Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30033622
Length (bp)3448
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30033622) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30033622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30033622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30033622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033622SMESG000059440.1 dd_Smed_v4_6251_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033622SMESG000059440.1 Contig40651newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033622SMESG000059440.1 Contig40651uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033622SMESG000059440.1 Contig45060newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033622SMESG000059440.1 Contig45060uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033622SMESG000059440.1 Contig47979newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033622SMESG000059440.1 Contig47979uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 251.521 bits (641), Expect = 2.322e-68
Identity = 217/733 (29.60%), Postives = 342/733 (46.66%), Query Frame = 1
Query:  337 GRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTG---AFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G   + VD K GDI+ T ++IDRE +  CQ   P   C+     +  + +     ++ E QIE+ DINDN P+F     T+ IPEN    S F +P+A DRD+   GV  Y L++   +      ++ +      P L V+G+LDRE   S++  +   DGG        ++ +T  D NDN P++    Y  E+SE +     V+Q+ A D D  Q    +I +      Q  E++ R+  +  +   + + G +     +     V+A D     +S    + + +KD ND+ P I++    L         I E+   +  V  + V+D D+G N+  +C +     V       S   +  +KK F   + P    D EK   Y++E++  D+G P +SS+  + + + D NDN P F       +  E+ K G  I  + A D+DS  N  + YS+  +   K  F I+   G+I +   LDRE ++ YE  V A D G P+L  +  + + VLD NDN P+   S Y+F ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DRE+       +  +D G PPR+A   V I VLD NDN P  T P   +H  L  T     G  V +V A D D G+N  +IY++   N    LF I S  G I L+K+++ +     RLVV+  D+G P    T  +++
Sbjct:   95 GAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTP---LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ-NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLL--TPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHL 810          

HSP 2 Score: 136.346 bits (342), Expect = 9.800e-32
Identity = 141/582 (24.23%), Postives = 254/582 (43.64%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYI--TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII---GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNR 2157
            L++ ++D NDN P F+      ++ EN       S+   K  DS++    +       +         +D    +   + V G +DRE++ +  F + A D G N    + +++V + D+NDN P    + +GL   ++    ISE    E  V  +   D+D+ +       + G + F++ + S+      + +++  T  + Y      +  K+    IV + +     S+  ++++++ D ND+ PV     + +   EN K   ++  IT +D D G N+E   SL      +   ++T   E G      Q+ +      DRE+   Y ++V+  D G+P++  +  + + + D NDN P F      FS+ E+      +G+V   D D   N  +  S+    GD+ ++     N  G I  +   DRE +  Y F ++A D G P  +    + I VLD NDN P I+  ++ S K++    R  +   + ++ A D D G N    + +   +     Q+  + G I     I+R       ++V V D G PPR  T  VH+ V +   NR
Sbjct:  266 LRVTVLDTNDNAPKFERPSYEAELSENSPIG--HSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGL---ITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDY------EKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEP--AAKGLFTISPETGE----IQVKT----SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ-----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGE--TVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR 819          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 252.292 bits (643), Expect = 4.971e-68
Identity = 217/733 (29.60%), Postives = 342/733 (46.66%), Query Frame = 1
Query:  337 GRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTG---AFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G   + VD K GDI+ T ++IDRE +  CQ   P   C+     +  + +     ++ E QIE+ DINDN P+F     T+ IPEN    S F +P+A DRD+   GV  Y L++   +      ++ +      P L V+G+LDRE   S++  +   DGG        ++ +T  D NDN P++    Y  E+SE +     V+Q+ A D D  Q    +I +      Q  E++ R+  +  +   + + G +     +     V+A D     +S    + + +KD ND+ P I++    L         I E+   +  V  + V+D D+G N+  +C +     V       S   +  +KK F   + P    D EK   Y++E++  D+G P +SS+  + + + D NDN P F       +  E+ K G  I  + A D+DS  N  + YS+  +   K  F I+   G+I +   LDRE ++ YE  V A D G P+L  +  + + VLD NDN P+   S Y+F ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DRE+       +  +D G PPR+A   V I VLD NDN P  T P   +H  L  T     G  V +V A D D G+N  +IY++   N    LF I S  G I L+K+++ +     RLVV+  D+G P    T  +++
Sbjct:   95 GAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTP---LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ-NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLL--TPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHL 810          

HSP 2 Score: 135.961 bits (341), Expect = 1.330e-31
Identity = 140/580 (24.14%), Postives = 255/580 (43.97%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII---GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNR 2157
            L++ ++D NDN P F+      ++ EN       S+   K  DS++    +       +         +D    +   + V G +DRE++ +  F + A D G N    + +++V + D+NDN P    + +GL   ++    ISE    E  V  +   D+D+ +       + G + F++ + S+      + +++ ++   L+   +K +      IV + +     S+  ++++++ D ND+ PV     + +   EN K   ++  IT +D D G N+E   SL      +   ++T   E G      Q+ +      DRE+   Y ++V+  D G+P++  +  + + + D NDN P F      FS+ E+      +G+V   D D   N  +  S+    GD+ ++     N  G I  +   DRE +  Y F ++A D G P  +    + I VLD NDN P I+  ++ S K++    R  +   + ++ A D D G N    + +   +     Q+  + G I     I+R       ++V V D G PPR  T  VH+ V +   NR
Sbjct:  266 LRVTVLDTNDNAPKFERPSYEAELSENSPIG--HSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGL---ITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFL-QTTTPLDYEKVKDYT---IEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEP--AAKGLFTISPETGE----IQVKT----SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ-----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGE--TVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR 819          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 231.106 bits (588), Expect = 1.157e-61
Identity = 235/801 (29.34%), Postives = 367/801 (45.82%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISK---CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSP--LENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYIN 2526
            ++ E    N  IGNL+K     LI N++ +T    T  F+L  +  +     LI +++  G+I+ T A IDRE++C  I +   C     +  +     ++ +++  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++   LEN               Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y F + E+  R   H  +G +  +D D G N      +   +    I     G I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P  S  + + +  F         NE+  N+  IN
Sbjct:   61 TIREEIPENVLIGNLLKDLNLSLIPNKSLTT----TMQFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAA-------------YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYN-YSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLF--------VNESVTNATLIN 815          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 230.72 bits (587), Expect = 1.366e-61
Identity = 234/802 (29.18%), Postives = 370/802 (46.13%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISK---CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSP--LENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYIN 2526
            ++ E    N  IGNL+K     LI N++ +T    T  F+L  +  +     LI +++  G+I+ T A IDRE++C  I +   C     +  +     ++ +++  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++   LEN               Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y F + E+  R   H  +G +  +D D G N      +   +   D  + ++  +I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P  S  + + +  F         NE+  N+  IN
Sbjct:   50 TIREEIPENVLIGNLLKDLNLSLIPNKSLTT----TMQFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAA-------------YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDEND--DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYN-YSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLF--------VNESVTNATLIN 804          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 230.72 bits (587), Expect = 1.366e-61
Identity = 234/802 (29.18%), Postives = 370/802 (46.13%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISK---CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSP--LENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYIN 2526
            ++ E    N  IGNL+K     LI N++ +T    T  F+L  +  +     LI +++  G+I+ T A IDRE++C  I +   C     +  +     ++ +++  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++   LEN               Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y F + E+  R   H  +G +  +D D G N      +   +   D  + ++  +I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P  S  + + +  F         NE+  N+  IN
Sbjct:   50 TIREEIPENVLIGNLLKDLNLSLIPNKSLTT----TMQFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAA-------------YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDEND--DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYN-YSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPD-SLFSVVIVNLF--------VNESVTNATLIN 804          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 163.696 bits (413), Expect = 2.578e-40
Identity = 204/761 (26.81%), Postives = 337/761 (44.28%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHNGQI-HLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRS----RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL--TNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++PI  +I  ++    S++ L       +  +S    ++L ++D   G+I +  ++DRE + + I K      ++  I A   +    + ++D+ DN P F+ D    +I E+    +      A+D DS + G       S+     +N   +    N  +  ++    LDRE +      + ASD G  + +   +VEIT  DVNDN P +    Y   I E  T  A +  + A D+D      G++ + ++ +S    + +  +   E  L   I A    K +  + V+ A DG   +  +T+ L I   D NDH P +      + ++EN      V R+   DED G N     S+  +    +D       E+ G  K  +L        DRE  +RYS++V   D GTP++++S  I + + D NDN P F+ +    +ISE+   G +I  + A D+D   +  ITY I   D EV     I   G I  ++  L R+   +    + A D G   L   C + + + DVN         +S KI E       H  IG     L A D D G N    + + S    R  P      + G I    ++DRE      V+V   D+ +PP   +T + + + D+NDN P+FT     A     I++D+  G+   +V A D D G NG + Y L  ++ + +  LF + ++ G + +  KLD +      L + ARD+GTPSLSA + + +
Sbjct:  177 DTPIETIIASVKASHASSQPLYYSMVAPQDSRS----QNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVV---VHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENG---EIEYSLGEGNGKNLLAI----NAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED--FGTNGKVHYSMASSSGIGGLTID-YSTGEVTLRERIDA----KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIID-------EDSGLIKTTKL-------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQG--GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPE-------HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDP------SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITL 880          

HSP 2 Score: 139.813 bits (351), Expect = 6.319e-33
Identity = 158/610 (25.90%), Postives = 257/610 (42.13%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEIS-ECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI--------IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRV--RSRSTPIDIQVYNEG----KIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDED 2262
            L I +IDIND+ P+    +K I + ENVA   E     A D DS   G+        S    E++  +ID  + +   ++    LDRE    +   + A D G         I V + D+NDN P +    Y   IS E    ++++ L A D D+ Q    +I ++I E  +    +  I  I +    L++      +++K  + + A D  G      + + I D N   P    H  S+KI E+      V  +   D D+G N+    S++ + F  +D        + G   +           DRE  + +SV V  +D+ +P +++S  I + + D NDN P F +     +ISED  +G     V A D+D  PN I+ Y +        I  + +  T     +G + ++  LDRE        + A+D G P+L+ + +I + + DVNDN P     SY   I E+         +G + A D D G N    FR+   + +   DI+   E     +I+     D E             +G    ++T  V I V DVNDN+P     ++     +N  D++     +G + A D D
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGI-----IKYSMEGSEDF--IIDEDSGL---IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ----KITYRIEEADRE---VFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDP-------SSGDISVSS-------DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRT-----SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGST---VGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFVI----LMNRFDNVQMARQIGFIPAFDPD 1028          

HSP 3 Score: 104.375 bits (259), Expect = 3.489e-22
Identity = 98/319 (30.72%), Postives = 154/319 (48.28%), Query Frame = 1
Query: 1519 NPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLN--ASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            N  HF+ E     + ED  I   I  V A  + S P   + YS++   D   +  F ++  +G+I L K +DREV D++   V A +  +P ++ S  + + VLDV DN P       F  +    RE        L+  A D D G+NG   + +   +    + +    G I     +DRE +  I + V   D G P R +T  V I V+DVNDN P F     N    + I +++   +++  VKATDEDFG NG + Y++ + +    L    S G++ L++++D K  +P   V+ A+D   P+LS+T  L I
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHASSQP---LYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEI----REDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYN----VTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTI 467          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 154.836 bits (390), Expect = 1.578e-37
Identity = 166/586 (28.33%), Postives = 259/586 (44.20%), Query Frame = 1
Query:  739 LDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTT-EAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-LYFDREKASRYSVEVICNDNGT-PTMSSSEI-ITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMA-AGS----IVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFK 2469
             D E  KS++  + A++         I + + DVNDN P +    Y   + E    E  +L ++A D D      G++ + I   S ++     I  +T  +      A K     +  +VV A DG G+S+E +  + I   +      +   S  +I+  E            D   GI      +++   +    S+Y+     G Q   F ++   G +Y  R   +     V+ N   T P+  S++  + IFI D NDNPP F +     SI ED K+     +V A D D   N  + YSII  +           GQ+    +LD E    Y+  V+A D G P  + +  + I VLDVNDN PE   S+    +E  E       +GK+ A D+D  +NG   +R+ + S    I     G +    +IDRE +  +D+ +   D G PPR++T +  I VLDVNDN P          + L+IT  +  AGS     +G + A D D GLNGS++Y    Q+    LF ++S+G + L+++L+   +   RL V   DQG P  S    + +R  K
Sbjct:  601 FDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMD--SGTFGEVSYHILSESSSFS----INPVTGEVF-----AQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTE------------DILPGIAIGSVGAMSKVKY----SIYS-----GDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSW--YTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGID-EKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP----------SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS---SLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISK 1138          

HSP 2 Score: 107.842 bits (268), Expect = 3.258e-23
Identity = 128/541 (23.66%), Postives = 236/541 (43.62%), Query Frame = 1
Query:  736 DLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIK--VHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDR---EKASRYSVEVICNDNGTPTMSSSEIITIFISD-ENDNPPHFE-TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSR-----------STPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHI--EVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +LDRE ++ +   +  + G G Q   R+ V + ++NDN P +     R+        + V  + A+D D+   +     F +S++S        I   T +I   ++ A   F+      + I A        T + + + D ND+ P     ++ +++        +    +I   D D       + SL                   G   IF++    G  F +       RY V V   DNG P+ S+S  +++ I + E  + P FE  EF+ F + E++KIG +IG +  ++S         +  I D E  + F I+  G++ +   +DRE +  +EF VE  +    +    CK  +IVLD NDN+P   S +Y   + +S     K   IG++ ASD+D G+NG   +R+ S            +  I +  +N+ ++  F N   +      +LV+  D+G+P R A   V +  ++   + + P F  P+   H    + +D + G+++ +++A++     N  ++Y+L
Sbjct: 1887 ELDREILERYSLKVIGT-GSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDN---LAPLRYFLVSDSSGQTPTHFNIDQFTGTI---HLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPF-AKIEAHDLDA--RGALTYSLGQ-----------------GSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFR-FEVMENSKIGLQIGNLSGEESRE------FHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQK---IGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQ------ILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVH----VLEDTSVGTVLQKIRASNRLGMRNDGLLYSL 2380          

HSP 3 Score: 101.293 bits (251), Expect = 3.054e-21
Identity = 174/752 (23.14%), Postives = 311/752 (41.36%), Query Frame = 1
Query:  127 LMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNN--INPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRP----VIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEV----KETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI 2331
            L+F + + +F  +    ++F+V      E  Q     IG  I  I    K  E    K F +  ++  +     + VD++ G+I   + +D E+  +          +   +    +  ++ +E+ D NDN PSF      ++I E     + F+LP   D D  K+ V   +   I      N F+L     N  +   L V G LDRE    +E  + A DGG     G+ R  +EI D NDN P +    Y   +S   +  + ++ + A D D    IG   +I + I + S         F I++S +     +L     +   ++V+A+D      S+   + + +       P    +  V S+S  + EN     +V R+++  +             DT    + S    P +   Q  ++ L  + G+  DRE AS + ++ +   +G   +   +++T  I D NDN P + +     S++        +    AKD D   N  I YS++ D E+    KET      G+I +   +D  +    +F V A+D G P L+   ++   +LD     P+     +   VE  E       + K+ A++   G +   R+ ++++   + +   + G +      D E   K      +  N N   T+T+ + I + DVNDN P F YP  N + +L + +       +  V A+D D G  G + Y++ +++ +   FSI
Sbjct:   10 LIFSLIFLIFPTFCQCLTKFTVP-----ESAQ-----IGTRIGWISG--KREESAAPKYFVVFPDEQTS---KFLKVDERSGEISTIAHLDYEKRSK-------FDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDV---HRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDAD----IGENSRISYDIKKTSAPSN---SNFAISQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQ-----------YRDTKLRLIGSSALCP-QQTDQAHVYLL-LLCGI-LDRETASEHHLKFLLEKDGQIIIEHPQLLT--IGDINDNAPQWHSSQIHISLNRTQGGSRTL---TAKDPDLGQNGWIRYSVL-DTELVSIDKET------GRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEK--ALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMS-GTVCIQKTFDFE-KQKSYQTTVIATNAN-SETSTSLISIRLKDVNDNWPIF-YP--NEY-HLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS---FSI 689          

HSP 4 Score: 83.5741 bits (205), Expect = 9.402e-16
Identity = 137/611 (22.42%), Postives = 243/611 (39.77%), Query Frame = 1
Query:  682 FELIDHGNNINPYLRVIGDL---DRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDA-KIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHT------KDLFSIQ----SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            FEL++  +     +   GDL      +++S++  L   D G         +EI++ N  T     L + K+    T +  + +     K  P+  G  + + I E + +    V     +E ++  N+   +   E + S+ VI   G G+   T +++ + + ND+ P   + S   ++ EN +    V  +   D D      +        F+  DS   +P         F ++   G        D E    +++ +   D    T ++   +TIF+SD NDN P F       ++S      G     + A D D+     +TYS+         F +         K+L     +RY  TV A DNG P+ + S  + +I+ +             F+  E  E       IG L+       ++  F +R++         +   G++   G IDRE+    +  V++ +     +      H+ VLD NDN P FT    +   YL++ D MA G  +G++ A+D+D G NG + Y + + N         D  SIQ    +D Q+              +++VEARD G P+ +A   + +
Sbjct: 1765 FELLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAG--LTYSIVEGNIDSAFSVD----SEGVIRTNLELDREILE-RYSLKVIGT-GSGQQIGTRVDVRVNNLNDNVPSFPM-SKPRRVPENLRVGSYVATVGAKDVDNLAPLRY--------FLVSDSSGQTPTH-------FNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSL--GQGSSSIFRVAPESGALFMKVLP-PAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRF-EVMENSKIGLQIGNLSGE-----ESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFT----SVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATW------QILVEARDHGHPARAAVGKVQV 2327          

HSP 5 Score: 82.8037 bits (203), Expect = 1.386e-15
Identity = 139/635 (21.89%), Postives = 260/635 (40.94%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGN------NINPY---LRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA--KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIK--VHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKD----RYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWERE-----HKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHT 2313
            + + + ++NDN PSF P  K  ++PEN+   S  +   AKD D+                    YF + D         NI+ +   + +   LD E +      + A+DG  +     + + ++D+NDN P +    Y+  +S  T        ++ A D D      G + + + + S +      IF +      L +  L    E +  + V A D    S  T++ + +    +  P  K     +  + +  E SKI +    ++ E+   + EF   + D                    KIF ++    L+     DRE+ + +  +V  ++    +        + + DENDN P F +     S+ +    G +IG ++A D DS  N  ++Y I+   ++         G I LN+  D ++ +     ++  VEA+D+G P      K++     V+  +   S S  F ++  +E            + K+ AS+R   +N    + ++     + I V   G++    ++D E    I + + V  +GN  R+A   + I V  V++  P FT     +   L I     AG  VG+++A DED G++G + Y+++++  T
Sbjct: 1913 VDVRVNNLNDNVPSF-PMSKPRRVPENLRVGSYVATVGAKDVDN---------------LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDT-FTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD----ARGALTYSLGQGSSS------IFRVAPESGALFMKVLPPAGE-RYLVTVTATDNGVPSFSTSVPVSVI-IGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE---SREFHYRIQDPE----------------ASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQ-----VSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDV-KTGELTLKTHLDWESEPIISMYLSVS-DGNG-RSAVVPLKIVVEPVDEFAPVFT----KSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQST 2487          

HSP 6 Score: 72.7886 bits (177), Expect = 1.441e-12
Identity = 97/370 (26.22%), Postives = 151/370 (40.81%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKA 2250
            L I D ND+ P  + HSS + I  N +++     +T  D D G N     S+ DT  VS+D       E G   +IF  N+I     D    S     V   D G+P +S+   +   + D    PP FE       I ED  IG  +  V+A +S    +  I YS+       E   ++  +G + + K  D E +  Y+ TV A +           IR+   DVNDN P      Y   + E  + E     +   +ASD D G  G   + + S S+   I     G++     + R    +  ++V   D G      +  +HI V+D +   P+F+     +   +  T+D+  G  +G V A
Sbjct:  429 LTIGDINDNAP--QWHSSQIHISLN-RTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDK------ETG---RIFVPNTI-----DCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ---DEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRL--KDVNDNWPIFYPNEYHLTVREGPKPEEPLLVV---SASDMDSGTFGEVSYHILSESSSFSINPVT-GEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFS----RSKYEIRTTEDILPGIAIGSVGA 765          

HSP 7 Score: 54.6842 bits (130), Expect = 5.187e-7
Identity = 144/665 (21.65%), Postives = 248/665 (37.29%), Query Frame = 1
Query:  343 HLISVDQKKGDIWVTSAID---REEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDH--GNNI-----NPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVL-QLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIV--VIAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDR------EKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS-RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDED 2262
            H  S+D+  G I+VT  +D    + +   I   L     N          ++ I I D NDN P F      I I E++     F +  A D+D +K G              E  + +I    G++I        L     LD E  ++++  + A+D G         + + + DVNDN P++    Y  E+ E +    ++ ++ A+DKD  +   GQI ++I+  S+        F I E +   N+   +S      S V   I A+ +G   RS+  +  + + D ND+ P   +  + + +         +  I   D D+G+N                 +Y + L    Q  +F + S   +Y  R      E+  R S  VI +D G P  S    + + IS  + +    E   K   I +    G  +  + A          ++  +I   E+   F I       ++  + R     Y   +   D    +   S ++R++      N  E     + +I +S     K   IG+L     D    G+F +R  S  S P+++     G ++Y  +  R              N          V +E+     ++P+F       H  +NI +D   GSI+  V AT  D
Sbjct:  780 HNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQT--------QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNG--------------EVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLEN--GQIVYRITNGSE-------YFGIDEKL--GNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSC-LSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSV--------------LYRAQL----QSSLFVVKSNGDVYLRRQLNASDERHQRLS--VIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNATG--------VSSWLIQSSEISNHFAIREGVLFMISHPIHRP---PYSLVIVLSDKN--DRQKSIQLRVLASGEAANKEE-----TIRISDSNSIGTK---IGRLGEKSAD----GSFFYRFSSEESCPLELD--QTGGLLYLADGLRRGDTHNFSCFFEKFNTTDGSAEEMRVDLEISRTKSDKPRFD----TGHLRVNIREDTPTGSIITTVNATVSD 1359          

