLT--FLSIHCPKLRILLLSHCDQITDNGVQKLVEMPSGGCRNLEYLALDNCPLLTDESLTCLSKNCAFLKKLDLYDCQLITKQSIQRV 392          
The following BLAST results are available for this feature:
BLAST of SMED30033623 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXL75.318e-3725.41F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL75.943e-3725.41F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL76.100e-3725.41F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL202.736e-1824.04F-box and leucine rich repeat protein 20 [Source:H... [more]
FBXL202.851e-1824.04F-box and leucine rich repeat protein 20 [Source:H... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl-13.222e-2124.61Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-13.222e-2124.61Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-13.222e-2124.61Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-13.222e-2124.61Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-14.791e-2124.61Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxl73.115e-2223.73gene:FBgn0038385 transcript:FBtr0083201[more]
CG90031.186e-1925.74gene:FBgn0033639 transcript:FBtr0113067[more]
CG90031.366e-1925.24gene:FBgn0033639 transcript:FBtr0088088[more]
CG90032.185e-1925.77gene:FBgn0033639 transcript:FBtr0330632[more]
CG90032.349e-1925.26gene:FBgn0033639 transcript:FBtr0113069[more]
back to top
BLAST of SMED30033623 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-192l18.91.173e-3125.12si:dkey-192l18.9 [Source:ZFIN;Acc:ZDB-GENE-120709-... [more]
fbxl71.164e-2824.86F-box and leucine-rich repeat protein 7 [Source:NC... [more]
fbxl27.979e-1724.32F-box and leucine-rich repeat protein 2 [Source:ZF... [more]
fbxl206.859e-1625.36F-box and leucine-rich repeat protein 20 [Source:Z... [more]
fbxl138.276e-1525.00F-box and leucine-rich repeat protein 13 [Source:Z... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
med13l3.907e-3525.79mediator complex subunit 13-like [Source:Xenbase;A... [more]
med13l4.748e-3525.79mediator complex subunit 13-like [Source:Xenbase;A... [more]
adcy32.714e-2024.94adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy33.351e-2025.21adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy35.650e-2025.07adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxl76.831e-3725.68F-box and leucine-rich repeat protein 7 [Source:MG... [more]
Fbxl208.698e-1823.77F-box and leucine-rich repeat protein 20 [Source:M... [more]
Fbxl27.405e-1623.10F-box and leucine-rich repeat protein 2 [Source:MG... [more]
Fbxl27.405e-1623.10F-box and leucine-rich repeat protein 2 [Source:MG... [more]
Fbxl142.100e-1424.25F-box and leucine-rich repeat protein 14 [Source:M... [more]
back to top
BLAST of SMED30033623 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UJT9|FBXL7_HUMAN2.930e-3625.41F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606... [more]
sp|Q5BJ29|FBXL7_MOUSE4.778e-3625.68F-box/LRR-repeat protein 7 OS=Mus musculus OX=1009... [more]
sp|A1A5X2|FBXL7_DANRE8.786e-2824.86F-box/LRR-repeat protein 7 OS=Danio rerio OX=7955 ... [more]
sp|P34284|FBXL_CAEEL6.095e-2024.61F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis ... [more]
sp|Q96IG2|FXL20_HUMAN1.369e-1724.04F-box/LRR-repeat protein 20 OS=Homo sapiens OX=960... [more]
back to top
BLAST of SMED30033623 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2B5033.031e-3728.19F-box/LRR-repeat protein 7 OS=Araneus ventricosus ... [more]