HSP 8 Score: 53.5286 bits (127), Expect = 1.195e-6
Identity = 31/84 (36.90%), Postives = 43/84 (51.19%), Query Frame = 1
Query: 1720 LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRV 1971
            LDRE    +   +   D G  + NDSC +R+ V D NDN P++  S   ++ E  E       + +  ASD DIGQNG F F +
Sbjct: 1687 LDREASQEHLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDASTPSEL-EIAESSRVGDVLHRFRASDMDIGQNGKFSFEL 1767          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 139.043 bits (349), Expect = 8.582e-33
Identity = 158/610 (25.90%), Postives = 257/610 (42.13%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEIS-ECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI--------IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRV--RSRSTPIDIQVYNEG----KIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDED 2262
            L I +IDIND+ P+    +K I + ENVA   E     A D DS   G+        S    E++  +ID  + +   ++    LDRE    +   + A D G         I V + D+NDN P +    Y   IS E    ++++ L A D D+ Q    +I ++I E  +    +  I  I +    L++      +++K  + + A D  G      + + I D N   P    H  S+KI E+      V  +   D D+G N+    S++ + F  +D        + G   +           DRE  + +SV V  +D+ +P +++S  I + + D NDN P F +     +ISED  +G     V A D+D  PN I+ Y +        I  + +  T     +G + ++  LDRE        + A+D G P+L+ + +I + + DVNDN P     SY   I E+         +G + A D D G N    FR+   + +   DI+   E     +I+     D E             +G    ++T  V I V DVNDN+P     ++     +N  D++     +G + A D D
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGI-----IKYSMEGSEDF--IIDEDSGL---IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ----KITYRIEEADRE---VFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID-------PSSGDISVSS-------DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRT-----SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFVI----LMNRFDNVQMARQIGFIPAFDPD 669          

HSP 2 Score: 136.346 bits (342), Expect = 6.530e-32
Identity = 163/564 (28.90%), Postives = 254/564 (45.04%), Query Frame = 1
Query:  820 IVEIT--DVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHNGQI-HLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRS----RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL--TNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            +VEIT  DVNDN P +    Y   I E  T  A +  + A D+D      G++ + ++ +S    + +  +   E  L   I A    K +  + V+ A DG   +  +T+ L I   D NDH P +      + ++EN      V R+   DED G N     S+  +    +D       E+ G  K  +L        DRE  +RYS++V   D GTP++++S  I + + D NDN P F+ +    +ISE+   G +I  + A D+D   +  ITY I   D EV     I   G I  ++  L R+   +    + A D G   L   C + + + DVN         +S KI E       H  IG     L A D D G N    + + S    R  P      + G I    ++DRE      V+V   D+ +PP   +T + + + D+NDN P+FT     A     I++D+  G+   +V A D D G NG + Y L  ++ + +  LF + ++ G + +  KLD +      L + ARD+GTPSLSA + + +
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED--FGTNGKVHYSMASSSGIGGLTID-YSTGEVTLRERIDA----KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIID-------EDSGLIKTTKL-------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQG--GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPE-------HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDP------SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITL 521          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 117.087 bits (292), Expect = 6.023e-26
Identity = 206/790 (26.08%), Postives = 344/790 (43.54%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTK-SFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFAD-----HQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXEN-YFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKD-DPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALK--SFKENKA--SIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSI------SEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGN-IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLN-ITDDMAAGSIVGEVKATDEDFGLNGSIIYNL-----TNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD---SFDRSNENSM 2508
            ++ +GN+I  +Q     TEI + + +    SE+S+++     SV++  G I V S++DRE   Q              I AD     H I  + ++I D+NDN P+F  D +   I E+ A  +  ++  A DRD    G      +   S + EN YF+L    N  + +L V   LDRE I  ++    A+D GG        + ++DVND+ PQ+    +  ++   +T + +L  + +D D  P  +    +F I + ++       +F+I  +    N   LK     ENK    + V A DG   ++ T +++ +K   D        + ++ + EN K   +V   +      G N  F  S ND N      ++     NG    I ++     + +++ +   +   +   DN   +    E+IT+ I + NDN P    +    SI      SEDA+    I  ++A+D+D      I + ++ D+     F I+  NG + + K LD E+   +  TV A D GE    D   I + V+D NDN P    S YS K++ES   E   + +    AS  D  QN T  + ++       + +  +  I+     +D E +  + + V   D+G PP      V I V+D NDN PKF         Y+  + ++  +G  V  VKA D D    G++ Y L     T  +     F+I S+G +++ + +D +      L V A+D G P L +   L I      D   +FD  N  ++
Sbjct: 2620 DADVGNVIGRVQQM--ETEIDEIRFTIVPGSEESDSF--LPFSVERSTGKIIVKSSLDRERKNQ----------WKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSG------RIRFSLVEENPYFDL----NENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPST-SPILHFSIKDDDLSPNNVS---QFFIPKGNEE-----GVFWIDSN----NDLLLKRPEIVENKMQYQLKVTAFDGVFETS-TKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLGESSL---LGPNVTFKLSDNDGN------VFVVNFRNG----IVKVKESDQIDYEKNQQLEFH-RLTIQDN---SEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDAR--QYITRIVAEDADFDE---IKFRMVDDF--GGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASD-GE--FEDKATILVTVIDQNDNAPTFEKSTYSMKVMES---ESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF-----EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTAL 3334          

HSP 2 Score: 103.605 bits (257), Expect = 7.308e-22
Identity = 166/609 (27.26%), Postives = 261/609 (42.86%), Query Frame = 1
Query:  823 VEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYF--------DREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEF----KTFSISEDAKIGHEIGIVIAK---DSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDN-----GEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGT---FRFRVRSRSTP-----IDIQVYNEGKIIYFG--NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYF-----KPRDSFDRSNENS-MNSKYINP 2529
            + I DVN+++PQ+  + Y   ISE     K + ++ A D D      G+I+F +  N+Q    ++ I   T  +  L   +L    ++  +  +IA+D EG   R + T + + ++D ND+ P   V  S  +I E+      V+ +   DED G NS+    LN                   +K  F+++   G  F        D  K   +++ +   D+G P +S+S  + + + D   N  H   EF    K  S+ E+++IG E+ ++ AK   D        + Y IIG  +    F I+  G +    +LDRE K  Y  TVEA+D+      +P   D   + I +LD ND+ P         I    E    +  I K+ A+D D   N       F++  R  P     ID+     G I   G   +DREK  + ++ V + D G P   +   V + VLD NDN P FT  +   H+Y ++    A    +  + A D D G N  + YN+T  +     FSI ++G II  + +         L V+A D GTP      T  +        KPR S +   E S   S Y+ P
Sbjct:  708 LRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGN--NGKIKFSLG-NNQEKSSVISIDAKTGIVKLLK--SLDREDQDVHTFAIIASD-EGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN------------------SEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHN--HLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGG-DGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP--VAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIE-RGDPQSFFRIDL---TSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAI---HHY-SVRSKFAGK--LCRIFAVDADEGENARLTYNITEGDAR---FSIDNNGNIIASEAIHGDESYA--LTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIP 1272          

HSP 3 Score: 102.449 bits (254), Expect = 1.473e-21
Identity = 116/431 (26.91%), Postives = 182/431 (42.23%), Query Frame = 1
Query:  703 NNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS----IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNI-ITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKI-VESWEREHKHFYIGKLNASDRD-IGQNGTFRF 1965
            ++IN  + V+  LD E +  F   + ASDG   + K  I+V + D NDN P +    Y  ++ E  +   ++    A   D  +TI   ++     +  N      I  + + + +  + ALK        + V+A D        E  +E+ + D ND+ P  +      K+KEN KS   V  +   D D   +  F     +   VS  +  T  L        F +NS    +     D EK  +Y+++VI  D G P + S  ++ I + DEND+ P F+    T  + E   IGH +      D D   N    T  I GD    ++F +N   ++   K L+   KD+Y  TV AKD      +  C + I +   + + P   T    KI + + + E     IG+L ASD D   QNG  RF
Sbjct: 3062 DDINGVVTVVKPLDSEILGFFNLTVVASDGEF-EDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALK--------LTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVD---SEHFGAVSYELEIVSETTTDTPVLP-------FAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDG--AKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTD--CPLTIFIRQTSRHAP---TMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRF 3466          

HSP 4 Score: 100.523 bits (249), Expect = 5.735e-21
Identity = 110/417 (26.38%), Postives = 184/417 (44.12%), Query Frame = 1
Query:  739 LDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE---CTTEAK--VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLND-TNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKET----FGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGT 1956
            +D E  +  EFH           K  I V I ++NDN P+ +    +  I E    + +A+  + ++ A+D D       +I+F++ ++      I  I  +   +  L+   L  F     ++ V+A+DGE   ++ TI + + D ND+ P  +  + S+K+ E+E     +     +  DQ    E+    +D T+FV+L++          Q  I  L        D E  S   + V+  D+G P + +   + I + DENDN P FE E     + E++K G ++  V A D DS     ++Y + I      +T    F IN NG + +++ +D E   +Y   V AKD G P L     + I V D ND+ P         +V+  E E     + K + SD D  +NG 
Sbjct: 2971 IDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD-----FDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFF-----NLTVVASDGEFE-DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNA----------QTGILTLAK----PLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQ--EGEAIGHRLLKFSVSDLDGPKNGA 3360          

HSP 5 Score: 97.0561 bits (240), Expect = 7.593e-20
Identity = 136/535 (25.42%), Postives = 227/535 (42.43%), Query Frame = 1
Query:  712 NPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR--IIVEITDVNDNTPQWVGLPYRKEISECTTEAKVL-QLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD-GEGRSNETTIELEI-----------------KDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGN--IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNIT-DDMAAGSIVGE 2241
            N  LRV   ++R   + + F + AS  G N+      + +EI D ND+ P +     R+          VL +++A D+D+ +   G+I +K +      E+ + I   T  I  + +      K N     V A D G   S  + + L                   +  N H PV       +++ E+     +V ++   DED G N      ++D    S + +     E  G+  I   + +  L  ++ +     ++V   D GTP  SS + + + I D N++ P F+       ISE+ K G +I  V A D D   N  I +S+  + E      I+   G + L K LDRE +D + F + A D G P       + I V DVNDN P+    +S   +   +  H  F +  + A D DIGQN   +F + S   P  I  ++    I+     +D  K    ++ ++V D+G+P  + +  +H+E++D+             AHN+L I  DD+A  + V E
Sbjct:  442 NGILRVSAKINRSE-RVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGE--NGKIVYKFTS-----ELPLEINANTGEITLVEVPK----KGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVD--EQSGE--ITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPE-DLPHGAF-VSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDI-------------AHNHLAIEFDDVAKEASVYE 945          

HSP 6 Score: 87.4261 bits (215), Expect = 6.597e-17
Identity = 169/749 (22.56%), Postives = 302/749 (40.32%), Query Frame = 1
Query:  190 VKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTK-SFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEII-------DINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEIS-----ECTTEAKVLQLNAQDKDDPQTIGGQ-IRFKI------SENSQNYEMIVRIFYI----TESILYLNIGALKS----FKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-------FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVN----------DNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            V  YL + EN+KP     ++ K+  N        K K S     EKS+     +IS+D K G + +  ++DRE+  Q +          + I A  + F +++ +        D+NDN P         +IPE++   +  S   A D D           K       E     IDH +           LD      F   +  +D G       C + VE+ D+  N          KE S     E  TE  V+ + A++  D Q +  + + ++I         S + +  VR  ++    T+S  ++ + A  S    +K+ +            R +   + + I D NDHRPV K       + EN  + +++ ++           E + + +  N  +   M+   +E G  +  F+++   G          DREK S + + V   D G P + S+ I+ + + DENDN P F      +S+   +K   ++  + A D+D   N  +TY+I    E    F I++NG I  ++ +  +  + Y  TV+A D+G P    +     +VL  N          ++ PEIS   S  ++   + +     +GKL ASD D G    +        +  D++  + G+++    ++         L   + +G       +TV I+V      RPKF+     +H   ++++ +A G+ +  +KA+ E  G    +++NL
Sbjct:  723 VSYYLRISENEKPGK---DIFKVTANDFDGGNNGKIKFSLGNNQEKSS-----VISIDAKTGIVKLLKSLDRED--QDVH--------TFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDED------IGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTE--VIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPR------------RRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKV-----------EATDADDVDNDAAAPLMFK--IERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVR--SKFAGKLCRIFAVDADEGENARLTYNIT---EGDARFSIDNNGNIIASEAIHGD--ESYALTVQATDHGTPGQQFAAT--RVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDAD-GDELWWSISSGDPDSVFDVR-QDTGQLLLAKKVEL-LKRGELRLNISVTDGQA--WDHSTVIIQVSRQISQRPKFSA----SHYQTDVSERVAVGTQIYTLKASGESLGTK-PLVFNL 1401          

HSP 7 Score: 85.1149 bits (209), Expect = 3.304e-16
Identity = 95/377 (25.20%), Postives = 158/377 (41.91%), Query Frame = 1
Query:  757 KSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKA----SIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGIN--SEFSCSLNDTNFVSL------DSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE 1845
            K ++  L   D  G +    + + + D+ND  P +V   Y   ISE   E   V+ ++A D D+  TI  +        SQ + +  R   IT          +    E+KA    S+ + A D     +  T  +E+           + S S+K+     S  L + +   D    I    +    +++  F  +      DS     +E    K I + +       DRE+ +++ + +  +  G   + +   +T+ I D NDN P F  +++ F+ISEDA +G  + I  A D D SP+  I +S++   E    F +N N G + +   LDRE  D Y+    A D G    N      I+V DVND+ P+
Sbjct: 2471 KRYQIPLVVEDATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTI--EYSLLDGSESQFFSVHPRQGTIT----------VAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVN----------IASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSS------LDRERKNQWKMTIRADAAGG--VHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLV---EENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQ 2812          

HSP 8 Score: 76.6406 bits (187), Expect = 1.075e-13
Identity = 91/379 (24.01%), Postives = 158/379 (41.69%), Query Frame = 1
Query: 1060 ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGI----NHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYS-FKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKF 2166
             L   ++ +  I ++  D  GR   +T+ L + D ND  P   +   S  I E+ K    V  ++ TD+D+    E+S                  L +G + + F ++   G        + +     S+ +   D+  P   ++  + + I+ E+   P F      FS+ EDA +G+ IG V   +++      I ++I+   E  ++F         G+I +   LDRE K++++ T+ A   G   ++    + + + DVNDN P     Y  F I E          +   +A DRD   +G  RF +   +   D+   N G +     +DREK+D   ++    D G        T  I V DVND+ P+F
Sbjct: 2464 VLNYHRDKRYQIPLVVEDATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYS------------------LLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDE---IRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTS---VTIFSAMDRDDSPSGRIRFSLVEENPYFDLN-ENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFT--IVVSDVNDSPPQF 2813          

HSP 9 Score: 69.3218 bits (168), Expect = 1.900e-11
Identity = 67/267 (25.09%), Postives = 127/267 (47.57%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPV-AKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEI--TDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQ 1272
            +++I ++D NDN P F+ ++   K+ EN ++S E  L V A D DSE +G   Y L+ +S +  +    ++    N N  + +   +D E IK +   + A DGG    +   ++EI   D ND+ P +        + E      ++L+ +  D D P+  G     +I  +        + F + E +  L    L+  K++K  + VIA D +G++ +  + + I+  + H P +K     +   +NE  + ++ R+  +DED+
Sbjct: 3201 QVEISVMDENDNAPKFEKEKYVGKVKEN-SKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDT--PVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKN-GAPFTVEIQGDG------AKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDE 3457          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 103.219 bits (256), Expect = 8.367e-22
Identity = 170/664 (25.60%), Postives = 275/664 (41.42%), Query Frame = 1
Query:  346 LISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFS--LPVAKDRDSE-KYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEI--TDVNDNTPQWVGLPYRKEISECTTEAKVLQ-LNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICN---DNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAK---IGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN 2301
            L +V+   GDI     +DREE    + + L  A  +  I +     ++ I + DINDN P F+     IKI EN    S+    L   KD+D+E +Y ++     +I        F +    N    ++ V G ++RE  + F F +  +DG   +   ++IVEI   D NDN P          + + T   +++  +N  D D    +   +       S+N E+                  LKS  +    + V  +D  G                H PV      ++ ++E+++ ++ V +                   D+   S+ S  +  LE      I +  S      D E+ S   V +I     DN    +S+    TI I D NDN P F+ +   F+++E++    IGH    VIA+D D S    + Y I+G  +    F +  +GQI   + LDRE K  Y   VEA D+G+P    +  + + VLD +DN P  S  +  ++ E          + +L+ASD D   N  F         P  +   N G +    ++D EK     + V + D         T++ + V DVNDN P F  P      YL I+++ +A   +G+  A+D D   NG I Y++T+
Sbjct: 1698 LFAVNSTTGDILSLIPLDREE--SSLHELLIEA-KDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIP-------FRI----NVATGWITVAGKVNREENEEFRFFVKVTDG---EKSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEI-----------------TLKSPLQTAVPVRVTVSDDAGHVAFMEYLFH-PHSRKHFPVFVEKLDTVSVREHDEQELAVFKAN----------------GDSIRYSIVSRCSDHLEMEKSTGILKTKS----SLDAEEYSECLVFIIATTYFDN--KPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGH----VIARDIDRSSR--VFYEIVGG-DANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRIGEP---VIQLSASDADEHSNHRFELDGGGEGIPFRVD-ENTGMVFVNDSLDFEKKQSYRIKVKLTDGA---WLIETSLFVNVKDVNDNAPIFEKP-----EYLFISEENSAE--IGQFHASDMDSENNGKIRYSVTS 2283          

HSP 2 Score: 81.2629 bits (199), Expect = 4.080e-15
Identity = 79/278 (28.42%), Postives = 129/278 (46.40%), Query Frame = 1
Query: 1141 IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGI-NHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-----TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGT 1956
            I +++ D ND+ P+  +    ++I E       V     TD D+G N          +  ++D+M  SP     Q   F    + G   DRE    YS+ +   D G P +SSS  + I I D NDNPP+F    ++ +++ +     ++  + A D DS+ N+++TY I+      E F I + N  +  N   + E   R EF VEA+D+G P L+ +  I + +   N++ P I+     + Y F IV+  +   K   I  +  SD  +G N T
Sbjct:  103 ILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTM--SPF-GIVQSDGFLFLEVTG-KLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF--GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQN---NTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSDGPLGANST 371          

HSP 3 Score: 72.0182 bits (175), Expect = 2.567e-12
Identity = 79/295 (26.78%), Postives = 131/295 (44.41%), Query Frame = 1
Query: 1489 ITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNII-TYSIIGDYEVKET---FGI-NHNGQIHLNKI--LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFT---YPLLNAHNYLNITDDMAAGSIVGEVKATDED--FGLNGSIIYNLTNQNHTKDLFSIQS 2337
            I I + D NDN P F  + +   I E A IG  + I  A D D   N  I  Y ++      +T   FGI   +G + L     LDRE +D Y   + A D G P L+ SC + I++LD+NDN P         +  +W     +  +  LNA+D D  +N    +R+       ++   ++  I+   N + E + + + +V+  D+G PP + T  + + +   N++ P      YP  + + ++ +  +   G  +  +  TD D   G N +I     N+     L S QS
Sbjct:  103 ILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIR---SLTLNWN-GLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQN-NTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYP--SDYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGNEQSIFSLISRQS 390          

HSP 4 Score: 70.0922 bits (170), Expect = 1.151e-11
Identity = 55/169 (32.54%), Postives = 85/169 (50.30%), Query Frame = 1
Query: 1360 GQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI 1848
            G   +F +NS  G     +  DRE++S + + +   D G P++S++  I I + D NDN P FE       ISE++KIG +I  ++A D D      + YS+  + E+   F IN   G I +   ++RE  + + F V+  D GE   +    + I V D NDN P I
Sbjct: 1694 GNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAE--LQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTD-GEK--SSKVIVEIHVEDFNDNHPMI 1857          

HSP 5 Score: 65.0846 bits (157), Expect = 3.590e-10
Identity = 80/292 (27.40%), Postives = 117/292 (40.07%), Query Frame = 1
Query:  118 LFGLMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTY----GRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENY--FELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTP---------QWVGLPYRKEISECTTEAKVLQLNAQDKD 942
            +F L   +F+ LF  +T   SE ++K   SV E+ K N+ IG                      LE+E   TY    G   I  D++  ++ V+S +DRE            A    II +   I  + I+++D+NDN P F  D + ++IPE         +  A D D  K G    Y    S +  +    F ++     +  +L V G LDRE    +   L A D G  +    C + + I D+NDN P          W GLP            K+  LNA D D
Sbjct:    9 IFLLNHLIFFHLFN-FTHQFSEETIKF--SVSEDAKLNTIIG---------------------HLEAEIGYTYRLSRGNSKIKFDEQTLELSVSSPLDRES---------ENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFL--FLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLNWNGLP----------NTKLFSLNATDLD 255          

HSP 6 Score: 62.3882 bits (150), Expect = 2.692e-9
Identity = 43/136 (31.62%), Postives = 67/136 (49.26%), Query Frame = 1
Query: 1474 SSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG---DYEVKETFGINH----NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSY 1860
            + + IIT+ +   N + P    +     + E+A IG   G + A+D DS  + +++Y I+    DY+     GI H    +G +   K  D E K  Y F  EAKD G P+   +C   I + DVNDN+P+  + Y
Sbjct:  614 TQTSIITLIVKPLNQHSPI--CQITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYD-----GIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRY 742          

HSP 7 Score: 61.2326 bits (147), Expect = 5.419e-9
Identity = 55/192 (28.65%), Postives = 90/192 (46.88%), Query Frame = 1
Query: 1693 NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS--YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDED 2262
            +G I  N  LD E    Y F + A  +       + ++ I V D ND  P   T    + K++E  +       IG   A D D GQNG   + + S +T +       G I+    +DRE+    ++L++  D G P  +AT+ + I V D+NDN P+F      +  ++ I+++   GS +  + ATD+D
Sbjct: 1604 DGTIFTNSPLDFENIKTYRFNITAGKS-------TSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFEL----SSYFIKISENSKIGSKIIRILATDKD 1784          

HSP 8 Score: 60.077 bits (144), Expect = 1.248e-8
Identity = 51/171 (29.82%), Postives = 75/171 (43.86%), Query Frame = 1
Query: 1135 TTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNN 1632
            + I L +K  N H P+ ++  + + + EN     +  RI   DED G++   S              Y    ++     IF L+S  G       FD EK   Y+ E    D GTP+ +++   TIFI D NDN P F + + T +IS   K    + IV A D+D    N
Sbjct:  617 SIITLIVKPLNQHSPICQI--TEIHVLENAPIGTIFGRIQARDEDSGLSGVVS--------------YKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATIS--GKSNETVAIVQANDNDVDVKN 769          

HSP 9 Score: 58.9214 bits (141), Expect = 2.512e-8
Identity = 89/347 (25.65%), Postives = 152/347 (43.80%), Query Frame = 1
Query: 1528 HFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTF-RFRVRSRSTPIDIQ-----VYNEGKIIY--FGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYP 2541
             F  E   FS+SEDAK+   IG + A+          TY +  G+ ++K         ++ ++  LDRE ++  +  +       P++     I I VLDVNDN P        + VE  E     + +    A+D D G+NGT  ++ +      +D       V ++G +     G +DRE  D   + +  ID G P  +++  ++I +LD+NDN P F          L +  +    + +  + ATD D   N  + Y +     T ++FSI  +  ++ +   +   +     VVEARD G P LS T  + +        +   +E ++N ++  P DYP
Sbjct:   26 QFSEETIKFSVSEDAKLNTIIGHLEAEIG-------YTYRLSRGNSKIKFD---EQTLELSVSSPLDRESENAIDMLIIT---SPPSI---IHILIDVLDVNDNSPIFPIDV--QRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF------GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNTECLQRC--EFVVEARDSGVPPLSTTLNIVVNM-----EYGNEHEPNINIRFY-PSDYP 340          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 182.185 bits (461), Expect = 7.583e-46
Identity = 185/720 (25.69%), Postives = 314/720 (43.61%), Query Frame = 1
Query:  352 SVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELID----HGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIG--GQIRFKISENSQNYEM--IVRIFYITESILYLNIGALKSFKENKASIVVIAADGEG---RSNETTIELEIKDCNDHRPVIKVH-----SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVR---SRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNP-PRTATTTVHIEVLDVNDNRPKF-----TYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPD-RLVVEARDQG 2421
            ++D   G++     +DRE +       +  +   Y I       E++I+++D+NDN P F      I   E+    +   L  A D D  + GV   Y     +   +N F L+      G+    +L   G+LDRE+  S++ ++ A DGG     G  ++ V I DVNDN P +    Y   ++E       V+ + A D D    +G   +I + ++E    + +     +   TE +       +KS    K+ +  + A   G   +   T + + + D NDH P+I             + EN  +  +V  + V D D G+N   S  +     VS + +    LE      I ++N +     DRE+  +Y++ V+  D GTP  +++  + I ++D ND+ P FE    +  +SE A  G  +  + A D D+  N  + Y I+   E+K        G I     LDRE++D  E ++ A+D G        ++++I+LD ND  P+ S     + V   E       +  + A+D D G NG+  F +     R  P+   +    G++     +DREK+ + ++ V   D G P P++AT TV + V DVNDN P+F      Y L +  + + +  ++    I+  V A+D+D G N  I Y L +          +S    +      +    P  +L+V ARD G
Sbjct:  104 TLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPI-------EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNV--DNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDND----LGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRI-----VSGNELGHFRLEEAADLHIVRVNGV----LDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQRE--QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAG 799          

HSP 2 Score: 152.14 bits (383), Expect = 1.391e-36
Identity = 174/660 (26.36%), Postives = 287/660 (43.48%), Query Frame = 1
Query:  493 IEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIV--EITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQ--------TIG-----------GQIRFKIS---ENSQNYEMIV----------RIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETT-IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-----GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPN-LNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQ-NGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD 2340
            I++ D NDN P F+    +  IPEN  R  +    VA+D D    G        + S    + F L    N     L +   LD E ++ +   + A D G       I V   + D+NDN P +  + Y  E+ E      +V+ ++A+D D           T G           G IR + +   E+   Y + V              + E+ L L   + + +++ +     +A   + R + T  + + IKD ND  PV  + ++   I EN     +V  +   D D+G N      + +      D   + PL         QL  +  L  DRE  S Y + +   D G P  S+   + I I DENDN P F+ +  + S++E+A IG  +  V A D D   N  I YSI+      D+ + E  G+     + + K L+ E   RY  TV A+D    N   D+ ++ I +LD+NDN P  + + Y  +++E+    +   Y+  +NA D D    N   R+ ++   + +     + G I     +DRE+  +  + +  +D G+PP T T  V +EV D+NDN P F     +A     + +++ +G+ V   +ATD+D GLN  + +NL  ++  +  F I S+
Sbjct: 1910 IQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDAD---LGQNAQLSYGVVSDWANDVFSL----NPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEF--LAHQKQQRLSSTVKVTILIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEAR--DEDMGQSDPLPFSLNPTDGQLRVVDAL--DRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGV-----VRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGG-YVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHA----TVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR--FHIDSE 2543          

HSP 3 Score: 141.739 bits (356), Expect = 2.323e-33
Identity = 170/692 (24.57%), Postives = 293/692 (42.34%), Query Frame = 1
Query:  346 LISVDQKKGDIWVTSAIDREEICQPI---------SKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR---IIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRP------VIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTF----------RFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDF-GLNGSIIYNLTNQNHTKDLFSI 2331
            L  ++   GDI +   +DRE+  +           S  LTG  +            +++E+ DINDN P F+       + EN+   +    P A D+D    G+      ++       +     H ++    +     LDRE    +   L A D    + +     + + ++DVNDN P++    Y   + E  ++ + V    A D DD +     + + IS   Q+Y  I     +  + L L     KS  +   +IV+ A D   +S  +  EL +      RP         + +S   + E+ +   ++T+++ T   +G+  +   ++     +  DS+   P  N G   + Q     GL  D E    Y + +   D  TP++ S  +IT+ ++D NDN P  E       + E+      I +V A D DS  N  + Y +  D++   TF I  +G+I+    LDRE    Y F VEA D G P++  +  + + +LD NDN P+ +  +S  + E+ E      ++ ++ +SD D+G N             +FR+  +S          G I   G++DRE+ D+  + V   D       A T + I + D NDN P+F +    + ++  +   +A   +VG++ ATD D  G N  I Y+L        +FSI
Sbjct: 2433 LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGI------------VRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDE---GLNAKLRFNLLGEHMHRF-----HIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGEN--AVVHYTISGRDQHYFDINTKTGVVSTKLELKTKT-KSHDDLTYTIVISAMDQGEQSLSSKAELTVI----LRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI--AGGIMGDSLRVDP--NSGLLSVGQ----DGL--DYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFD--GTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGS---FVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQS----------GNITVAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFY-SFSFPELQQSIA---LVGQIIATDRDKQGPNSVISYSL---QQPSPMFSI 3062          

HSP 4 Score: 140.584 bits (353), Expect = 4.575e-33
Identity = 176/739 (23.82%), Postives = 307/739 (41.54%), Query Frame = 1
Query:  352 SVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH------QIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDG-----GGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTE---AKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNG-TPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKI-LDREVKDR----YEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESW---EREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG--NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            S++   G + V  A+DRE         L  ++L  I   D          +L I I+D NDN P F P + +  + EN +  +      A D D    G     ++       +N+   I     +   +RV  +L+ E +  +   + A D       G+  +  + + I D+NDN P ++  PY   + E T       VL +NA D D P  +  Q+R+ + E   +   + RI   +  I  L     +   E   ++V +       +    + +E++D ND+ PV ++ S    ++EN  S   V     TD+D+G+N++   +L                  G     F ++S  G        DRE+ S Y + ++  D+  T   +SS  +TI +SD NDN P F++     ++ E    G  +    A D D   N ++ Y+I G    +  F IN    +   K+ L  + K      Y   + A D GE +L+   ++ +I+       PE+  ++++     +   E       I K++A+    G  G  R+ +        ++V     ++  G   +D E     ++ ++  D   P   + T + + V D NDN P     + NA     + ++ +   ++  VKA+D D G NG++IY L  QN     F I   G+I  + +LD +       VVEA DQG P ++ T ++ +      D
Sbjct: 2222 SLNPTDGQLRVVDALDRE---------LRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANG----RIRYSIVLGDQNHDFSISEDTGV---VRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAE--LTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTP-PLNSQVRYFLKEGDSD---LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL-----------------LGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISG--RDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-----RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAE----VLEEESPPQLIAVVKASDRDSGDNGNVIYRL--QNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKND 2908          

HSP 5 Score: 139.813 bits (351), Expect = 8.350e-33
Identity = 182/690 (26.38%), Postives = 283/690 (41.01%), Query Frame = 1
Query:  355 VDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFE---LQIEIIDINDNFPSFQPD---EKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVI---GDLDRENIKSFEFHLYASDGGGNQGKCRIIVE--ITDVNDNTPQWVGLPYRKEISECT-TEAKVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGE-GRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDRE---KASRYS-------------------VEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPN-LNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS--RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQ 2304
            +D + G I     +DREE        L  +  +    A    +    + I IID+NDN P F  D   E TI +PEN A   E  L   +DRD+   GV      S++++  + +         I P   V+     +  E        L A+D G      ++ +   I DVND+TP +    Y   + E T    +   L A D D    +G  G+I ++I E   N E +  +F   +  L++     +  ++  A  V     G+  RS+   + + + D ND+ P     + +  I EN  +   V ++T  D D G N+E S +L+     S    +T    NG  K +          FDRE   K SR +                   +E   +DNG P +     + + ++D NDN P F       +ISE A  G  I  V  +D+D   N  + YS+    E  +    +  GQ+ L + LDRE ++ +   V AKD    + L+ +  I I+VLD NDN PE + S S   V   E       + +  ASD D G N    F + +  R     I     G +     +D E +    + +   D G P  + T   ++ V+D NDN P F    +       I + +   + +  V A D D GLNG + Y ++ Q
Sbjct:  881 IDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDA---GVNSRISYSLTNNPNQQF--------RIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDID----LGDNGRISYEIIEG--NTERMFGVF--PDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLS-----SQTQDFTIDTRNGFIKTLRP--------FDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSE--VSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSIT-GSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAI----VRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQ 1531          

HSP 6 Score: 131.339 bits (329), Expect = 3.617e-30
Identity = 135/462 (29.22%), Postives = 211/462 (45.67%), Query Frame = 1
Query: 1129 NETTIELEIKDCNDHRPVIKVHSSS---LKIKENEK--SKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-LYFDR----EKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXX----------------------XXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARD 2415
             +  + + I D ND+ PV  +   S   + + EN     +I ++R  V D D G+NS  S SL +               N  Q+  F++  + G LY  R    E  S   VE++  D G+P +SS   +++ I+D ND+ P F+      S+ E  K+      + A D D   N  I+Y II +   +  FG+  +G + +   LDRE +D Y  TV  +D G+P+ +    + I V+D NDN P+ + S ++F I E+   +    ++GKL A DRDIG+N    F + S++    I   N G I      DRE + K+                           V DNG P       V + V DVNDN P+F    L A  ++ I++  + G+ +  V   D D GLNG + Y+L   N         + GQ+ L ++LD + +    L+V A+D
Sbjct:  924 GQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSR--VRDRDAGVNSRISYSLTN---------------NPNQQ--FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEII-EGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADT---FVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRN-GFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEF----LRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD 1357          

HSP 7 Score: 129.028 bits (323), Expect = 1.512e-29
Identity = 194/755 (25.70%), Postives = 317/755 (41.99%), Query Frame = 1
Query:  340 RHLISVDQKKGDIWVTSAIDREEICQ-----PISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYG-VXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG-------GNQGKCRIIVEITDVNDNTPQWVG-----LPYRKEISECTTEAKVLQLNAQDKDDPQ--------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG----ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKA-SRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSAT----TTLYIRYFKPR 2475
            R    +D   G +++   +D E+I         S C T +    +++         + ++D NDN P F       +I E +   +      A D DS   G V     K         +F +    N     +  + ++DRE+I +F   + A+D           +    +IVE  D+NDN P +V      LP +   S+ ++ A V+Q++A+D D             G Q  FK+  N+          +  E    L +     A++S + +    + I   G G S  +  + E +         K+  S   + ENE   I  + +TVT        E+      TN  +  S        G   ++F +++  G+       DRE     Y VEV     G    +S   + + + D+ND+PP F      +++SED +IGH I  + A D D+  +  +T+ ++  ++ K     +  G++ LN  LDRE K +YE  +   D  +          I V D NDN P    T YSF I E+ +R ++   +G++ A D D+GQN    + V S     D+   N   G +     +D E+V    ++V   DNG P  + T TV+  VLD+NDN P F     ++  + N+       + V  V A D D G NG I Y++T  +   + F I S+G I  ++ LD + ++   L V ARD      S +    T L ++Y  PR
Sbjct: 1429 RDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLY--------NVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGI----NTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVE--DINDNAPVFVSMNAAILPPKFSTSKGSSTA-VMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRS--------KLSGS---VYENEP--IGTSILTVTAHLASAEIEYFV----TNVTATGS-------RGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGS--VTFLLMDGHDGKFLLEPS-TGKLILNDTLDRETKSKYELRIRVSDGVQ---YTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQ---VGQIVARDADLGQNAQLSYGVVSDWAN-DVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENV----PIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSE-FGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPR 2129          

HSP 8 Score: 120.553 bits (301), Expect = 7.137e-27
Identity = 166/651 (25.50%), Postives = 271/651 (41.63%), Query Frame = 1
Query:  499 IIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYIT-------ESILYLNIGALKSFKEN--KASI--------VVIAADGEGR-SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL---NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTP-TMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQ-----VYNEGKIIY-FGNIDREXXXXXXXXXXXXXNGNPPRTATTT---VHIEVLDVNDNRPKFTYPLLNAHNY-LNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ 2334
            I D+ND+ P F        +PE    ++ F    A D D    G        I     E  F +   G     YL V   LDRE    +   +   D G         +++ + D NDN PQ+    +   I E    +  V +L A D+D    IG   ++ F +S  +Q++ +  R  +I        E+++ ++  A  S ++   + S+          ++ +G  R  ++  +++ + D ND+ P        + I E       +T +   D D+G+N +   SL   N+    +LDS         GQ  +       G   DRE    + + V+  D      +SS+  ITI + DENDN P F       S+ E +  G E+    A D+D   N+ + +SI      ++TF I+   G ++L+K LD E    Y   + A D G P+L+ +    ++V+D NDN P   ST+   +I E    +     I  + A D D G NG   + + S+  P   Q     +  E  +I+    IDRE +D   + V   D   P     +T   V + V D+NDN P F    +NA       +    + + V +V A D D   NG + Y +   +  ++LF +Q
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDID---LGDNGRISYEIIEGNTERMFGVFPDG-----YLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD----IGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSAT-------GQLSL-------GRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNR-RDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTP---IVTVTADDPDSGLNGKVSYAI-SKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVS--MNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV--SGPQELFKLQ 1654          

HSP 9 Score: 117.472 bits (293), Expect = 5.757e-26
Identity = 158/625 (25.28%), Postives = 257/625 (41.12%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSFQPDEKTIKIPEN-VARSSEFSLPV-AKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG---EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINS--EFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFK-----TFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG-----DYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLT 2298
            EL I I+DINDN P+F       ++ EN V  +  + L V A D D+         ++        + F +     +I     ++  LDRE    +   L A D G     G   + VE+ D+NDN P +    Y   + E   +   VL   A DKD  + +  ++RF +       E + R    +E+        L   + +   + ++A D    E R++   + + + D ND+ P     + ++ + E       V      D D G N+   ++ S  D ++  +++      + G      +L +    + D      Y++ +   D G  ++SS   +T+ +      PP     F       F++SED + G  I  V A          I Y+I G        V    G+   GQ      LD E+   YE  +EA D   P+L     I + V D NDN P +         E  E E     I  + ASDRD G NG   +R+++       ++   G+I     +DRE++     +V+ +D G P  T T +V + +LD NDN PKFT         LN+T++   GS V  V ++D D G N +  Y+ +
Sbjct: 2369 ELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPL---NSQVRYFLKEGDSDLFRINASSGDI----ALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKD--EGLNAKLRFNLLG-----EHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINT------KTGVVSTKLELKTKTKSHDDLT----YTIVISAMDQGEQSLSSKAELTVIL-----RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQ----DGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQL--IYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGT-FEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLF-----SLNVTENAEIGSFVIRVTSSDLDLGANANASYSFS 2952          

HSP 10 Score: 115.161 bits (287), Expect = 2.868e-25
Identity = 169/715 (23.64%), Postives = 302/715 (42.24%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISEC-TTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRII--VLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDI-GQNGTFRFRV----RSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGS-IIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPD-RLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNN 2577
            + I I+D ++N P F+  E    +P++  R        A D+  +  G  +     ++ ++  + F +  H    + ++ ++  +       +E  + A+D G      + R+++ +T  N +TP++    Y+  + E     + +L + A D D      G +R+ IS  ++  +  V     T  I+          +E   +I V        S+   + + + D ND+ PV         I EN+     V +    D+D   N+    +                L +G  +  F +N   G     + FD E+   Y++++    N   +M S   + + +   N+  P F      F +SE + +G  +G V A D DS  +  + Y ++G    K  F I+ N G I++ + LDRE ++R   TV AK+ G    ND+ + ++I  + D ND    I   Y+  I E+     K   +  + A D+D+  QN  F + +      +S  ID+Q    G+I     +DRE+    ++++  ID G PP+T + TVHIE+ DVNDN P FT   LN +    I+++  AG+ +  + A+D D   NG    Y L    H K   S+  +  ++       +   P    ++E  D G P   +   L I      D+   +    +     N  D P  V  ++  PN+
Sbjct: 3110 VNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDK--QDLGTNEMDYSLMTFNL-SSIFSVGRH----DGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPN--GMLRYSISGGNERQDFSVD--ERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAF---------------LPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK-NPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDK-GFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTK---VTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQT---GEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGY----ISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKH-KSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFN-GDLPSNVKLADVRPND 3784          

HSP 11 Score: 111.694 bits (278), Expect = 2.903e-24
Identity = 200/803 (24.91%), Postives = 333/803 (41.47%), Query Frame = 1
Query:  307 QLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQ---------IFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--------------------------------GNQGKCR------IIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEM-----IVRIFYITESILYLNIGALKSFKENKASIVV-IAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINS--EFSCSLNDTNF---VSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGT--PTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKI--GHEIGIVIAKDSDSSP-NNIITYSII-GDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRST---PIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNG-NPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRL----VVEARDQGTPSLSATTTLYIRYFKPRDSF 2484
            QL     + +   + S++ + G + +T+ +D EE+             +YI+    Q            +   ++D+NDN P F P   + ++ ENV  ++E     AKD DS   G+ +Y + +             + G + N  +R   +LDRE+  ++   + A D                                   +Q + R      + + I DVND  P ++       +        V+ + A D D+ +   G I + + E +++ +M     +      T+  L + + AL   +E ++S ++ I A   G   +S E+ + + I D ND+ PV      S  + EN     +V +++ TD D+G N    +S  L D N    +S D+      +N                 + E+ SRYS+ V   D     P   ++E +TI I D NDN P F        + E+     G  +  V A D+D+ P N+ + Y +  GD ++   F IN  +G I L K LDRE +  Y  T+ A D G P L  +  +R+ V D+NDN P          V        H    +  A+D+D G N   RF +         ID +    G+I     +DRE+     + +   D+    PR ++  + I V DVNDN PKF     N    + + + ++ G  V   +A D D G N  + Y ++ ++  +  F I +  G +  K +L TK K+ D L    V+ A DQG  SLS+   L +   +P + F
Sbjct: 1956 QLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEV------------QHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDS--------EFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRN--GYIDYLMKE-ARDEDMGQSDPLPFSLNPTDGQLRV-VDALD--RELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKN----------------LNYERLSRYSLTVRAEDCALENPAGDTAE-LTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDL---FRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPR--ATDKDEGLNAKLRFNLLGEHMHRFHIDSET---GEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYN----VAVPERISKGEFVFGARALDLDDGENAVVHYTISGRD--QHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELF 2700          