V4A9T73.033e-3729.56F-box domain-containing protein OS=Lottia gigantea... [more]
A0A1S3HGJ81.234e-3628.25F-box/LRR-repeat protein 7-like isoform X2 OS=Ling... [more]
A0A3B3SD401.831e-3624.94F-box domain-containing protein OS=Paramormyrops k... [more]
A0A1S3HDN61.884e-3628.25F-box/LRR-repeat protein 7-like isoform X1 OS=Ling... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-192l18.91.780e-3624.78F-box/LRR-repeat protein 7-like [Source:NCBI gene;... [more]
si:dkey-192l18.91.873e-3624.78F-box/LRR-repeat protein 7-like [Source:NCBI gene;... [more]
fbxl72.485e-2823.91F-box and leucine-rich repeat protein 7 [Source:NC... [more]
fbxl71.046e-2724.59F-box and leucine-rich repeat protein 7 [Source:NC... [more]
fbxl208.265e-1622.25F-box and leucine rich repeat protein 20 [Source:N... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXL72.403e-4026.43F-box and leucine rich repeat protein 7 [Source:HG... [more]
ENSPMAT00000008139.12.793e-2323.94pep scaffold:Pmarinus_7.0:GL476334:657211:690462:-... [more]
ENSPMAT00000003881.14.340e-2122.67pep scaffold:Pmarinus_7.0:GL477033:429527:460683:1... [more]
FBXL71.986e-1521.18F-box and leucine rich repeat protein 7 [Source:HG... [more]
FBXL72.253e-1420.62F-box and leucine rich repeat protein 7 [Source:HG... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GRR11.303e-1125.00F-box protein component of an SCF ubiquitin-ligase... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458898.179e-1923.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388386.110e-1827.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458136.077e-1723.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480706.318e-1623.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410091.526e-1323.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30033623 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-192l18.92.200e-2824.48F-box and leucine rich repeat protein 7 [Source:NC... [more]
si:dkey-192l18.93.967e-2824.48F-box and leucine rich repeat protein 7 [Source:NC... [more]
si:dkey-192l18.94.703e-2824.48F-box and leucine rich repeat protein 7 [Source:NC... [more]
fbxl23.069e-1924.47F-box/LRR-repeat protein 2 [Source:NCBI gene;Acc:1... [more]
fbxl201.754e-1524.93F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SMED30033623 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050765.10.000e+099.44SMESG000050765.1[more]
SMESG000053104.14.264e-3128.17SMESG000053104.1[more]
SMESG000081003.13.051e-1623.28SMESG000081003.1[more]
SMESG000081003.16.437e-1623.28SMESG000081003.1[more]
SMESG000081003.14.388e-1326.40SMESG000081003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033623 ID=SMED30033623|Name=SMED30033623|organism=Schmidtea mediterranea sexual|type=transcript|length=1640bp
TGAATTTGACAAAATTTTATTCCGATTTCAAAACAGATTTATACACAATA
TGGCGTCTGAGGGGGGTAGGATCGATAAATTTACAATTTTTTATGTCGAT
ATATTTCAACCGAACGCACATTTGGAATAATTCCCGCAGAAATTCCCTGG
AAATATTATCGAATTTATTGATTATTAGAATTTTCAATGAATATCGATTA
TTTTCTGCGATCTGGAAAATCGATTGCCTTGAGATCTGGCAATTGTCGGA
CAAATCAATTATTCTCAGATTTCTCAAGAGTTTCAGGCTGGAAAATGTGA
TTGAGGAACAATTTCTCAAAATGATTTCACAAATTTGATTGTTTGAGGTC
GATATTGCCTGGATGGAGTTGTTTGTAATTTTATGGCACTTCGATATGGA
CAATCTCCGCAAACAGTGCAAATTCATTATAACTGAAGATATTCCTTTAT
CTGTAACGAAACAACATCCAGCTATATCTAAATATTTTAAATGTAAACCA
TATTTTGCTAAGCATTTCATTCCTCCGTCCGTAATCATTCGGCATTCCTT
CAAAATCAACTTTCTCAATCTGTTGAAGACTGGGGAAAACGAATGAATAC
AAGAATCATCAATTTGTCTACAATAAGAAAGATCCAAATGCTTCAAATTG