HSP 12 Score: 110.153 bits (274), Expect = 9.236e-24
Identity = 171/745 (22.95%), Postives = 308/745 (41.34%), Query Frame = 1
Query:  139 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQ------IEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSE-KYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTE-AKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEM--IVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRS---NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTD-EDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHF--YIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE--GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTK 2316
            +  QL +   V++ E   +L   V+ + + +   GN+I  +QN    T       F++                 + G+I+    +DREEI         G +   +   D  +  +       + ++D NDN P F     T     NV  ++E    V +   S+   G       S S +  E +      GN     + V G LDRE    +   + ASDG   + +  I + I D NDN P++    Y     E     A V Q+ A D+D  Q     I + + + S  + +       +  +++ + +   ++S  EN  ++ V+A D  G+    +E  + + I D +++ P  +       + ++      + R+   D +D G N E   SL   N   L S+++    +G    +  +   P         +RY + V   D G P  S    + I ++ EN + P F        + E+  +G  I  V A D D+ PN ++ YSI G  E ++ F ++   G I + + LD ++   Y   +  +D G   L+    + II+ DVNDN P     ++ K    +  E+K    ++ + +A+D+D  +N    +            + N+  G I    + D E   +I  L     N +    +   +++ VL VN+  P+F  P+     + ++++  A G+ VG V+ATD+D G +G + Y L   ++ K
Sbjct: 2809 VMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGT-------FEI----------------TESGEIYTRMRLDREEI---------GDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-----TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGN-----ITVAGHLDREQQDEYILKVVASDGAW-RAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDK-QGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRS-PENMYALTVLATD-NGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFN---LSSIFSVGRHDGWITLVKPIQVPPN--------TRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNE-RQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPP----VFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYE-ERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVF----HFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDK 3485          

HSP 13 Score: 108.997 bits (271), Expect = 1.910e-23
Identity = 159/657 (24.20%), Postives = 280/657 (42.62%), Query Frame = 1
Query:  487 LQIEIIDINDNFP----SFQPDE-KTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECT-TEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITE-SILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPT-MSSSEIITIFISDENDNPPHFETEFKTFSISEDA---KIGHEIGI------VIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHL--NKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV---LDVNDNIPEISTSYSFKIVESWEREH-----KHFYI-------GKLNAS-DRDIGQNGTFR-FRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRT------ATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN 2301
            + + ++D ND+ P     F PD  K   + EN    +  +    KD DS   G+       I S     +F L +   +++  +RV G LDRE I  +   + A D G         +I+++ DVND+ P +    Y   +SE   T + V  + A D+D    +  Q+ + I   ++     ++ F +   + L +  G L     +   + + A DG    +   T +++ I D ND  P       ++ + E+   + +V  +T TD DQG N   + +L      S++ +Y  PL+       F L+++ G        DREK S+Y + VI  D G PT  S++  + + ++D NDN P F      +S+++D    K+  E+        V A D D   N +I Y +    E    F ++  +G I L  +       K  Y+  V A+D G+        + I++   L++ +     +  Y F++VE  E++      +   I       GK N+  + DI Q    + FR+ +RS          G+I     +DRE+     + +    + +              V+I ++D+NDN P F      +   +++ ++ A G  +   +  D D G+N  I Y+LTN
Sbjct:  368 VTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDS---GLNGRTSVRIVSGNELGHFRL-EEAADLH-IVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDED--TGVNAQVHYDILSGNE-----LKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP----SVERLY--PLQ-------FALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE--GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRS----------GRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDR-ESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTN 986          

HSP 14 Score: 99.3673 bits (246), Expect = 1.624e-20
Identity = 173/775 (22.32%), Postives = 315/775 (40.65%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISK---------CLTGAFL-NYIIF----ADHQIFELQ------IEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ---GKCRIIVEITDVNDNTPQWVGLPYRKEISECT-TEAKVLQLNAQDKDDPQTIGGQIRFKISENSQ----NYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTI--ELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPT---MSSSEIITIFISDENDNPPHFETEFKT-----FSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVL----------------------DVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXN-GNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLF 2325
             S+ EN   ++ +G L  + ++  ++ E+    SF L S+  +       ++D + G I      DRE + + +S+          L G+   NY++     +D+ I  LQ      + + D+NDN P F      + I E  +  +  +    +D D    G+      S++       F L    ++    L +   LDRE+ +     + A D            I + + D NDN P++        + E + T  ++++  A D D  Q +  Q+ F IS  ++    + + I    Y+ + + Y +I    S+  N     + A+D    S  TT+   + + D ND+ P+    +   +IKE    K  +  +T  D D G+N + S ++         S     L  G   + F +N+  G+       DRE    + + V+  D   P+   +S+ +++T+ + D NDN P F +         FS S+ +     +  V AKD+DSS N ++TY I+     +E F +  N G I        + + RY+ T+++ D    +   S ++ I ++                       V +N P I TS    +          +++  + A+    G  G        R   ID ++   G +     +DRE   +   +       G  PRT+ T V + VLD ND+ P+F    L+     N+++D+  G  +  ++A D D    GS+ + L + +  K L 
Sbjct: 1160 FSIPENAPADTFVGKLTAVDRDIGRNAEL----SFTLSSQTQD------FTIDTRNGFIKTLRPFDREALVK-VSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADE---GLNGDVYYSLAKGNEAGQFNL----DSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDAD--QGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDI---TSYTLN-----ITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAI---------SKQEPQLPQG---RHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTA--VMQVHAKDADSSSNGLVTYEIVSG--PQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEP-IGTSI-LTVTAHLASAEIEYFVTNVTAT----GSRGQV-----DRLFDIDAKL---GILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQF----LDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLMDGHDGKFLL 1870          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 178.333 bits (451), Expect = 1.277e-44
Identity = 168/624 (26.92%), Postives = 287/624 (45.99%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV--RIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENG-GQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI----IGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +Q++++D NDN+P F     T+++PE+    +E +  VA  R ++   G       +I     ++ F +     +++    ++  LD E+++S+   + A DGG        +++V + D NDN P++    +++ + E       ++++ A D D  +    +I + ISE   N+ + V  R  ++        I  L   ++ + +  V+A DG    +S  +++ + ++D ND+ P          + E++     VT +T TD D+     +  +  +T        +    +NG G   I Q         D ++  R+ + V   D+G    S +  + I I+D N+  P FE    + S+ EDA +G  + +V A DSD   N  ITYS+    I      + F IN   G I  N  LDRE    Y  TV AKD G P+L+D+  + I V DVNDN P   S  Y   I+E          +G    ++ ASD D+G NG  ++ +  R       V +   G I     +DRE V    +    +D G+PP ++T  V I + DVND+ P F    +     L + ++   GS+VGE+ A D D G+N  + Y++
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVS----LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD--EGANAEITYSISERDDNFPLAVDPRTGWVQ------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTR-----GRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED-------ALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKIT----LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 2 Score: 174.481 bits (441), Expect = 1.963e-43
Identity = 211/797 (26.47%), Postives = 334/797 (41.91%), Query Frame = 1
Query:  184 FSVKLYL-SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-----YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR-----IIVEITDVNDNTPQWVGLPYRKEISE----CTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN---NIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRST-------PIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR 2460
            F   LY+ SV E Q    P G  +  ++ +      +      L   +S +    L  VD + G +  ++++DRE         L       ++  D           LQ+ ++D ND+ P+F+ ++    I E     S      A D+D  K     YG++     +  +   E     ID  + +   +     LDRE   S+   + A+D    Q + R     + V++ D NDN PQ+    Y  ++ E     T +  V  + A D D  Q     IR+ I   N+Q+   I  +      +  L+  +++S++     +V+ A DG    RSN T + + + D ND+ P          + EN      + R+   D D+G N+E  +S S  D NF     +   P   G  + I  L        DRE+  R++ +V+  D G P  S+S  + I + D NDN P F  ++   ++ ED   G  +  V A D D        I T +  G + +      N  G I + + LD + + R+  TV A D+G    +D+  + I + D N+  P    + YS  + E          +   +A+D D+G N    + +   S        P  I     G I+    +DRE      + V   D GNP  + TT V I V DVNDN P F  PL  A    +I +D   G+ V +V A+D D GLNG I Y L++++     F I  + G I   K LD +      L   A D+G+P LS+T  + IR
Sbjct:  359 FEQALYVASVLEEQ----PAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS----LFKVDSRTGVVTTSASLDRE---------LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV---ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYR-----LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF----PLAVDP-RTGWVQTIKPL--------DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQ---NGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVV---SATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIR 1102          

HSP 3 Score: 127.487 bits (319), Expect = 5.179e-29
Identity = 136/563 (24.16%), Postives = 229/563 (40.67%), Query Frame = 1
Query:  349 ISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK---YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNG----QIHLNKILDRE-VKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREH-KHFYIGKLNASDRDIGQNGTFRF 1965
            ++VD + G +     +DREE          G F   ++  D  +        + I + D+NDN P+F P      + E+    +  +   A D D +    Y +     +   +   +N   LI           +   LD +  K F   + A+D GG      + + ITD N+  P +   PY   + E       VL ++A D D    +  QI + ++E S N       F I      +   A    +     ++ + A   G    S+ T +E+ + D ND+ P  K       I E+      V ++  +D D G+N      L+D +           +E+G     F ++   G        DRE  + + +  I  D G+P +SS+  + I + D ND+PP F ++  T  + E++ +G  +G + A D D   N ++ YSIIG  +      +   G    Q+     LD E  + R+E  V A     P L +   I I+V DVNDN P +     F+++ +  R+H     IG++ A D D+     +R 
Sbjct:  737 LAVDPRTGWVQTIKPLDREE---------QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----------IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-----------IEDGS----FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 97.8265 bits (242), Expect = 4.916e-20
Identity = 104/344 (30.23%), Postives = 163/344 (47.38%), Query Frame = 1
Query: 1525 PHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHF--YIGKLNASDRDIGQNGTFRFRVRS----------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPP---RTATTTVHIEVLDVNDNRPKF---TYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDR 2490
            P+FE      S+ E+   G  +  V A+D + SP   + YS++   D   +  F ++   G +  +  LDRE+ D + F V A D+  P  + +  +++ VLD ND+ P    ++  +  E+  RE       +  L A+D+DIG+N    + + +          +  PI       G I    ++DRE  D   +LV   D  +     RTAT +V ++VLD NDN P+F   TY +    +    T+D    + V  ++ATD D G N +I Y +   N T+  FSI S  G + L K LD +     RLV+ A+D G+PS S TT L +      D+  R
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP----TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTED----NTVAHIRATDADQGNNAAIRYAIIGGN-TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 178.333 bits (451), Expect = 1.277e-44
Identity = 168/624 (26.92%), Postives = 287/624 (45.99%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV--RIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENG-GQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI----IGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +Q++++D NDN+P F     T+++PE+    +E +  VA  R ++   G       +I     ++ F +     +++    ++  LD E+++S+   + A DGG        +++V + D NDN P++    +++ + E       ++++ A D D  +    +I + ISE   N+ + V  R  ++        I  L   ++ + +  V+A DG    +S  +++ + ++D ND+ P          + E++     VT +T TD D+     +  +  +T        +    +NG G   I Q         D ++  R+ + V   D+G    S +  + I I+D N+  P FE    + S+ EDA +G  + +V A DSD   N  ITYS+    I      + F IN   G I  N  LDRE    Y  TV AKD G P+L+D+  + I V DVNDN P   S  Y   I+E          +G    ++ ASD D+G NG  ++ +  R       V +   G I     +DRE V    +    +D G+PP ++T  V I + DVND+ P F    +     L + ++   GS+VGE+ A D D G+N  + Y++
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVS----LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD--EGANAEITYSISERDDNFPLAVDPRTGWVQ------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTR-----GRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED-------ALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKIT----LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 2 Score: 174.481 bits (441), Expect = 1.963e-43
Identity = 211/797 (26.47%), Postives = 334/797 (41.91%), Query Frame = 1
Query:  184 FSVKLYL-SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-----YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR-----IIVEITDVNDNTPQWVGLPYRKEISE----CTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN---NIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRST-------PIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR 2460
            F   LY+ SV E Q    P G  +  ++ +      +      L   +S +    L  VD + G +  ++++DRE         L       ++  D           LQ+ ++D ND+ P+F+ ++    I E     S      A D+D  K     YG++     +  +   E     ID  + +   +     LDRE   S+   + A+D    Q + R     + V++ D NDN PQ+    Y  ++ E     T +  V  + A D D  Q     IR+ I   N+Q+   I  +      +  L+  +++S++     +V+ A DG    RSN T + + + D ND+ P          + EN      + R+   D D+G N+E  +S S  D NF     +   P   G  + I  L        DRE+  R++ +V+  D G P  S+S  + I + D NDN P F  ++   ++ ED   G  +  V A D D        I T +  G + +      N  G I + + LD + + R+  TV A D+G    +D+  + I + D N+  P    + YS  + E          +   +A+D D+G N    + +   S        P  I     G I+    +DRE      + V   D GNP  + TT V I V DVNDN P F  PL  A    +I +D   G+ V +V A+D D GLNG I Y L++++     F I  + G I   K LD +      L   A D+G+P LS+T  + IR
Sbjct:  359 FEQALYVASVLEEQ----PAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS----LFKVDSRTGVVTTSASLDRE---------LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV---ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYR-----LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF----PLAVDP-RTGWVQTIKPL--------DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQ---NGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVV---SATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIR 1102          

HSP 3 Score: 127.487 bits (319), Expect = 5.179e-29
Identity = 136/563 (24.16%), Postives = 229/563 (40.67%), Query Frame = 1
Query:  349 ISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK---YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNG----QIHLNKILDRE-VKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREH-KHFYIGKLNASDRDIGQNGTFRF 1965
            ++VD + G +     +DREE          G F   ++  D  +        + I + D+NDN P+F P      + E+    +  +   A D D +    Y +     +   +   +N   LI           +   LD +  K F   + A+D GG      + + ITD N+  P +   PY   + E       VL ++A D D    +  QI + ++E S N       F I      +   A    +     ++ + A   G    S+ T +E+ + D ND+ P  K       I E+      V ++  +D D G+N      L+D +           +E+G     F ++   G        DRE  + + +  I  D G+P +SS+  + I + D ND+PP F ++  T  + E++ +G  +G + A D D   N ++ YSIIG  +      +   G    Q+     LD E  + R+E  V A     P L +   I I+V DVNDN P +     F+++ +  R+H     IG++ A D D+     +R 
Sbjct:  737 LAVDPRTGWVQTIKPLDREE---------QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----------IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-----------IEDGS----FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 97.8265 bits (242), Expect = 4.916e-20
Identity = 104/344 (30.23%), Postives = 163/344 (47.38%), Query Frame = 1
Query: 1525 PHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHF--YIGKLNASDRDIGQNGTFRFRVRS----------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPP---RTATTTVHIEVLDVNDNRPKF---TYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDR 2490
            P+FE      S+ E+   G  +  V A+D + SP   + YS++   D   +  F ++   G +  +  LDRE+ D + F V A D+  P  + +  +++ VLD ND+ P    ++  +  E+  RE       +  L A+D+DIG+N    + + +          +  PI       G I    ++DRE  D   +LV   D  +     RTAT +V ++VLD NDN P+F   TY +    +    T+D    + V  ++ATD D G N +I Y +   N T+  FSI S  G + L K LD +     RLV+ A+D G+PS S TT L +      D+  R
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP----TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTED----NTVAHIRATDADQGNNAAIRYAIIGGN-TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 178.333 bits (451), Expect = 1.333e-44
Identity = 168/624 (26.92%), Postives = 287/624 (45.99%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV--RIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENG-GQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI----IGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +Q++++D NDN+P F     T+++PE+    +E +  VA  R ++   G       +I     ++ F +     +++    ++  LD E+++S+   + A DGG        +++V + D NDN P++    +++ + E       ++++ A D D  +    +I + ISE   N+ + V  R  ++        I  L   ++ + +  V+A DG    +S  +++ + ++D ND+ P          + E++     VT +T TD D+     +  +  +T        +    +NG G   I Q         D ++  R+ + V   D+G    S +  + I I+D N+  P FE    + S+ EDA +G  + +V A DSD   N  ITYS+    I      + F IN   G I  N  LDRE    Y  TV AKD G P+L+D+  + I V DVNDN P   S  Y   I+E          +G    ++ ASD D+G NG  ++ +  R       V +   G I     +DRE V    +    +D G+PP ++T  V I + DVND+ P F    +     L + ++   GS+VGE+ A D D G+N  + Y++
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVS----LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD--EGANAEITYSISERDDNFPLAVDPRTGWVQ------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTR-----GRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED-------ALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKIT----LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 2 Score: 174.096 bits (440), Expect = 2.194e-43
Identity = 211/797 (26.47%), Postives = 334/797 (41.91%), Query Frame = 1
Query:  184 FSVKLYL-SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-----YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR-----IIVEITDVNDNTPQWVGLPYRKEISE----CTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN---NIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRST-------PIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR 2460
            F   LY+ SV E Q    P G  +  ++ +      +      L   +S +    L  VD + G +  ++++DRE         L       ++  D           LQ+ ++D ND+ P+F+ ++    I E     S      A D+D  K     YG++     +  +   E     ID  + +   +     LDRE   S+   + A+D    Q + R     + V++ D NDN PQ+    Y  ++ E     T +  V  + A D D  Q     IR+ I   N+Q+   I  +      +  L+  +++S++     +V+ A DG    RSN T + + + D ND+ P          + EN      + R+   D D+G N+E  +S S  D NF     +   P   G  + I  L        DRE+  R++ +V+  D G P  S+S  + I + D NDN P F  ++   ++ ED   G  +  V A D D        I T +  G + +      N  G I + + LD + + R+  TV A D+G    +D+  + I + D N+  P    + YS  + E          +   +A+D D+G N    + +   S        P  I     G I+    +DRE      + V   D GNP  + TT V I V DVNDN P F  PL  A    +I +D   G+ V +V A+D D GLNG I Y L++++     F I  + G I   K LD +      L   A D+G+P LS+T  + IR
Sbjct:  359 FEQALYVASVLEEQ----PAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS----LFKVDSRTGVVTTSASLDRE---------LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV---ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYR-----LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF----PLAVDP-RTGWVQTIKPL--------DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQ---NGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVV---SATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIR 1102          

HSP 3 Score: 127.102 bits (318), Expect = 5.881e-29
Identity = 136/563 (24.16%), Postives = 229/563 (40.67%), Query Frame = 1
Query:  349 ISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK---YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNG----QIHLNKILDRE-VKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREH-KHFYIGKLNASDRDIGQNGTFRF 1965
            ++VD + G +     +DREE          G F   ++  D  +        + I + D+NDN P+F P      + E+    +  +   A D D +    Y +     +   +   +N   LI           +   LD +  K F   + A+D GG      + + ITD N+  P +   PY   + E       VL ++A D D    +  QI + ++E S N       F I      +   A    +     ++ + A   G    S+ T +E+ + D ND+ P  K       I E+      V ++  +D D G+N      L+D +           +E+G     F ++   G        DRE  + + +  I  D G+P +SS+  + I + D ND+PP F ++  T  + E++ +G  +G + A D D   N ++ YSIIG  +      +   G    Q+     LD E  + R+E  V A     P L +   I I+V DVNDN P +     F+++ +  R+H     IG++ A D D+     +R 
Sbjct:  737 LAVDPRTGWVQTIKPLDREE---------QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----------IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-----------IEDGS----FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 97.8265 bits (242), Expect = 5.172e-20
Identity = 104/344 (30.23%), Postives = 163/344 (47.38%), Query Frame = 1
Query: 1525 PHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHF--YIGKLNASDRDIGQNGTFRFRVRS----------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPP---RTATTTVHIEVLDVNDNRPKF---TYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDR 2490
            P+FE      S+ E+   G  +  V A+D + SP   + YS++   D   +  F ++   G +  +  LDRE+ D + F V A D+  P  + +  +++ VLD ND+ P    ++  +  E+  RE       +  L A+D+DIG+N    + + +          +  PI       G I    ++DRE  D   +LV   D  +     RTAT +V ++VLD NDN P+F   TY +    +    T+D    + V  ++ATD D G N +I Y +   N T+  FSI S  G + L K LD +     RLV+ A+D G+PS S TT L +      D+  R
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP----TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTED----NTVAHIRATDADQGNNAAIRYAIIGGN-TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 177.948 bits (450), Expect = 1.612e-44
Identity = 168/624 (26.92%), Postives = 287/624 (45.99%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV--RIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENG-GQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI----IGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +Q++++D NDN+P F     T+++PE+    +E +  VA  R ++   G       +I     ++ F +     +++    ++  LD E+++S+   + A DGG        +++V + D NDN P++    +++ + E       ++++ A D D  +    +I + ISE   N+ + V  R  ++        I  L   ++ + +  V+A DG    +S  +++ + ++D ND+ P          + E++     VT +T TD D+     +  +  +T        +    +NG G   I Q         D ++  R+ + V   D+G    S +  + I I+D N+  P FE    + S+ EDA +G  + +V A DSD   N  ITYS+    I      + F IN   G I  N  LDRE    Y  TV AKD G P+L+D+  + I V DVNDN P   S  Y   I+E          +G    ++ ASD D+G NG  ++ +  R       V +   G I     +DRE V    +    +D G+PP ++T  V I + DVND+ P F    +     L + ++   GS+VGE+ A D D G+N  + Y++
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVS----LVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD--EGANAEITYSISERDDNFPLAVDPRTGWVQ------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTR-----GRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED-------ALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKIT----LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 2 Score: 173.711 bits (439), Expect = 3.040e-43
Identity = 211/797 (26.47%), Postives = 334/797 (41.91%), Query Frame = 1
Query:  184 FSVKLYL-SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK-----YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR-----IIVEITDVNDNTPQWVGLPYRKEISE----CTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN---NIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRST-------PIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR 2460
            F   LY+ SV E Q    P G  +  ++ +      +      L   +S +    L  VD + G +  ++++DRE         L       ++  D           LQ+ ++D ND+ P+F+ ++    I E     S      A D+D  K     YG++     +  +   E     ID  + +   +     LDRE   S+   + A+D    Q + R     + V++ D NDN PQ+    Y  ++ E     T +  V  + A D D  Q     IR+ I   N+Q+   I  +      +  L+  +++S++     +V+ A DG    RSN T + + + D ND+ P          + EN      + R+   D D+G N+E  +S S  D NF     +   P   G  + I  L        DRE+  R++ +V+  D G P  S+S  + I + D NDN P F  ++   ++ ED   G  +  V A D D        I T +  G + +      N  G I + + LD + + R+  TV A D+G    +D+  + I + D N+  P    + YS  + E          +   +A+D D+G N    + +   S        P  I     G I+    +DRE      + V   D GNP  + TT V I V DVNDN P F  PL  A    +I +D   G+ V +V A+D D GLNG I Y L++++     F I  + G I   K LD +      L   A D+G+P LS+T  + IR
Sbjct:  359 FEQALYVASVLEEQ----PAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQS----LFKVDSRTGVVTTSASLDRE---------LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV---ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYR-----LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF----PLAVDP-RTGWVQTIKPL--------DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQ---NGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVV---SATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIR 1102          