TCAACAGTATTTCTCGGAAAGATTGGTGAGTATTGAATCTGACTTTGAAT
GAGCTTCAATTCATTTATTTGAATACATTTTGACAAATTTAAAGTGTGAA
TTCTTCTGCAGGTTATTATTAAATGACAAACTGATGCATTCTGTAAATGA
ATATTCAAAGTTAAGTTTATGACTTCTAATTCTGGACACTTATTTGCAAT
CTTTATTAAATCATCATCTGTTATTTGACATTTGGATAGATCTATCACCT
TAAGACAGTAACAGAAAGGAGGGGTTCGATAACTTAATATCTTTAGAATT
GTATCAATTCCTTTATGAATATTTATTCCAGAATCATTGTGACATTGAGA
AAAATCTAATTTATACCACATATTTTGATTCCAAACTACTGAATACCATT
GTTTACAAACTCTTGCACAGCTACAAAGATCATTGACCGGTAATAATCTT
AAGATATGAGATAGGATGTCCACTTGGAGAAATGAAAATAGGCTCTGTTT
ATCATGATCATCATCGTTGGGACAGGTTTGAGAAAAAATGAACGGTTGCG
ATGAGGATATCGTTGAGTTTGATGTTTGATGATTTGAGTGAATAGATACA
GGATGAATGCTTTCAGTAGAAGTCACTAAAATCTTTGAAGTTTTCTTATT
AAGATTTTTTGAGCATCCAGGAGACATCATGTCGTTTGGTAAAGCCACGA
AGCTTGATTTACTTTCGTATGGGTTAATGAATGAGTTGATTGAATTTCTA
CCGGTATTTATCCATGGGAGATTTGACTGAACACTGCAGTTATTAAGCTG
CCTATATATTTGACTTCTATCACTTAGATCGCTGATTATACCAGAACTGC
TGTTGGTTTCTTGAGAATGAACTGTATAATTTTCATTTGTCTGTTTTTTA
CCTTTTTTTGATTTTTTTGAAAACTTAAATCCACAAAATTTAACATTTCT
TGTGCATTGCATAGATAGAAATGAAGATTTTCAACAATAA
back to top

protein sequence of SMED30033623-orf-1

>SMED30033623-orf-1 ID=SMED30033623-orf-1|Name=SMED30033623-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
MQCTRNVKFCGFKFSKKSKKGKKQTNENYTVHSQETNSSSGIISDLSDRS
QIYRQLNNCSVQSNLPWINTGRNSINSFINPYESKSSFVALPNDMMSPGC
SKNLNKKTSKILVTSTESIHPVSIHSNHQTSNSTISSSQPFIFSQTCPND
DDHDKQSLFSFLQVDILSHILRLLPVNDLCSCARVCKQWYSVVWNQNMWY
KLDFSQCHNDSGINIHKGIDTILKILSYRTPPFCYCLKVIDLSKCQITDD
DLIKIANKCPELEVINLTLNIHLQNASVCHLIITCRRIHTLNLSKCIQIN
ELKLIQSQIQYSPIFPRNTVDNLKHLDLSYCRQIDDSCIHSFSPVFNRLR
KLILKECRMITDGGMKCLAKYGLHLKYLDIAGCCFVTDKGISSVIMNLHC
LRRLSISKCHKITNNSIQAISTSNNQICEIILRNCSSITFSSLKLLRNLR
IIDLSDNCQISRQSIFQIAENNRYSLKILIINKFDNISREFLRELFQMCV
RLKYIDIKNCKFIDPTPLRRHIVYKSVLKSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR006553Leu-rich_rpt_Cys-con_subtyp
IPR001810F-box_dom
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006553Leucine-rich repeat, cysteine-containing subtypeSMARTSM00367LRR_CC_2coord: 285..311
e-value: 690.0
score: 0.2
coord: 346..371
e-value: 0.047
score: 22.8
coord: 259..284
e-value: 86.0
score: 7.3
coord: 234..258
e-value: 29.0
score: 10.9
coord: 320..345
e-value: 45.0
score: 9.4
coord: 372..397
e-value: 11.0
score: 14.2
coord: 499..524
e-value: 150.0
score: 5.4
coord: 398..423
e-value: 0.0088
score: 25.2
coord: 446..471
e-value: 37.0
score: 10.1
IPR001810F-box domainSMARTSM00256fbox_2coord: 162..202
e-value: 1.0E-6
score: 38.3
IPR001810F-box domainPFAMPF12937F-box-likecoord: 165..204
e-value: 4.2E-11
score: 42.6
IPR001810F-box domainPROSITEPS50181FBOXcoord: 156..202
score: 10.61
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 374..393
e-value: 0.016
score: 15.2
coord: 236..256
e-value: 0.19
score: 11.8
coord: 348..369
e-value: 0.73
score: 10.0
IPR001611Leucine-rich repeatPFAMPF00560LRR_1coord: 322..342
e-value: 0.23
score: 12.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 427..530
e-value: 4.6E-7
score: 31.0
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 315..426
e-value: 7.9E-19
score: 69.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 201..314
e-value: 8.5E-10
score: 39.5
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 150..200
e-value: 4.2E-10
score: 41.2
NoneNo IPR availablePANTHERPTHR13318UNCHARACTERIZEDcoord: 149..511
NoneNo IPR availablePANTHERPTHR13318:SF50F-BOX/LRR-REPEAT PROTEIN 7coord: 149..511
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 179..515