HSP 3 Score: 126.716 bits (317), Expect = 7.094e-29
Identity = 136/563 (24.16%), Postives = 229/563 (40.67%), Query Frame = 1
Query:  349 ISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEK---YGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNG----QIHLNKILDRE-VKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREH-KHFYIGKLNASDRDIGQNGTFRF 1965
            ++VD + G +     +DREE          G F   ++  D  +        + I + D+NDN P+F P      + E+    +  +   A D D +    Y +     +   +   +N   LI           +   LD +  K F   + A+D GG      + + ITD N+  P +   PY   + E       VL ++A D D    +  QI + ++E S N       F I      +   A    +     ++ + A   G    S+ T +E+ + D ND+ P  K       I E+      V ++  +D D G+N      L+D +           +E+G     F ++   G        DRE  + + +  I  D G+P +SS+  + I + D ND+PP F ++  T  + E++ +G  +G + A D D   N ++ YSIIG  +      +   G    Q+     LD E  + R+E  V A     P L +   I I+V DVNDN P +     F+++ +  R+H     IG++ A D D+     +R 
Sbjct:  737 LAVDPRTGWVQTIKPLDREE---------QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLIT----------IAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-----------IEDGS----FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLR---DFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 97.4413 bits (241), Expect = 5.827e-20
Identity = 104/344 (30.23%), Postives = 163/344 (47.38%), Query Frame = 1
Query: 1525 PHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHF--YIGKLNASDRDIGQNGTFRFRVRS----------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPP---RTATTTVHIEVLDVNDNRPKF---TYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDR 2490
            P+FE      S+ E+   G  +  V A+D + SP   + YS++   D   +  F ++   G +  +  LDRE+ D + F V A D+  P  + +  +++ VLD ND+ P    ++  +  E+  RE       +  L A+D+DIG+N    + + +          +  PI       G I    ++DRE  D   +LV   D  +     RTAT +V ++VLD NDN P+F   TY +    +    T+D    + V  ++ATD D G N +I Y +   N T+  FSI S  G + L K LD +     RLV+ A+D G+PS S TT L +      D+  R
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP----TFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTED----NTVAHIRATDADQGNNAAIRYAIIGGN-TQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 267.7 bits (683), Expect = 3.662e-74
Identity = 236/768 (30.73%), Postives = 374/768 (48.70%), Query Frame = 1
Query:  241 GNLIKLIQNQTKSTEILKTKSFQLESEKSNTY----GRHLISVDQKKGDIWVTS-AIDREEI--CQPISK-CLTGAFLNYIIFADHQ---IFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKV-------HSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G L ++ + Q  ST I    + Q   +  + Y    G   + VD K GDI+ T   IDRE +  C+   K C     ++      +Q   + E +IE+ DINDN P F     T+ +PEN    + FS+P+A D+D+E+ GV  Y L +   ++     ++ +      P L V+G LDRE   S++  + A DGG         + V I D NDN P++    Y  E++E +     VLQ+ A D D    +G  G+I + + +       ++RI   +  I+Y+  G L   + N     V+A D     +S++T + +++ D ND+ P +++       HS  +  I E+      V  + V+D+D+G N+  +C +       L     S ++N  ++K F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN P F         +E+ + G ++  V+A D+DS  N  + YSII D   +  F I+ N G++     LDRE KDRYEF V A D G P+   +  + I VLD NDN P+   S YSF ++E+         +G +   D D G+N   +  V        IQ    G I+   + DREK       +  +D G+PPR++   V I VLD NDN P  T P  +  +++ ++   A  S+V  V+A D D G N  ++Y++   N   DLF I  S+G+I L K+L  K     RLV++  D+G PS  A   ++I
Sbjct:   24 GILYRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSD----LGPNGEIEYTLHQAIDPVPKLLRIDR-SSGIIYVK-GPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDN--KRKYFLQTTTP---LDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSP---VGMVTVQDMDEGENAQVQLSVEPDVGKFVIQ-NGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP--SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN-PHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHI 773          

HSP 2 Score: 88.1965 bits (217), Expect = 4.565e-17
Identity = 136/589 (23.09%), Postives = 231/589 (39.22%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFE------LQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL-------IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI----------GALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLND--TNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKT--FSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS 1851
            S E     NSPIG+   ++Q +   +++      +    ++      L+ +D+  G I+V   +DREEI              Y++  D           + I++ D NDN P+ +          +    I E++   +  +L    D+D  +  V    +           F+L       +D  N    +L+    LD E ++ +   + A D G         + V++TD NDN+P +    +  E +E      KV+++ A D D               +  N E++  I   + +     I            L    +++    V AAD    S+  T  + IK  D ND+ P   +   S  + EN      V  +TV D D+G N++   S+      FV         ++NG    +  ++      FDREK S Y+  +   D G P  SS   +TI + DENDN P       +    +S  A     + +V A+D DS  N  + YSI G       +    NG+I L K L R+    +   ++  D G+P+ +    I ++ + VN+ I  +S
Sbjct:  247 SYEAEVAENSPIGH--SVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINN---------LKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP------FQLRPASDSSVD--NKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDAD---------------SGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFV---------IQNGTGTILSSIS------FDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRH---AIALVHIYVNETIANVS 783          

HSP 3 Score: 62.003 bits (149), Expect = 4.412e-9
Identity = 92/405 (22.72%), Postives = 169/405 (41.73%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVI--KVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHE----IGIVIAKDSD----SSPNNIITYSIIG 1656
            L++++ D NDN P F P    ++  E      +    VA D DS      +     I+ S     FE+  +   +    R    LDRE+   +EF + A+D G   ++G   +++++ D NDN P+++   Y   + E     + V  +  QD D+ +    Q++  +  +   + +      I  SI      +    KE+  +  + A DG    RS+   + + + D ND+ PV+    +SS +++        +V  +   D D G N+E   S+   N    D  Y SP  NG      +L         R+ +  + + +  +D G P+  +  ++ I++++   N  H E           A +GH     + + IA D D    +  +NI+  S+ G
Sbjct:  455 LKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNA--ELVYSIIADSSTRGLFEIDPNSGEV----RARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGEN--AQVQLSVEPDVGKFVIQNGTGTILSSI------SFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN--PHDLFYISP-SNGEITLTKELT--------RKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSHVE-----------ALVGHSLYTPLDMDIAGDPDYGLAAQRSNIVYGSLAG 823          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 267.7 bits (683), Expect = 2.185e-73
Identity = 236/771 (30.61%), Postives = 374/771 (48.51%), Query Frame = 1
Query:  241 GNLIKLIQNQTKSTEILKTKSFQLESEKSNTY----GRHLISVDQKKGDIWVTS-AIDREEI--CQPISKCLTGAFLNYIIFA-------DHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKV-------HSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G L ++ + Q  ST I    + Q   +  + Y    G   + VD K GDI+ T   IDRE +  C+   K     FL + +           ++ E +IE+ DINDN P F     T+ +PEN    + FS+P+A D+D+E+ GV  Y L +   ++     ++ +      P L V+G LDRE   S++  + A DGG         + V I D NDN P++    Y  E++E +     VLQ+ A D D    +G  G+I + + +       ++RI   +  I+Y+  G L   + N     V+A D     +S++T + +++ D ND+ P +++       HS  +  I E+      V  + V+D+D+G N+  +C +       L     S ++N  ++K F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN P F         +E+ + G ++  V+A D+DS  N  + YSII D   +  F I+ N G++     LDRE KDRYEF V A D G P+   +  + I VLD NDN P+   S YSF ++E+         +G +   D D G+N   +  V        IQ    G I+   + DREK       +  +D G+PPR++   V I VLD NDN P  T P  +  +++ ++   A  S+V  V+A D D G N  ++Y++   N   DLF I  S+G+I L K+L  K     RLV++  D+G PS  A   ++I
Sbjct:   24 GILYRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKP---CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSD----LGPNGEIEYTLHQAIDPVPKLLRIDR-SSGIIYVK-GPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDN--KRKYFLQTTTP---LDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSP---VGMVTVQDMDEGENAQVQLSVEPDVGKFVIQ-NGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP--SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN-PHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHI 773          

HSP 2 Score: 88.1965 bits (217), Expect = 5.032e-17
Identity = 136/589 (23.09%), Postives = 231/589 (39.22%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFE------LQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL-------IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI----------GALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLND--TNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKT--FSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS 1851
            S E     NSPIG+   ++Q +   +++      +    ++      L+ +D+  G I+V   +DREEI              Y++  D           + I++ D NDN P+ +          +    I E++   +  +L    D+D  +  V    +           F+L       +D  N    +L+    LD E ++ +   + A D G         + V++TD NDN+P +    +  E +E      KV+++ A D D               +  N E++  I   + +     I            L    +++    V AAD    S+  T  + IK  D ND+ P   +   S  + EN      V  +TV D D+G N++   S+      FV         ++NG    +  ++      FDREK S Y+  +   D G P  SS   +TI + DENDN P       +    +S  A     + +V A+D DS  N  + YSI G       +    NG+I L K L R+    +   ++  D G+P+ +    I ++ + VN+ I  +S
Sbjct:  247 SYEAEVAENSPIGH--SVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINN---------LKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP------FQLRPASDSSVD--NKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDAD---------------SGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFV---------IQNGTGTILSSIS------FDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRH---AIALVHIYVNETIANVS 783          

HSP 3 Score: 60.8474 bits (146), Expect = 9.022e-9
Identity = 92/405 (22.72%), Postives = 169/405 (41.73%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSS--LKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHE----IGIVIAKDSD----SSPNNIITYSIIG 1656
            L++++ D NDN P F P    ++  E      +    VA D DS      +     I+ S     FE+  +   +    R    LDRE+   +EF + A+D G   ++G   +++++ D NDN P+++   Y   + E     + V  +  QD D+ +    Q++  +  +   + +      I  SI      +    KE+  +  + A DG    RS+   + + + D ND+ PV+   S+S  +++        +V  +   D D G N+E   S+   N    D  Y SP  NG      +L         R+ +  + + +  +D G P+  +  ++ I++++   N  H E           A +GH     + + IA D D    +  +NI+  S+ G
Sbjct:  455 LKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNA--ELVYSIIADSSTRGLFEIDPNSGEV----RARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGEN--AQVQLSVEPDVGKFVIQNGTGTILSSI------SFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN--PHDLFYISP-SNGEITLTKELT--------RKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSHVE-----------ALVGHSLYTPLDMDIAGDPDYGLAAQRSNIVYGSLAG 823          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 254.603 bits (649), Expect = 1.610e-69
Identity = 233/805 (28.94%), Postives = 372/805 (46.21%), Query Frame = 1
Query:  133 FKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ------PISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVR------IFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--------LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQ--VYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            + M   +  L     +  +  LY  V E Q PN+ IG+L         S + L       + E    Y R    VD K GDI+ T ++IDRE +  C+      P       +  + +     ++ E +IEI+D NDN P F     T+ IPEN    + F++PVA DRDS   G+  Y L +   +      ++    +   P L V+G+LDRE   S++ ++   DGG    Q    + + ITD NDN P++    Y  E+ E +     VLQ+ A D D      G++ + + + S     ++       I ++  S+    I  LK + + K +        + +S++  + + +KD ND+ P I++    L   E+  + I         V  + V+D D+G N+  +C +       L S   S   N  ++K F   +      D E+   Y +E++  D+G P +SS+  + + ++D NDN P F          E+ + G ++  V+A D+DS  N  +TYSI G    +  F IN N G++ +   LDRE  D Y+F V A D G P+L  +  + + VLD NDN P+ +   YSF + E+         +G +  +D D G+N   +  V   +    IQ   Y     I F   DREK       +  +D G+PPR++   + I VLD NDN P  T P  +++ +L+     +  + V  V+A D D GLN  + +N+   N    LF I S+G+I L K+   K     RLVV+ +D+GTP    T  ++I
Sbjct:   34 YAMLVWILLLLCCSANVVNTILY-QVTEEQPPNTLIGSL--------ASDQGLPDTGHLYKLEVGAPYLR----VDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDN------GPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRS--ASETGNDRKRKYFLQTTT---LLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSP---VGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISF---DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLD--PRTSPETHVESVEAEDIDIGLNSELDFNIVGGN-PHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHI 803          

HSP 2 Score: 140.969 bits (354), Expect = 2.611e-33
Identity = 137/469 (29.21%), Postives = 213/469 (45.42%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINS----EFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQN--------GTFRFRVRSRSTPIDIQVYNEGKIIYFGN----IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            +EI D ND+ P       +L I EN     L      TD D G N       +     TN  SL     S       +K+ QL  +  L  DRE    Y + +   D G+P   SS ++ I I+D NDN P FE       + E++ +GH +  V A DSD  PN  +TYS+      V     I+ N G I +   +DRE     +F V+AKDNG  + +    + I V D NDN P I        ++   +    E       +  +  SDRD G+N        G   F++RS S     +  N+ K  YF      +D E++ +  + +  +D+GNP  ++T ++ ++V D+NDN P F+  L     +    ++   G  V +V ATD D G N  + Y++T  +  + LF I  + G++ +  +LD +  +  + +V A D+G PSL  T T+ ++     D
Sbjct:  150 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDS------DEKLPQLIVLGNL--DRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSAS-----ETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFF----EENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRND 601          

HSP 3 Score: 135.191 bits (339), Expect = 1.350e-31
Identity = 148/570 (25.96%), Postives = 241/570 (42.28%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKI-LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEV 2136
            L+I I D NDN P F+      ++PEN           A D D    G   Y L   SS +       ID    I   + V G +DRE I   +F++ A D G      + +V IT  D NDN P    + +GL   ++    ISE       V  +   D+D+ +       + G + F++   S+      R +++  + L       +  KE +  IV + +     S+  ++++++ D ND+ PV       ++  E  +    V  +  TD D G N+E + S+   + V       +P  N G+ ++           DRE+   Y   V   D G P++  +  + + + D NDN P F     +FS+ E+      +G+V   D D   N  +  S+  D      F I +     L+ I  DRE +  Y F ++A D G+P  +    I I VLD NDN P ++   + S+K ++   R     ++  + A D DIG N    F +   +     ++ +EG+I        + +    ++V V D G PPR  T  VHI V
Sbjct:  260 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMR--LLSIDRNTGI---IFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLL----DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINP--NTGEVRVMS-------QLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDP--RTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 805          

HSP 4 Score: 95.5153 bits (236), Expect = 2.571e-19
Identity = 137/567 (24.16%), Postives = 228/567 (40.21%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLN--------IGALKSFKENKASIVVIAADGEGRS--NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGI--VIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI 1848
            NSP+G+   ++Q +   +++           + ++    L+S+D+  G I+V  ++DREEI   I K    A  N       +   + I + D NDN PS +         ++    I E++   +  +L    DRD  +  V    +         +  E    GN+     +L+    LD E IK +   + A D G         + V++TD+NDN P +    Y  E  E      KVL + A D D       ++ + I+  S           + E +  +N        +  L   + +    +V AAD    S     T+ +++ D ND+ P   ++  S  ++EN      V  +TV D D+G N+    S+   N  F+  +  YT                +  + FDREK S YS  +   D G P  SS   ITI + DENDN P+      +     D +   E  +  V A+D D   N+ + ++I+G       F I+  G+I L K    +    +   V+ KD G P    +  + I V +   N+  +
Sbjct:  286 NSPVGH--SVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS--ILKFYVQAKDNGPQSKSSKAL-VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASET---GNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGS-----------VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTI---------------LSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG-NPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHV 815          

HSP 5 Score: 71.633 bits (174), Expect = 4.502e-12
Identity = 102/416 (24.52%), Postives = 178/416 (42.79%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP---YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVR--IFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRP-VIKVHSSSLKIKENEKS-KILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRY----SVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHE----IGIVIAKDSDSS--PNNIITYSIIGDYEV 1668
            L++++ D+NDN P F P    ++  E      +    VA D DS      +        S+ E  FE       INP    +RV+  LDRE +  ++F + A+D G    +G   ++V++ D NDN P+++   Y   + E     + V  +   D D+    G   R ++S    N + +++   + I  +I      +    KE+  S  + A DG    RS+   I + + D ND+ P V K  +SS K  +   S +  V  +   D D G+NSE      D N V            G    +F+++S   +   +E   ++     + V   D GTP   ++ ++ I++++   N  H E             +GH     + + IA D D S  P++ I ++++G + V
Sbjct:  486 LKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNA--ELTYSITGGSVPEGLFE-------INPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDE----GENARVQLSVEPDNGKFMIQNGTYTILSTI------SFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSEL-----DFNIVG-----------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVE-----------GLVGHSLYTPLEMDIAGDPDYSRDPHSNILFAVLGGFSV 855          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 253.447 bits (646), Expect = 2.793e-69
Identity = 232/803 (28.89%), Postives = 370/803 (46.08%), Query Frame = 1
Query:  139 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ------PISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVR------IFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--------LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQ--VYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            + W L  L     +     +   V E Q PN+ IG+L         S + L       + E    Y R    VD K GDI+ T ++IDRE +  C+      P       +  + +     ++ E +IEI+D NDN P F     T+ IPEN    + F++PVA DRDS   G+  Y L +   +      ++    +   P L V+G+LDRE   S++ ++   DGG    Q    + + ITD NDN P++    Y  E+ E +     VLQ+ A D D      G++ + + + S     ++       I ++  S+    I  LK + + K +        + +S++  + + +KD ND+ P I++    L   E+  + I         V  + V+D D+G N+  +C +       L S   S   N  ++K F   +      D E+   Y +E++  D+G P +SS+  + + ++D NDN P F          E+ + G ++  V+A D+DS  N  +TYSI G    +  F IN N G++ +   LDRE  D Y+F V A D G P+L  +  + + VLD NDN P+ +   YSF + E+         +G +  +D D G+N   +  V   +    IQ   Y     I F   DREK       +  +D G+PPR++   + I VLD NDN P  T P  +++ +L+     +  + V  V+A D D GLN  + +N+   N    LF I S+G+I L K+   K     RLVV+ +D+GTP    T  ++I
Sbjct:   16 LVWILLLL--CCSANVVNTILYQVTEEQPPNTLIGSL--------ASDQGLPDTGHLYKLEVGAPYLR----VDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDN------GPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRS--ASETGNDRKRKYFLQTTT---LLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSP---VGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISF---DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLD--PRTSPETHVESVEAEDIDIGLNSELDFNIVGGN-PHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHI 782          

HSP 2 Score: 140.584 bits (353), Expect = 2.605e-33
Identity = 137/469 (29.21%), Postives = 213/469 (45.42%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINS----EFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQN--------GTFRFRVRSRSTPIDIQVYNEGKIIYFGN----IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            +EI D ND+ P       +L I EN     L      TD D G N       +     TN  SL     S       +K+ QL  +  L  DRE    Y + +   D G+P   SS ++ I I+D NDN P FE       + E++ +GH +  V A DSD  PN  +TYS+      V     I+ N G I +   +DRE     +F V+AKDNG  + +    + I V D NDN P I        ++   +    E       +  +  SDRD G+N        G   F++RS S     +  N+ K  YF      +D E++ +  + +  +D+GNP  ++T ++ ++V D+NDN P F+  L     +    ++   G  V +V ATD D G N  + Y++T  +  + LF I  + G++ +  +LD +  +  + +V A D+G PSL  T T+ ++     D
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDS------DEKLPQLIVLGNL--DRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSAS-----ETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFF----EENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRND 580          

HSP 3 Score: 134.806 bits (338), Expect = 1.812e-31
Identity = 148/570 (25.96%), Postives = 241/570 (42.28%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKI-LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEV 2136
            L+I I D NDN P F+      ++PEN           A D D    G   Y L   SS +       ID    I   + V G +DRE I   +F++ A D G      + +V IT  D NDN P    + +GL   ++    ISE       V  +   D+D+ +       + G + F++   S+      R +++  + L       +  KE +  IV + +     S+  ++++++ D ND+ PV       ++  E  +    V  +  TD D G N+E + S+   + V       +P  N G+ ++           DRE+   Y   V   D G P++  +  + + + D NDN P F     +FS+ E+      +G+V   D D   N  +  S+  D      F I +     L+ I  DRE +  Y F ++A D G+P  +    I I VLD NDN P ++   + S+K ++   R     ++  + A D DIG N    F +   +     ++ +EG+I        + +    ++V V D G PPR  T  VHI V
Sbjct:  239 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMR--LLSIDRNTGI---IFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLL----DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINP--NTGEVRVMS-------QLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDP--RTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 784          

HSP 4 Score: 95.1301 bits (235), Expect = 3.353e-19
Identity = 137/567 (24.16%), Postives = 228/567 (40.21%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLN--------IGALKSFKENKASIVVIAADGEGRS--NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGI--VIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI 1848
            NSP+G+   ++Q +   +++           + ++    L+S+D+  G I+V  ++DREEI   I K    A  N       +   + I + D NDN PS +         ++    I E++   +  +L    DRD  +  V    +         +  E    GN+     +L+    LD E IK +   + A D G         + V++TD+NDN P +    Y  E  E      KVL + A D D       ++ + I+  S           + E +  +N        +  L   + +    +V AAD    S     T+ +++ D ND+ P   ++  S  ++EN      V  +TV D D+G N+    S+   N  F+  +  YT                +  + FDREK S YS  +   D G P  SS   ITI + DENDN P+      +     D +   E  +  V A+D D   N+ + ++I+G       F I+  G+I L K    +    +   V+ KD G P    +  + I V +   N+  +
Sbjct:  265 NSPVGH--SVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS--ILKFYVQAKDNGPQSKSSKAL-VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASET---GNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGS-----------VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTI---------------LSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG-NPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHV 794          

HSP 5 Score: 71.2478 bits (173), Expect = 6.668e-12
Identity = 102/416 (24.52%), Postives = 178/416 (42.79%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP---YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVR--IFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRP-VIKVHSSSLKIKENEKS-KILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRY----SVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHE----IGIVIAKDSDSS--PNNIITYSIIGDYEV 1668
            L++++ D+NDN P F P    ++  E      +    VA D DS      +        S+ E  FE       INP    +RV+  LDRE +  ++F + A+D G    +G   ++V++ D NDN P+++   Y   + E     + V  +   D D+    G   R ++S    N + +++   + I  +I      +    KE+  S  + A DG    RS+   I + + D ND+ P V K  +SS K  +   S +  V  +   D D G+NSE      D N V            G    +F+++S   +   +E   ++     + V   D GTP   ++ ++ I++++   N  H E             +GH     + + IA D D S  P++ I ++++G + V
Sbjct:  465 LKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNA--ELTYSITGGSVPEGLFE-------INPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDE----GENARVQLSVEPDNGKFMIQNGTYTILSTI------SFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSEL-----DFNIVG-----------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVE-----------GLVGHSLYTPLEMDIAGDPDYSRDPHSNILFAVLGGFSV 834          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 253.062 bits (645), Expect = 4.717e-69
Identity = 232/803 (28.89%), Postives = 370/803 (46.08%), Query Frame = 1
Query:  139 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ------PISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVR------IFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--------LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQ--VYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            + W L  L     +     +   V E Q PN+ IG+L         S + L       + E    Y R    VD K GDI+ T ++IDRE +  C+      P       +  + +     ++ E +IEI+D NDN P F     T+ IPEN    + F++PVA DRDS   G+  Y L +   +      ++    +   P L V+G+LDRE   S++ ++   DGG    Q    + + ITD NDN P++    Y  E+ E +     VLQ+ A D D      G++ + + + S     ++       I ++  S+    I  LK + + K +        + +S++  + + +KD ND+ P I++    L   E+  + I         V  + V+D D+G N+  +C +       L S   S   N  ++K F   +      D E+   Y +E++  D+G P +SS+  + + ++D NDN P F          E+ + G ++  V+A D+DS  N  +TYSI G    +  F IN N G++ +   LDRE  D Y+F V A D G P+L  +  + + VLD NDN P+ +   YSF + E+         +G +  +D D G+N   +  V   +    IQ   Y     I F   DREK       +  +D G+PPR++   + I VLD NDN P  T P  +++ +L+     +  + V  V+A D D GLN  + +N+   N    LF I S+G+I L K+   K     RLVV+ +D+GTP    T  ++I
Sbjct:   29 LVWILLLL--CCSANVVNTILYQVTEEQPPNTLIGSL--------ASDQGLPDTGHLYKLEVGAPYLR----VDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDN------GPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRS--ASETGNDRKRKYFLQTTT---LLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSP---VGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISF---DREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLD--PRTSPETHVESVEAEDIDIGLNSELDFNIVGGN-PHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHI 795          

HSP 2 Score: 140.969 bits (354), Expect = 2.609e-33
Identity = 134/465 (28.82%), Postives = 215/465 (46.24%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQN--------GTFRFRVRSRSTPIDIQVYNEGKIIYFGN----IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            +EI D ND+ P       +L I EN     L      TD D G N     +L  T      ++++  +     +K+ QL  +  L  DRE    Y + +   D G+P   SS ++ I I+D NDN P FE       + E++ +GH +  V A DSD  PN  +TYS+      V     I+ N G I +   +DRE     +F V+AKDNG  + +    + I V D NDN P I        ++   +    E       +  +  SDRD G+N        G   F++RS S     +  N+ K  YF      +D E++ +  + +  +D+GNP  ++T ++ ++V D+NDN P F+  L     +    ++   G  V +V ATD D G N  + Y++T  +  + LF I  + G++ +  +LD +  +  + +V A D+G PSL  T T+ ++     D
Sbjct:  142 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYAL--TTGPEATNLFSLQVAQDSDEKLPQLIVLGNL--DRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSAS-----ETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFF----EENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRND 593          

HSP 3 Score: 134.806 bits (338), Expect = 1.820e-31
Identity = 148/570 (25.96%), Postives = 241/570 (42.28%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKI-LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEV 2136
            L+I I D NDN P F+      ++PEN           A D D    G   Y L   SS +       ID    I   + V G +DRE I   +F++ A D G      + +V IT  D NDN P    + +GL   ++    ISE       V  +   D+D+ +       + G + F++   S+      R +++  + L       +  KE +  IV + +     S+  ++++++ D ND+ PV       ++  E  +    V  +  TD D G N+E + S+   + V       +P  N G+ ++           DRE+   Y   V   D G P++  +  + + + D NDN P F     +FS+ E+      +G+V   D D   N  +  S+  D      F I +     L+ I  DRE +  Y F ++A D G+P  +    I I VLD NDN P ++   + S+K ++   R     ++  + A D DIG N    F +   +     ++ +EG+I        + +    ++V V D G PPR  T  VHI V
Sbjct:  252 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMR--LLSIDRNTGI---IFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLL----DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINP--NTGEVRVMS-------QLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD---NGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDP--RTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 797          

HSP 4 Score: 94.7449 bits (234), Expect = 3.658e-19
Identity = 137/567 (24.16%), Postives = 228/567 (40.21%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLN--------IGALKSFKENKASIVVIAADGEGRS--NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGI--VIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI 1848
            NSP+G+   ++Q +   +++           + ++    L+S+D+  G I+V  ++DREEI   I K    A  N       +   + I + D NDN PS +         ++    I E++   +  +L    DRD  +  V    +         +  E    GN+     +L+    LD E IK +   + A D G         + V++TD+NDN P +    Y  E  E      KVL + A D D       ++ + I+  S           + E +  +N        +  L   + +    +V AAD    S     T+ +++ D ND+ P   ++  S  ++EN      V  +TV D D+G N+    S+   N  F+  +  YT                +  + FDREK S YS  +   D G P  SS   ITI + DENDN P+      +     D +   E  +  V A+D D   N+ + ++I+G       F I+  G+I L K    +    +   V+ KD G P    +  + I V +   N+  +
Sbjct:  278 NSPVGH--SVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS--ILKFYVQAKDNGPQSKSSKAL-VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASET---GNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGS-----------VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTI---------------LSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGG-NPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHV 807          

HSP 5 Score: 71.633 bits (174), Expect = 5.531e-12
Identity = 102/416 (24.52%), Postives = 178/416 (42.79%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP---YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVR--IFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRP-VIKVHSSSLKIKENEKS-KILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRY----SVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHE----IGIVIAKDSDSS--PNNIITYSIIGDYEV 1668
            L++++ D+NDN P F P    ++  E      +    VA D DS      +        S+ E  FE       INP    +RV+  LDRE +  ++F + A+D G    +G   ++V++ D NDN P+++   Y   + E     + V  +   D D+    G   R ++S    N + +++   + I  +I      +    KE+  S  + A DG    RS+   I + + D ND+ P V K  +SS K  +   S +  V  +   D D G+NSE      D N V            G    +F+++S   +   +E   ++     + V   D GTP   ++ ++ I++++   N  H E             +GH     + + IA D D S  P++ I ++++G + V
Sbjct:  478 LKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNA--ELTYSITGGSVPEGLFE-------INPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDE----GENARVQLSVEPDNGKFMIQNGTYTILSTI------SFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSEL-----DFNIVG-----------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVE-----------GLVGHSLYTPLEMDIAGDPDYSRDPHSNILFAVLGGFSV 847          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 275.789 bits (704), Expect = 1.362e-76
Identity = 242/800 (30.25%), Postives = 378/800 (47.25%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTGAFLNY------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLY 2454
            F  LFF   ++ S  S K+   V E Q PN  IG+L         S  +     ++LE       G   + VD K GDI+ T ++IDRE +  CQ   P  KC    FL +      ++    ++ + QIEI+DINDN P+F     T+ IPEN      F +P A DRDS   GV  Y L     +      ++ +  +   P L V+G LDRE   S++  +   DGG         + + I D NDN P++  + Y  E+ E +     VLQ+ A D D  Q +  +I +   + S   + + R+ ++  S   + + G +           V+A D     ++  T + + I+D ND++PVI++    L         I E+   +  V  + V+D D+G+N+  +C +     V       S   +  +KK F L +   L  D E    Y++E++  D+G P +SS+  + + ++D NDN P F          E+  I   +  V A D+DS PN+ + YSI+ D   +  F IN + GQI +N +LDRE ++ Y+F V A D G P+L  +  + I VLD NDN P+ +   Y+F ++E+  R      +G +   D D G+N      V   S    IQ    G I+   + DRE        +  +D G+PPR++   V I VLD NDN P    P   ++ YL  T     G+ V  V+A D D G+N  + Y++ + N   +LF I  ++G++ L+K +  K     RLVV+  D+G PS   T  ++
Sbjct:   53 FLWLFFQLPILGS--STKVAYRVPEEQPPNILIGSLAS-DYGYPDSKHL-----YKLE------LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKC----FLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS---DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV--AGDVPFQLKQVSDTGSDSKKKYF-LQTTTAL--DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSP---VGMVTVIDADKGENAHIHLSVEPESGEFVIQ-NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYL--TPQTHPGTPVNWVRAEDMDTGINAELDYSIASGN-PFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          

HSP 2 Score: 124.02 bits (310), Expect = 6.078e-28
Identity = 132/455 (29.01%), Postives = 202/455 (44.40%), Query Frame = 1
Query: 1144 ELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE-VKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDI-QVYNEG---KIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++EI D ND+ P       +L I EN    +L      TD D G+N   S  L     V  ++     L+    +   Q   I     DRE+   Y + +   D GTP  +SS ++ I I D NDN P FE       + E++ +GH +  V A DSD   N  I YS     + V+    ++ + G I +   +DRE     +F+V AKD G        ++ I + D NDN P I        ++   +    E       +  +  SD D G N      V +   P  + QV + G   K  YF      +D E V +  + +  +D+GNPP ++T ++ ++V DVNDN P F+  L+     +   ++     +V EV ATD D G N  + Y++      + +FSI  D GQI +   LD + +      V A D+G PSL  T ++ I
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL----IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV-AGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLME----VVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVI 608          

HSP 3 Score: 76.2554 bits (186), Expect = 2.717e-13
Identity = 134/576 (23.26%), Postives = 232/576 (40.28%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQ----NQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQW------VGLPYRKEISECTTEAKVLQLNAQDKDD-PQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF--ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            ++ E     NSP+G+ +  ++    +Q  + EI    SF   S+      R L+ +D+  G I V   IDRE++         G     ++  D          ++ I I D NDN P  +               I E+V   +  +L    D D    GV       ++  +     ++ D G++     +L+    LD E++K +   + A D G         + V++TDVNDN P +      V  P   +I++      V++++A D D  P +   Q+ + I  +         IF I      + +   L   +       V+A D    S + T  + + + D ND+ P   ++  +  + EN      V  +TV D D+G N+    S+   +  FV         ++NG    +  ++      FDRE  S Y+  +   D G P  SS   +TI + DENDN P     +      ++     G  +  V A+D D+  N  + YSI       E F I+HN G++ L K + R+    +   V+  D G+P+ + +  +   +
Sbjct:  291 MAYEAELPENSPMGHSVLQVKANDSDQGVNAEI--DYSFHQASDTV----RRLLHLDRSTGLITVQGPIDREDV---------GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE---GVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDL-----VMEVSATDADSGPNS---QLHYSILPDPSARG----IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFV---------IQNGTGTILSSIS------FDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF-ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 275.404 bits (703), Expect = 2.191e-76
Identity = 242/800 (30.25%), Postives = 378/800 (47.25%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTGAFLNY------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLY 2454
            F  LFF   ++ S  S K+   V E Q PN  IG+L         S  +     ++LE       G   + VD K GDI+ T ++IDRE +  CQ   P  KC    FL +      ++    ++ + QIEI+DINDN P+F     T+ IPEN      F +P A DRDS   GV  Y L     +      ++ +  +   P L V+G LDRE   S++  +   DGG         + + I D NDN P++  + Y  E+ E +     VLQ+ A D D  Q +  +I +   + S   + + R+ ++  S   + + G +           V+A D     ++  T + + I+D ND++PVI++    L         I E+   +  V  + V+D D+G+N+  +C +     V       S   +  +KK F L +   L  D E    Y++E++  D+G P +SS+  + + ++D NDN P F          E+  I   +  V A D+DS PN+ + YSI+ D   +  F IN + GQI +N +LDRE ++ Y+F V A D G P+L  +  + I VLD NDN P+ +   Y+F ++E+  R      +G +   D D G+N      V   S    IQ    G I+   + DRE        +  +D G+PPR++   V I VLD NDN P    P   ++ YL  T     G+ V  V+A D D G+N  + Y++ + N   +LF I  ++G++ L+K +  K     RLVV+  D+G PS   T  ++
Sbjct:   53 FLWLFFQLPILGS--STKVAYRVPEEQPPNILIGSLASDY-GYPDSKHL-----YKLE------LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKC----FLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS---DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV--AGDVPFQLKQVSDTGSDSKKKYF-LQTTTAL--DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSP---VGMVTVIDADKGENAHIHLSVEPESGEFVIQ-NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYL--TPQTHPGTPVNWVRAEDMDTGINAELDYSIASGN-PFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          

HSP 2 Score: 124.02 bits (310), Expect = 6.452e-28
Identity = 132/455 (29.01%), Postives = 202/455 (44.40%), Query Frame = 1
Query: 1144 ELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE-VKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDI-QVYNEG---KIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++EI D ND+ P       +L I EN    +L      TD D G+N   S  L     V  ++     L+    +   Q   I     DRE+   Y + +   D GTP  +SS ++ I I D NDN P FE       + E++ +GH +  V A DSD   N  I YS     + V+    ++ + G I +   +DRE     +F+V AKD G        ++ I + D NDN P I        ++   +    E       +  +  SD D G N      V +   P  + QV + G   K  YF      +D E V +  + +  +D+GNPP ++T ++ ++V DVNDN P F+  L+     +   ++     +V EV ATD D G N  + Y++      + +FSI  D GQI +   LD + +      V A D+G PSL  T ++ I
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL----IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV-AGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLME----VVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVI 608          

HSP 3 Score: 75.8702 bits (185), Expect = 3.714e-13
Identity = 134/576 (23.26%), Postives = 232/576 (40.28%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQ----NQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQW------VGLPYRKEISECTTEAKVLQLNAQDKDD-PQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF--ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            ++ E     NSP+G+ +  ++    +Q  + EI    SF   S+      R L+ +D+  G I V   IDRE++         G     ++  D          ++ I I D NDN P  +               I E+V   +  +L    D D    GV       ++  +     ++ D G++     +L+    LD E++K +   + A D G         + V++TDVNDN P +      V  P   +I++      V++++A D D  P +   Q+ + I  +         IF I      + +   L   +       V+A D    S + T  + + + D ND+ P   ++  +  + EN      V  +TV D D+G N+    S+   +  FV         ++NG    +  ++      FDRE  S Y+  +   D G P  SS   +TI + DENDN P     +      ++     G  +  V A+D D+  N  + YSI       E F I+HN G++ L K + R+    +   V+  D G+P+ + +  +   +
Sbjct:  291 MAYEAELPENSPMGHSVLQVKANDSDQGVNAEI--DYSFHQASDTV----RRLLHLDRSTGLITVQGPIDREDV---------GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE---GVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDL-----VMEVSATDADSGPNS---QLHYSILPDPSARG----IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFV---------IQNGTGTILSSIS------FDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF-ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 276.944 bits (707), Expect = 3.413e-76
Identity = 242/800 (30.25%), Postives = 378/800 (47.25%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTGAFLNY------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLY 2454
            F  LFF   ++ S  S K+   V E Q PN  IG+L         S  +     ++LE       G   + VD K GDI+ T ++IDRE +  CQ   P  KC    FL +      ++    ++ + QIEI+DINDN P+F     T+ IPEN      F +P A DRDS   GV  Y L     +      ++ +  +   P L V+G LDRE   S++  +   DGG         + + I D NDN P++  + Y  E+ E +     VLQ+ A D D  Q +  +I +   + S   + + R+ ++  S   + + G +           V+A D     ++  T + + I+D ND++PVI++    L         I E+   +  V  + V+D D+G+N+  +C +     V       S   +  +KK F L +   L  D E    Y++E++  D+G P +SS+  + + ++D NDN P F          E+  I   +  V A D+DS PN+ + YSI+ D   +  F IN + GQI +N +LDRE ++ Y+F V A D G P+L  +  + I VLD NDN P+ +   Y+F ++E+  R      +G +   D D G+N      V   S    IQ    G I+   + DRE        +  +D G+PPR++   V I VLD NDN P    P   ++ YL  T     G+ V  V+A D D G+N  + Y++ + N   +LF I  ++G++ L+K +  K     RLVV+  D+G PS   T  ++
Sbjct:   53 FLWLFFQLPILGS--STKVAYRVPEEQPPNILIGSLASDY-GYPDSKHL-----YKLE------LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKC----FLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS---DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV--AGDVPFQLKQVSDTGSDSKKKYF-LQTTTAL--DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSP---VGMVTVIDADKGENAHIHLSVEPESGEFVIQ-NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYL--TPQTHPGTPVNWVRAEDMDTGINAELDYSIASGN-PFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          

HSP 2 Score: 124.02 bits (310), Expect = 6.057e-28
Identity = 132/455 (29.01%), Postives = 202/455 (44.40%), Query Frame = 1
Query: 1144 ELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE-VKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDI-QVYNEG---KIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++EI D ND+ P       +L I EN    +L      TD D G+N   S  L     V  ++     L+    +   Q   I     DRE+   Y + +   D GTP  +SS ++ I I D NDN P FE       + E++ +GH +  V A DSD   N  I YS     + V+    ++ + G I +   +DRE     +F+V AKD G        ++ I + D NDN P I        ++   +    E       +  +  SD D G N      V +   P  + QV + G   K  YF      +D E V +  + +  +D+GNPP ++T ++ ++V DVNDN P F+  L+     +   ++     +V EV ATD D G N  + Y++      + +FSI  D GQI +   LD + +      V A D+G PSL  T ++ I
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL----IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV-AGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLME----VVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVI 608          

HSP 3 Score: 77.0258 bits (188), Expect = 1.634e-13
Identity = 133/575 (23.13%), Postives = 230/575 (40.00%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQ----NQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQW------VGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF--ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            ++ E     NSP+G+ +  ++    +Q  + EI    SF   S+      R L+ +D+  G I V   IDRE++         G     ++  D          ++ I I D NDN P  +               I E+V   +  +L    D D    GV       ++  +     ++ D G++     +L+    LD E++K +   + A D G         + V++TDVNDN P +      V  P   +I++      V++++A D D       Q+ + I  +         IF I      + +   L   +       V+A D    S + T  + + + D ND+ P   ++  +  + EN      V  +TV D D+G N+    S+   +  FV         ++NG    +  ++      FDRE  S Y+  +   D G P  SS   +TI + DENDN P     +      ++     G  +  V A+D D+  N  + YSI       E F I+HN G++ L K + R+    +   V+  D G+P+ + +  +   +
Sbjct:  291 MAYEAELPENSPMGHSVLQVKANDSDQGVNAEI--DYSFHQASDTV----RRLLHLDRSTGLITVQGPIDREDV---------GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE---GVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDL-----VMEVSATDAD--SGPNSQLHYSILPDPSARG----IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFV---------IQNGTGTILSSIS------FDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF-ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 275.789 bits (704), Expect = 3.566e-76
Identity = 242/800 (30.25%), Postives = 378/800 (47.25%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTGAFLNY------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLY 2454
            F  LFF   ++ S  S K+   V E Q PN  IG+L         S  +     ++LE       G   + VD K GDI+ T ++IDRE +  CQ   P  KC    FL +      ++    ++ + QIEI+DINDN P+F     T+ IPEN      F +P A DRDS   GV  Y L     +      ++ +  +   P L V+G LDRE   S++  +   DGG         + + I D NDN P++  + Y  E+ E +     VLQ+ A D D  Q +  +I +   + S   + + R+ ++  S   + + G +           V+A D     ++  T + + I+D ND++PVI++    L         I E+   +  V  + V+D D+G+N+  +C +     V       S   +  +KK F L +   L  D E    Y++E++  D+G P +SS+  + + ++D NDN P F          E+  I   +  V A D+DS PN+ + YSI+ D   +  F IN + GQI +N +LDRE ++ Y+F V A D G P+L  +  + I VLD NDN P+ +   Y+F ++E+  R      +G +   D D G+N      V   S    IQ    G I+   + DRE        +  +D G+PPR++   V I VLD NDN P    P   ++ YL  T     G+ V  V+A D D G+N  + Y++ + N   +LF I  ++G++ L+K +  K     RLVV+  D+G PS   T  ++
Sbjct:   53 FLWLFFQLPILGS--STKVAYRVPEEQPPNILIGSLASDY-GYPDSKHL-----YKLE------LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKC----FLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS---DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV--AGDVPFQLKQVSDTGSDSKKKYF-LQTTTAL--DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSP---VGMVTVIDADKGENAHIHLSVEPESGEFVIQ-NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYL--TPQTHPGTPVNWVRAEDMDTGINAELDYSIASGN-PFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 817          

HSP 2 Score: 123.635 bits (309), Expect = 8.621e-28
Identity = 132/455 (29.01%), Postives = 202/455 (44.40%), Query Frame = 1
Query: 1144 ELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE-VKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDI-QVYNEG---KIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++EI D ND+ P       +L I EN    +L      TD D G+N   S  L     V  ++     L+    +   Q   I     DRE+   Y + +   D GTP  +SS ++ I I D NDN P FE       + E++ +GH +  V A DSD   N  I YS     + V+    ++ + G I +   +DRE     +F+V AKD G        ++ I + D NDN P I        ++   +    E       +  +  SD D G N      V +   P  + QV + G   K  YF      +D E V +  + +  +D+GNPP ++T ++ ++V DVNDN P F+  L+     +   ++     +V EV ATD D G N  + Y++      + +FSI  D GQI +   LD + +      V A D+G PSL  T ++ I
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL----IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV-AGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLME----VVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVI 608          

HSP 3 Score: 76.2554 bits (186), Expect = 2.574e-13
Identity = 133/575 (23.13%), Postives = 230/575 (40.00%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQ----NQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQW------VGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF--ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            ++ E     NSP+G+ +  ++    +Q  + EI    SF   S+      R L+ +D+  G I V   IDRE++         G     ++  D          ++ I I D NDN P  +               I E+V   +  +L    D D    GV       ++  +     ++ D G++     +L+    LD E++K +   + A D G         + V++TDVNDN P +      V  P   +I++      V++++A D D       Q+ + I  +         IF I      + +   L   +       V+A D    S + T  + + + D ND+ P   ++  +  + EN      V  +TV D D+G N+    S+   +  FV         ++NG    +  ++      FDRE  S Y+  +   D G P  SS   +TI + DENDN P     +      ++     G  +  V A+D D+  N  + YSI       E F I+HN G++ L K + R+    +   V+  D G+P+ + +  +   +
Sbjct:  291 MAYEAELPENSPMGHSVLQVKANDSDQGVNAEI--DYSFHQASDTV----RRLLHLDRSTGLITVQGPIDREDV---------GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE---GVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDL-----VMEVSATDAD--SGPNSQLHYSILPDPSARG----IFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFV---------IQNGTGTILSSIS------FDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF-ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 276.559 bits (706), Expect = 4.091e-76
Identity = 242/800 (30.25%), Postives = 378/800 (47.25%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTGAFLNY------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLY 2454
            F  LFF   ++ S  S K+   V E Q PN  IG+L         S  +     ++LE       G   + VD K GDI+ T ++IDRE +  CQ   P  KC    FL +      ++    ++ + QIEI+DINDN P+F     T+ IPEN      F +P A DRDS   GV  Y L     +      ++ +  +   P L V+G LDRE   S++  +   DGG         + + I D NDN P++  + Y  E+ E +     VLQ+ A D D  Q +  +I +   + S   + + R+ ++  S   + + G +           V+A D     ++  T + + I+D ND++PVI++    L         I E+   +  V  + V+D D+G+N+  +C +     V       S   +  +KK F L +   L  D E    Y++E++  D+G P +SS+  + + ++D NDN P F          E+  I   +  V A D+DS PN+ + YSI+ D   +  F IN + GQI +N +LDRE ++ Y+F V A D G P+L  +  + I VLD NDN P+ +   Y+F ++E+  R      +G +   D D G+N      V   S    IQ    G I+   + DRE        +  +D G+PPR++   V I VLD NDN P    P   ++ YL  T     G+ V  V+A D D G+N  + Y++ + N   +LF I  ++G++ L+K +  K     RLVV+  D+G PS   T  ++
Sbjct:   45 FLWLFFQLPILGS--STKVAYRVPEEQPPNILIGSLASDY-GYPDSKHL-----YKLE------LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKC----FLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS---DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV--AGDVPFQLKQVSDTGSDSKKKYF-LQTTTAL--DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSP---VGMVTVIDADKGENAHIHLSVEPESGEFVIQ-NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYL--TPQTHPGTPVNWVRAEDMDTGINAELDYSIASGN-PFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVH 809          

HSP 2 Score: 124.02 bits (310), Expect = 7.396e-28
Identity = 132/455 (29.01%), Postives = 202/455 (44.40%), Query Frame = 1
Query: 1144 ELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE-VKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDI-QVYNEG---KIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++EI D ND+ P       +L I EN    +L      TD D G+N   S  L     V  ++     L+    +   Q   I     DRE+   Y + +   D GTP  +SS ++ I I D NDN P FE       + E++ +GH +  V A DSD   N  I YS     + V+    ++ + G I +   +DRE     +F+V AKD G        ++ I + D NDN P I        ++   +    E       +  +  SD D G N      V +   P  + QV + G   K  YF      +D E V +  + +  +D+GNPP ++T ++ ++V DVNDN P F+  L+     +   ++     +V EV ATD D G N  + Y++      + +FSI  D GQI +   LD + +      V A D+G PSL  T ++ I
Sbjct:  155 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL----IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV-AGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLME----VVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVI 600          

HSP 3 Score: 77.0258 bits (188), Expect = 1.789e-13
Identity = 133/575 (23.13%), Postives = 230/575 (40.00%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQ----NQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQI------FELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQW------VGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF--ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            ++ E     NSP+G+ +  ++    +Q  + EI    SF   S+      R L+ +D+  G I V   IDRE++         G     ++  D          ++ I I D NDN P  +               I E+V   +  +L    D D    GV       ++  +     ++ D G++     +L+    LD E++K +   + A D G         + V++TDVNDN P +      V  P   +I++      V++++A D D       Q+ + I  +         IF I      + +   L   +       V+A D    S + T  + + + D ND+ P   ++  +  + EN      V  +TV D D+G N+    S+   +  FV         ++NG    +  ++      FDRE  S Y+  +   D G P  SS   +TI + DENDN P     +      ++     G  +  V A+D D+  N  + YSI       E F I+HN G++ L K + R+    +   V+  D G+P+ + +  +   +
Sbjct:  283 MAYEAELPENSPMGHSVLQVKANDSDQGVNAEI--DYSFHQASDTV----RRLLHLDRSTGLITVQGPIDREDV---------GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE---GVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDL-----VMEVSATDAD--SGPNSQLHYSILPDPSAR----GIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFV---------IQNGTGTILSSIS------FDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF-ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 812          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 252.677 bits (644), Expect = 6.930e-69
Identity = 217/733 (29.60%), Postives = 343/733 (46.79%), Query Frame = 1
Query:  337 GRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTG---AFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G   + VD K GDI+ T ++IDRE +  CQ   P + C+     +  + +     ++ E QIE+ DINDN P+F     T+ IPEN    S F +P+A DRD+   GV  Y L++   +      ++ +      P L V+G+LDRE   S++  +   DGG        ++ +T  D NDN P++    Y  E+SE +     V+Q+ A D D  Q    +I +      Q  E++ R+  +  +   + + G +     +     V+A D     +S    + + +KD ND+ P I++    L         I E+   +  V  + V+D D+G N+  +C +     V       S   +  +KK F   + P    D EK   Y++E++  D+G P +SS+  + + + D NDN P F       +  E+ K G  +  V A D+DS  N  + YS+  +   +  F I+  NG+I +   LDRE +D YE  V A D G P+L  +  + + VLD NDN P+   S Y+F ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DRE+       +  +D G PPR+A   V I VLD NDN P  T P   +H  L  T     G  V +V A D D G+N  + Y++   N    LF I S  G I L+K+++ +     RLVV+  D+G P    T  +++
Sbjct:   73 GAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFH---QAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTP---LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENARVQLSVEQDNGDFVIQ-NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLL--TPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHL 788          

HSP 2 Score: 136.346 bits (342), Expect = 5.705e-32
Identity = 139/580 (23.97%), Postives = 254/580 (43.79%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII---GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNR 2157
            L++ ++D NDN P F+      ++ EN       S+   K  DS++    +       +         +D    +   + V G +DRE++ +  F + A D G      + +++V + D+NDN P    + +GL   ++    ISE    E  V  +   D+D+ +       + G + F++ + S+      + +++ ++   L+   +K +      IV + +     S+  ++++++ D ND+ PV     + +   EN K   +V  +T +D D G N+E   SL      +   ++T   ENG  +    L        DRE+   Y ++V+  D G+P++  +  + + + D NDN P F      FS+ E+      +G+V   D D   N  +  S+    GD+ ++     N  G I  +   DRE +  Y F ++A D G P  +    + I VLD NDN P I+  ++ S +++    R  +   + ++ A D D G N    + +   +     Q+  + G I     I+R       ++V V D G PPR  T  VH+ V +   NR
Sbjct:  244 LRVTVLDTNDNAPKFERPTYEAELSENSPIG--HSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL---ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFL-QTTTPLDYEKVKDYT---IEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEP--AAQGLFTISPENGEIRVKTSL--------DREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ-----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGE--TVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR 797          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 252.677 bits (644), Expect = 6.930e-69
Identity = 217/733 (29.60%), Postives = 343/733 (46.79%), Query Frame = 1
Query:  337 GRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTG---AFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G   + VD K GDI+ T ++IDRE +  CQ   P + C+     +  + +     ++ E QIE+ DINDN P+F     T+ IPEN    S F +P+A DRD+   GV  Y L++   +      ++ +      P L V+G+LDRE   S++  +   DGG        ++ +T  D NDN P++    Y  E+SE +     V+Q+ A D D  Q    +I +      Q  E++ R+  +  +   + + G +     +     V+A D     +S    + + +KD ND+ P I++    L         I E+   +  V  + V+D D+G N+  +C +     V       S   +  +KK F   + P    D EK   Y++E++  D+G P +SS+  + + + D NDN P F       +  E+ K G  +  V A D+DS  N  + YS+  +   +  F I+  NG+I +   LDRE +D YE  V A D G P+L  +  + + VLD NDN P+   S Y+F ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DRE+       +  +D G PPR+A   V I VLD NDN P  T P   +H  L  T     G  V +V A D D G+N  + Y++   N    LF I S  G I L+K+++ +     RLVV+  D+G P    T  +++
Sbjct:   73 GAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFH---QAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTP---LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENARVQLSVEQDNGDFVIQ-NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLL--TPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHL 788          

HSP 2 Score: 136.346 bits (342), Expect = 5.705e-32
Identity = 139/580 (23.97%), Postives = 254/580 (43.79%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII---GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNR 2157
            L++ ++D NDN P F+      ++ EN       S+   K  DS++    +       +         +D    +   + V G +DRE++ +  F + A D G      + +++V + D+NDN P    + +GL   ++    ISE    E  V  +   D+D+ +       + G + F++ + S+      + +++ ++   L+   +K +      IV + +     S+  ++++++ D ND+ PV     + +   EN K   +V  +T +D D G N+E   SL      +   ++T   ENG  +    L        DRE+   Y ++V+  D G+P++  +  + + + D NDN P F      FS+ E+      +G+V   D D   N  +  S+    GD+ ++     N  G I  +   DRE +  Y F ++A D G P  +    + I VLD NDN P I+  ++ S +++    R  +   + ++ A D D G N    + +   +     Q+  + G I     I+R       ++V V D G PPR  T  VH+ V +   NR
Sbjct:  244 LRVTVLDTNDNAPKFERPTYEAELSENSPIG--HSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL---ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFL-QTTTPLDYEKVKDYT---IEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEP--AAQGLFTISPENGEIRVKTSL--------DREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ-----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGE--TVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR 797          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 227.254 bits (578), Expect = 2.029e-60
Identity = 195/666 (29.28%), Postives = 308/666 (46.25%), Query Frame = 1
Query:  511 NDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            NDN P+F     T+ IPEN    S F +P+A DRD+   GV  Y L++   +      ++ +      P L V+G+LDRE   S++  +   DGG        ++ +T  D NDN P++    Y  E+SE +     V+Q+ A D D  Q    +I +      Q  E++ R+  +  +   + + G +     +     V+A D     +S    + + +KD ND+ P I++    L         I E+   +  V  + V+D D+G N+  +C +     V       S   +  +KK F   + P    D EK   Y++E++  D+G P +SS+  + + + D NDN P F       +  E+ K G  +  V A D+DS  N  + YS+  +   +  F I+  NG+I +   LDRE +D YE  V A D G P+L  +  + + VLD NDN P+   S Y+F ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DRE+       +  +D G PPR+A   V I VLD NDN P  T P   +H  L  T     G  V +V A D D G+N  + Y++   N    LF I S  G I L+K+++ +     RLVV+  D+G P    T  +++
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFH---QAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTP---LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENARVQLSVEQDNGDFVIQ-NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLL--TPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHL 649          

HSP 2 Score: 136.346 bits (342), Expect = 6.521e-32
Identity = 139/580 (23.97%), Postives = 254/580 (43.79%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII---GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNR 2157
            L++ ++D NDN P F+      ++ EN       S+   K  DS++    +       +         +D    +   + V G +DRE++ +  F + A D G      + +++V + D+NDN P    + +GL   ++    ISE    E  V  +   D+D+ +       + G + F++ + S+      + +++ ++   L+   +K +      IV + +     S+  ++++++ D ND+ PV     + +   EN K   +V  +T +D D G N+E   SL      +   ++T   ENG  +    L        DRE+   Y ++V+  D G+P++  +  + + + D NDN P F      FS+ E+      +G+V   D D   N  +  S+    GD+ ++     N  G I  +   DRE +  Y F ++A D G P  +    + I VLD NDN P I+  ++ S +++    R  +   + ++ A D D G N    + +   +     Q+  + G I     I+R       ++V V D G PPR  T  VH+ V +   NR
Sbjct:  105 LRVTVLDTNDNAPKFERPTYEAELSENSPIG--HSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL---ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFL-QTTTPLDYEKVKDY---TIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEP--AAQGLFTISPENGEIRVKTSL--------DREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ-----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGE--TVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR 658          

HSP 3 Score: 62.003 bits (149), Expect = 4.491e-9
Identity = 82/365 (22.47%), Postives = 148/365 (40.55%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIV--VIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFET 1539
            L+++++D+NDN P F      +  PEN       +   A D DS      +           +  F +      I    RV   LDRE   S+E  + A+D G    QG   ++V + D NDN P+++   Y   + E     + V  +   D D     G   R ++S    N + +++    T +IL     +L   +E +++    + A DG    RS    + + + D ND+ P I   S++       ++++   V+++T  D D GIN+E + S                +  G    +FQ+ S  G        +R     + + V  +D G P    + ++ +++++   N    ET
Sbjct:  331 LKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNA--ELVYSLEPEPAAQGLFTISPENGEI----RVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDK----GENARVQLSVEQDNGDFVIQ--NGTGTIL----SSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYS----------------IAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLET 663          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 224.557 bits (571), Expect = 1.890e-59
Identity = 220/771 (28.53%), Postives = 364/771 (47.21%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPI---SKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTE-----AKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKA-SIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
            +V E    N  IG+L+K     LI +++ +T +     F+L  +  +     LI +++  G+I+ T A IDRE++C  I   ++C     +  +     ++ +++  I DINDN P F      I IPEN A +S +SLP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I++++  D NDN P ++     KEI     E     + V QL+A D D    IG   R     ++    +  R+F++  +   + +      +E+ +  ++V+A DG       T+ + + D ND+ P I +       + ++ + EN      +  ITV D+D   N   +C  +      L  ++++          F L +    + D E    Y+++++  D G P ++ S ++ I + DENDN P F   F + S+ E+   G ++  + A D+DS  N  I+Y +   ++    F ++   G +   K LDRE +++Y FTV A+DNG P L  +  + + VLD NDN P  +   Y+F + ES     KH  +G +  +D D G+N      +   +    I     G I    + DRE+ +     V   D G   R++T  V I V+DVNDN+P F  P  N +++  +      G++V +V A D+D G+N  ++Y++   N TK LF I Q+ G I LK+K         R++V+A D G P
Sbjct:   29 TVREEMPENVLIGDLLKDLNLSLIPDKSLTTPM----QFKLVYKTGDV---PLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI----EKEIEVSIPENAPIGSSVTQLHATDAD----IGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQ---------FLLET--AAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML--GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP---KHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDP-QSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSN-YSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN-TKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 223.787 bits (569), Expect = 1.957e-59
Identity = 220/771 (28.53%), Postives = 364/771 (47.21%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPI---SKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTE-----AKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKA-SIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
            +V E    N  IG+L+K     LI +++ +T +     F+L  +  +     LI +++  G+I+ T A IDRE++C  I   ++C     +  +     ++ +++  I DINDN P F      I IPEN A +S +SLP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I++++  D NDN P ++     KEI     E     + V QL+A D D    IG   R     ++    +  R+F++  +   + +      +E+ +  ++V+A DG       T+ + + D ND+ P I +       + ++ + EN      +  ITV D+D   N   +C  +      L  ++++          F L +    + D E    Y+++++  D G P ++ S ++ I + DENDN P F   F + S+ E+   G ++  + A D+DS  N  I+Y +   ++    F ++   G +   K LDRE +++Y FTV A+DNG P L  +  + + VLD NDN P  +   Y+F + ES     KH  +G +  +D D G+N      +   +    I     G I    + DRE+ +     V   D G   R++T  V I V+DVNDN+P F  P  N +++  +      G++V +V A D+D G+N  ++Y++   N TK LF I Q+ G I LK+K         R++V+A D G P
Sbjct:   29 TVREEMPENVLIGDLLKDLNLSLIPDKSLTTPM----QFKLVYKTGDV---PLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI----EKEIEVSIPENAPIGSSVTQLHATDAD----IGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQ---------FLLET--AAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML--GFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP---KHGTVGLITVTDPDYGENSAVTLSILDVNDQFTID-PQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSN-YSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN-TKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 1.115e-67
Identity = 217/733 (29.60%), Postives = 342/733 (46.66%), Query Frame = 1
Query:  337 GRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTG---AFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G   + VD K GDI+ T ++IDRE +  CQ   P   C+     +  + +     ++ E QIE+ DINDN P+F     T+ IPEN    S F +P+A DRD+   GV  Y L++   +      ++ +      P L V+G+LDRE   S++  +   DGG        ++ +T  D NDN P++    Y  E+SE +     V+Q+ A D D  Q    +I +      Q  E++ R+  +  +   + + G +     +     V+A D     +S    + + +KD ND+ P I++    L         I E+   +  V  + V+D D+G N+  +C +     V       S   +  +KK F   + P    D EK   Y++E++  D+G P +SS+  + + + D NDN P F       +  E+ K G  I  + A D+DS  N  + YS+  +   K  F I+   G+I +   LDRE ++ YE  V A D G P+L  +  + + VLD NDN P+   S Y+F ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DRE+       +  +D G PPR+A   V I VLD NDN P  T P   +H  L  T     G  V +V A D D G+N  +IY++   N    LF I S  G I L+K+++ +     RLVV+  D+G P    T  +++
Sbjct:   95 GAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTP---LDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ-NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLL--TPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN-PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHL 810          

HSP 2 Score: 136.346 bits (342), Expect = 4.706e-31
Identity = 141/582 (24.23%), Postives = 254/582 (43.64%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYI--TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII---GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNR 2157
            L++ ++D NDN P F+      ++ EN       S+   K  DS++    +       +         +D    +   + V G +DRE++ +  F + A D G N    + +++V + D+NDN P    + +GL   ++    ISE    E  V  +   D+D+ +       + G + F++ + S+      + +++  T  + Y      +  K+    IV + +     S+  ++++++ D ND+ PV     + +   EN K   ++  IT +D D G N+E   SL      +   ++T   E G      Q+ +      DRE+   Y ++V+  D G+P++  +  + + + D NDN P F      FS+ E+      +G+V   D D   N  +  S+    GD+ ++     N  G I  +   DRE +  Y F ++A D G P  +    + I VLD NDN P I+  ++ S K++    R  +   + ++ A D D G N    + +   +     Q+  + G I     I+R       ++V V D G PPR  T  VH+ V +   NR
Sbjct:  266 LRVTVLDTNDNAPKFERPSYEAELSENSPIG--HSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGL---ITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDY------EKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEP--AAKGLFTISPETGE----IQVKT----SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ-----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGE--TVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANR 819          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 7.829e-61
Identity = 233/790 (29.49%), Postives = 364/790 (46.08%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISKCLTGAFLNYIIFADHQIFEL---QIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSP--LENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
             + +  +  V  S    K Y ++ E    N  IGNL+K     LI N++ +T    T  F+L  +  +     LI +++  G+I+ T A IDRE++C  I +     +   +     +IF L   +  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++   LEN               Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y F + E+  R   H  +G +  +D D G N      +   +   D  + ++  +I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P
Sbjct:   41 IFAVLLVCVVFHSGAQEKNY-TIREEIPENVLIGNLLKDLNLSLIPNKSLTT----TMQFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAA-------------YLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDEND--DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYN-YSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.270e-60
Identity = 226/767 (29.47%), Postives = 358/767 (46.68%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISKCLTGAFLNYIIFADHQIFEL---QIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
            ++ E    N  IG+L+K     LI N++ +T +     F+L  +  +     LI +++  G+I+ T A IDRE++C  I +     +   +     +IF L   +  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++          F L +    Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y+F + E+  R   H  +G +  +D D G N      +   +   D  + ++  +I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P
Sbjct:   29 TIREEMPENVLIGDLLKDLNLSLIPNKSLTTAM----QFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------FLLET--AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDEND--DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSN-YSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.299e-60
Identity = 226/767 (29.47%), Postives = 358/767 (46.68%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISKCLTGAFLNYIIFADHQIFEL---QIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
            ++ E    N  IG+L+K     LI N++ +T +     F+L  +  +     LI +++  G+I+ T A IDRE++C  I +     +   +     +IF L   +  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++          F L +    Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y+F + E+  R   H  +G +  +D D G N      +   +   D  + ++  +I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P
Sbjct:   29 TIREEMPENVLIGDLLKDLNLSLIPNKSLTTAM----QFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKS-----QNIFGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------FLLET--AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDEND--DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSN-YSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 5.946e-60
Identity = 228/770 (29.61%), Postives = 362/770 (47.01%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIK-----LIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEICQPISK---C---LTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRII--VEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG-ALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVH------SSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
            ++ E    N  IG+L+K     LI N++ +T +     F+L  +  +     LI +++  G+I+ T A IDRE++C  I +   C   +  A L   IF   ++ +++  I DINDN P F      I IPEN A +S+++LP A D D    GV+ Y L        +N F L       G+ + P L V  +LDRE   ++   +   DGG  Q     I  V +TD NDN P +        I E       V QL+A D D    IG   +   S ++    +  R+F++  +   + I   L   +     ++V+A+DG        + + + D ND+ P I +       + ++ + EN      +  ITVTD+D   N   +C  +      L  ++++          F L +    Y D E    Y+++++  D G P ++ S ++ I + DENDN P F   F T SI E+   G ++  V A D+DS PN  I Y ++G     E       G + + K LDRE +D+Y FT+ AKDNG P L  +  + + ++D NDN P  +   Y+F + E+  R   H  +G +  +D D G N      +   +   D  + ++  +I    + DREK +     V   D G   R+++  V I V+DVNDN+P F  P  N ++Y  +      G++V +V A D D G+N  + Y++   N T+DLF+I Q  G I L +K D       R++V+A D G P
Sbjct:   29 TIREEMPENVLIGDLLKDLNLSLIPNKSLTTAM----QFKLVYKTGDV---PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIF---RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS-----QNMFGLDVIETPEGDKM-PQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDAD----IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------FLLET--AAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPR---HGTVGLITVTDPDYGDNSAVTLSILDEND--DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSN-YSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4E0S0C6 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000360 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.167e-80
Identity = 239/850 (28.12%), Postives = 382/850 (44.94%), Query Frame = 1
Query:  346 LISVDQKKGDIWVTSAIDREEICQPI----SKCL-------------TGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKT-------IKIPENVARSSEFSLPVAKDRDSEKYGVXXXX-XXXXXXXXXENYFELIDHGNN--------------------------INPYLRVIGDLDRENI-KSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWV------------------------GLPYRK-----EISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNY--EMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSS-LKIKENEKSKI-LVTRITVTDED--QGINSEFSCSLNDTNFVSLDSMYTSPLEN------------------GGQK---------KIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFK---------------------TFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--------------DYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGE-PNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGT--FRFRVRSRSTPID----------------IQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTAT-TTVHIEVLDVNDNRPKFTYPLLNAHNY-------------------------------LNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            L+ ++   G +  T  +DRE +C        +C              +  F    ++AD     L + ++D+NDN P F             I + E     +   LP A D D++++GV++Y    + ++     +F+++   +                           + P LR I  LDRE     F F+L A+D  G +G+  + + + DVND+ P+W                         G   R+      + ECTT+ K+++L AQDKDDPQ  GG+I F++SE+S +     + R  +++   LYL    L+   +   +IVV+A+DG GR+ E    L I+DCNDHRP+I + ++  + I E    +  LV+ ITV D D     NS+FSC LNDT ++ L  +   P  +                  GG++          +++L S   + FDRE ++ Y+V   C D G+P++++S  ITI I D NDN P F T                         F++SEDA+ G  IG V A D DS  N  + Y+++                +  +  F +   G++HL   LDRE +  YEF V A D+G+   L+ +  ++I V DVND  P     Y F++VES+     H  +G LNA+D D+G+NG+  +R  V  R + +                 ++V ++G+I  +G +DRE++  I V V   DNG P   +T TTV I VLD+NDN+P+F  P   A                                  LN++ D + G+++ + +A D D+G NG++ + L
Sbjct:  122 LVQLEPSTGAVRFTVPLDRERLCPDTIGTDQRCTISLLVAIHLTPINSSHFKPLTVYAD-----LTVLVLDVNDNAPYFTSSNSADSAPLAVITVDEECPIGTMIQLPQATDPDTQEHGVQRYEFHPTSTAVRVREHFDVVQFRHQPGLRCEDVTSVQLEMIQSVAPADPRPVVPCLRTIRRLDRETAGDQFHFNLIATDTNGKRGEIAVQLLVRDVNDHAPEWATKLELFDSSSRSHWISASPSDPAHGTESRQTHYTFSVPECTTQHKLIRLEAQDKDDPQQDGGKITFRLSEHSPDRLPTTLRRRLFVSNDHLYLTDRGLRGLAQPNLTIVVVASDGAGRNTEAWFHLRIEDCNDHRPMILIQNTDYITIPEESAGQSHLVSLITVRDFDLVTSPNSQFSCFLNDTTYLELKEVVAGPTADDRDLLHSHSHQGDEITSTGGKEDLSSRRGRWSVYRLGSRSEISFDRETSALYTVMFECIDKGSPSLTASRPITIHIEDINDNAPQFITRCAPLPLSQNTKDIKPNRPCTPQFVFTVSEDAERGILIGSVRAVDLDSGENARVEYTLLSLHNNSTVPDSNESEVFRPETLFTVTPMGELHLLGELDRESQSYYEFLVVATDHGKRQRLSSTATVQITVADVNDCAPVFRGDYVFEVVESYGSSTIHQVLGTLNATDADLGRNGSVHYRLAVHPRESGLSGLSKSMSDSAVPGAQLVKVSHDGQITVYGVVDREQITMIMVDVIAEDNGVPLHMSTMTTVTIHVLDLNDNKPRFVQPEFTAGRLPSSFSNQKPERFNTLGLPPSFEALSSDATYKLNLSLDTSIGTLITKFEAFDPDYGPNGTLTFEL 966          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A3Q3FN09 (Protocadherin 1a OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 6.680e-75
Identity = 250/803 (31.13%), Postives = 386/803 (48.07%), Query Frame = 1
Query:  127 LMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPISKCLTGAFLNYIIFA-------DHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKV-------HSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            L   +FW    +     +E S+ LY  V+E Q PN+ IG+L    Q    S  +     ++LE       G   + VD K GDI+ T   IDRE +  C+ ++K  T  +L + +           ++ E +IE+ DINDN P F     TI +PEN    + FS+P+A DRDSE+ GV  Y L +   +      ++ D      P L V+G+LDRE   S++  + A DGG  Q      + V +TD NDN P++    Y  E+SE +     VLQ+ A D D      G+I + + +       ++RI   T  I+Y+  G L   + +  S  V+A D   + +S++T + +E+ D ND+ P +++       HS  +  I E+      V  + V+DED+G N+  +C +       L     S  +N  ++K F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN P F         +E+ + G ++  V A D+DS  N  + Y+I+ D  +K  F I+ N G++     LDRE K+RYEF V A D G P    +  + + VLD NDN P+   S YSF ++E+         +G +   D D G+N      V        +Q    G I+   + DREK       +  +D G PPR++   V I VLD NDN P  T P  +  ++  ++   +  S V  V+A D+D G N  ++YN+   N    LF I  S G+I L K++  K     RLVV   D+G P   AT  ++I
Sbjct:    5 LRAVLFW--VVVLHCGSAEGSI-LY-RVQEEQPPNTLIGSLAA-DQGLPDSGHL-----YKLE------VGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLAKGKT-CYLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSSALLRVVVTDANDNAPKFEKSSYEAEVSENSPVGHSVLQVKANDSD--MGPNGEIEYTLHQAVDPVPKLLRIDRST-GIIYVK-GPLDREEISSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDEDEGENAVVTCVVAGDVPFQLRPASDSTADN--KRKYFLQTTTP---LDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIFSPTLFEVDFAEENQPGEKVLDVTASDADSGTNAELLYNIVADSSIKGLFEIDPNTGEVRARSPLDREHKERYEFRVTAADKGSPVHKGTATVVVKVLDRNDNDPKFMLSGYSFSVLENMPPLSP---VGMVTVQDMDKGENARVHLSVEPDGGKFVVQ-NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVITKP--SNSSFRRLSPLASPDSHVEVVEAEDQDSGPNAELVYNIAGGN-PYSLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHI 774          

HSP 2 Score: 129.413 bits (324), Expect = 1.863e-26
Identity = 148/586 (25.26%), Postives = 245/586 (41.81%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE---CTTEAKVLQLNAQDKDDPQTI----GGQIRFKISENSQNYEMIVRIFYI--TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI---IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS-------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEV 2136
            L++ + D NDN P F+      ++ EN           A D D    G  +Y L      + +     ID    I   + V G LDRE I S  F++ A D G      K  + +E+TD NDN P    + +GL    E    ISE     T   ++Q++ +D+ +   +     G + F++   S +     R +++  T  + Y  +      ++ +  IV + +     S+  ++++++ D ND+ P+       +   E  +    V  +T +D D G N+E        N V+  S+          K +F+++   G        DRE   RY   V   D G+P    +  + + + D NDN P F     +FS+ E+      +G+V  +D D   N  +  S+    G + V+     N  G I  +   DRE +  Y F ++A D GEP  +    + I VLD NDN P I+  ++ SF+ +        H  +  + A D+D G N    + +         R +P      + G+I     + R+      ++V V D G PPR AT  VHI V
Sbjct:  230 LRVVVTDANDNAPKFEKSSYEAEVSENSPVGHSVLQVKANDSDMGPNGEIEYTLHQAVDPVPK--LLRIDRSTGI---IYVKGPLDREEISSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDEDEGENAVVTCVVAGDVPFQLRPASDSTADNKRKYFLQTTTPLDYERV------RDYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIFSPTLFEVDFAEENQPGEKVLDVTASDADSGTNAELLY-----NIVADSSI----------KGLFEIDPNTGEVRARSPLDREHKERYEFRVTAADKGSPVHKGTATVVVKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDKGENARVHLSVEPDGGKFVVQ-----NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVITKPSNSSFRRLSPLASPDSHVEV--VEAEDQDSGPNAELVYNIAGGNPYSLFRISP------SSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 3 Score: 91.6633 bits (226), Expect = 7.144e-15
Identity = 141/604 (23.34%), Postives = 241/604 (39.90%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH-------QIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHG-----NNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSF----KENKA--SIVVIAADGEG--RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGD--YEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWERE 1893
            S E     NSP+G+   ++Q +   +++      +    ++      L+ +D+  G I+V   +DREEI          +   Y++  D        + F + IE+ D NDN P+ +          E    I E++   +  +L    D D  +  V    +           F+L         N    +L+    LD E ++ +   + A D G         + V++TDVNDN+P +    +  + +E      KVL + A D D       ++ + I  +S     I  +F I       N G +++     +E+K      V AAD          T+ +++ D ND+ P   +   S  + EN      V  +TV D D+G N+    S+                E  G K + Q  +   +  + FDREK S Y+  +   D G P  SS   +TI + DENDN P       + F+   +S  A     + +V A+D DS PN  + Y+I G   Y +   F I+  +G+I L K + R+    +   V   D G+P  + +  + I V +   N+  +       +    +R+
Sbjct:  248 SYEAEVSENSPVGH--SVLQVKANDSDMGPNGEIEYTLHQAVDPVPKLLRIDRSTGIIYVKGPLDREEIS---------SLSFYVVARDKGPQPKSSKTF-VTIEVTDQNDNAPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDEDEGENAVVTCVVAGDVP------FQLRPASDSTADNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIFSPTLFEVDFAEENQPGEKVLDVTASDAD--SGTNAELLYNIVADSS----IKGLFEIDP-----NTGEVRARSPLDREHKERYEFRVTAADKGSPVHKGTATVVVKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDKGENARVHLSV----------------EPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVITKPSNSSFR--RLSPLASPDSHVEVVEAEDQDSGPNAELVYNIAGGNPYSL---FRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRD 801          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A3Q2XMI2 (Protocadherin 1a OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.099e-74
Identity = 247/803 (30.76%), Postives = 389/803 (48.44%), Query Frame = 1
Query:  127 LMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPISK---C---LTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKV-------HSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAA-GSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            L+  +FW L  L    +S     +   V+E Q PN+ IG+L    Q    S  +     ++LE       G   + VD K GDI+ T   IDRE +  C+ + +   C      +  + I     ++ E +IE+ DINDN P F     TI +PEN    + FS+P+A DRDS++ GV  Y L +   +      ++ D      P L V+G+LDRE   S++  +   DGG  Q      + V +TDVNDN+P++  L Y  E+ E +     VLQ+ A D D      G+I + + +       ++RI   T  I+Y+  G L   + +  S  V+A D   + +S++T + +E+ D ND+ P +++       HS  +  I E+      V  + V+D+D+G N+  +C +       L  +  S  +N  ++K F   + P    D E+   Y V ++  D+G P +S +  + + ++D NDN P F         +E+ + G ++  VIA D+DS  N  + YSI+ D  +K  F I+ N G++  +  LDRE K+ YEF V A D G P    +  + I VLD NDN P+   S YSF ++E+         +G +   D D G+N   R  V S      +Q    G I+   + DREK       +  +D G PPR++   V I VLD NDN P  T P   +++   +   +A+  S V  V+A D D G N  +++++   N  + LF I  S G+I L K++  K     RLVV+  D+G P+  AT  ++I
Sbjct:   14 LLVMLFWLLVLL----RSSAEGSILYRVQEEQPPNTLIGSLAA-DQGLPDSGHL-----YKLE------VGAPYLRVDGKTGDIFTTEIPIDRETLRDCRMLVRGKPCYLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSSVLTISVPENTIMGALFSIPLATDRDSDRNGVSDYALTAGQDAATLFGLQVADDRGGKIPQLIVLGNLDRELKDSYDLTIKTVDGGNPQRYSSALLRVVVTDVNDNSPKFEKLTYEAEVLENSPVGHSVLQVKANDSD--MGPNGEIEYTLHQAGDPVPKLLRIDRST-GIIYVK-GPLDREEIDSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNPPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDQDEGENAVVTCVVAGDVPFQLRPISDSSSDN--KRKYFLQTTTP---LDYERVKDYRVAIVAVDSGNPALSGTNSLKVQVTDVNDNAPVFSPTLFEVEFAEENQPGEKVLDVIASDADSGTNADLLYSIVADTSIKGLFEIDPNTGEVRASNPLDREHKEHYEFRVTAADKGSPVHKGTASVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSP---VGMVTVMDVDKGENAHVRLSVESDGGKFVVQ-NGTGTILSSISFDREKESSYTFRLKALDGGQPPRSSYVGVTINVLDENDNDPVVTKP---SNSSFRLLSPLASPDSHVEIVEAEDLDSGPNAELVFSIAGGNPYQ-LFRISPSSGEITLAKEMARKYGGLHRLVVKVSDRGKPTRHATALVHI 783          

HSP 2 Score: 124.79 bits (312), Expect = 5.546e-25
Identity = 154/625 (24.64%), Postives = 252/625 (40.32%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLR---------VIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE---CTTEAKVLQLNAQDKDDPQTI----GGQIRFKISENSQNYEMIVRIFYI--TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL-NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI---IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS-------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAA 2223
            L++ + D+NDN P F+      ++ EN           A D D    G              E  + L   G+ +   LR         V G LDRE I S  F++ A D G      K  + +E+TD NDN P    + +GL    E    ISE     T   ++Q++ QD+ +   +     G + F++   S +     R +++  T  + Y  +      K+ + +IV + +     S   ++++++ D ND+ PV       ++  E  +    V  +  +D D G N++   S+  DT+                 K +F+++   G        DRE    Y   V   D G+P    +  + I + D NDN P F     +FS+ E+      +G+V   D D   N  +  S+    G + V+     N  G I  +   DRE +  Y F ++A D G+P  +    + I VLD NDN P ++  ++ SF+++        H  I  + A D D G N    F +         R +P      + G+I     + R+      ++V V D G P R AT  VHI V +   N   F   L+    Y  +  D+A 
Sbjct:  239 LRVVVTDVNDNSPKFEKLTYEAEVLENSPVGHSVLQVKANDSDMGPNG--------------EIEYTLHQAGDPVPKLLRIDRSTGIIYVKGPLDREEIDSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNPPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDQDEGENAVVTCVVAGDVPFQLRPISDSSSDNKRKYFLQTTTPLDYERV------KDYRVAIVAVDSGNPALSGTNSLKVQVTDVNDNAPVFSPTLFEVEFAEENQPGEKVLDVIASDADSGTNADLLYSIVADTSI----------------KGLFEIDPNTGEVRASNPLDREHKEHYEFRVTAADKGSPVHKGTASVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVMDVDKGENAHVRLSVESDGGKFVVQ-----NGTGTILSSISFDREKESSYTFRLKALDGGQPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRLLSPLASPDSHVEI--VEAEDLDSGPNAELVFSIAGGNPYQLFRISP------SSGEITLAKEMARKYGGLHRLVVKVSDRGKPTRHATALVHIYVNETISNV-SFVEALVGHSLYTPLDRDIAG 813          

HSP 3 Score: 97.8265 bits (242), Expect = 1.110e-16
Identity = 144/578 (24.91%), Postives = 239/578 (41.35%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH-------QIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL--IDHGNNINP---YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSF----KENKA--SIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            L+ E     NSP+G+   ++Q +   +++      +    ++      L+ +D+  G I+V   +DREEI          +   Y++  D        + F + IE+ D NDN P+ +          E    I E++   +  +L    D+D  +  V    +           F+L  I   ++ N    +L+    LD E +K +   + A D G     G   + V++TDVNDN P +    +  E +E      KVL + A D D        + + I  ++     I  +F I       N G +++     +E+K      V AAD     ++ T  + IK  D ND+ P   +   S  + EN      V  +TV D D+G N+    S+                E+ G K + Q  +   +  + FDREK S Y+  +   D G P  SS   +TI + DENDN P       + F+   +S  A     + IV A+D DS PN  + +SI G     + F I+  +G+I L K + R+    +   V+  D G+P  + +  + I V
Sbjct:  256 LTYEAEVLENSPVGH--SVLQVKANDSDMGPNGEIEYTLHQAGDPVPKLLRIDRSTGIIYVKGPLDREEI---------DSLSFYVVARDKGPQPKSSKTF-VTIEVTDQNDNPPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDQDEGENAVVTCVVAGDVP------FQLRPISDSSSDNKRKYFLQTTTPLDYERVKDYRVAIVAVDSGNPALSGTNSLKVQVTDVNDNAPVFSPTLFEVEFAEENQPGEKVLDVIASDAD--SGTNADLLYSIVADTS----IKGLFEIDP-----NTGEVRASNPLDREHKEHYEFRVTAADKGSPVHKGTASVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVMDVDKGENAHVRLSV----------------ESDGGKFVVQNGTGTILSSISFDREKESSYTFRLKALDGGQPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRL--LSPLASPDSHVEIVEAEDLDSGPNAELVFSIAGGNPY-QLFRISPSSGEITLAKEMARKYGGLHRLVVKVSDRGKPTRHATALVHIYV 785          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A068WE58 (Protocadherin gamma B1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000834200 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.203e-74
Identity = 251/835 (30.06%), Postives = 365/835 (43.71%), Query Frame = 1
Query:  130 MFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQP-------------ISKCLTGAFLNYIIFADHQIFE-LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXX-----------XXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK---------------------------VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSS-----------------LKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQK----KIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMS-SSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN---HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI------STSYSFKIVESWEREH-KHFYIGKLNASDRDIGQNGTFRFRVRS-------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNG--NPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHN------YLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS 2337
            MF + W +F +  ++  E        ++EN    + IG LI  +Q+Q   T         L  +  + Y    I +    G +     IDRE ICQ               S     AFL +I   +  + E +Q+ IID+NDN P F+P   TI +PE+      F LP AKD D  K G+                    ++  + YF L     N  P LR I  LD E  ++  + L+A DGGG      I VEI DVNDN+PQWVGLPY   + EC  +++                           ++QL A D D  +   G I+FK+ +   + +   ++    + + Y+ IG L      K SI V A DG G +N T I++ ++DCND+ P I V S S                 + I E +  +I +  ITV+D D G N+  SC +   N V  +     PL+          +F L    G+ FDRE  SR  V ++C D G P  + + +++ I + D NDN P F+       + E+   G   G V A D D   N  + YSI        T         G+I   + LDRE K  Y  TVEA D G+P L+ S  + I VLDVND+ P        S    F+I ES+++E     +IG++NA+D D G NGT  F ++         + P   ++  +G++   G +DREK  + +V V V D G  +   T+   V I + D NDN P FT P   +         LN T D+   S +  + A D D   NG + + L    + +  F I S
Sbjct:    1 MFALTWTVFVI-PLISCEAPYMHQFYIKENTPAGTLIGQLI--VQHQKTFTS--------LAGQPLSEY----ILIHPTNGSMLAIQTIDREAICQNDESTNSSLVLHRFESPSCEVAFLVHITTNEESLLETVQLTIIDMNDNSPIFEPSSVTISVPESSPIGGLFYLPPAKDADLGKNGISSYHLSRIHSDSGPQACPSYTANDDGYFTLSMTDEN-TPQLRQISGLDYEKFQNLFYCLHAYDGGGLTSALLIAVEIQDVNDNSPQWVGLPYHVHLRECAQQSQQSLWKTSAELRSFLRLSGFAYDTPFRFLIQLAAIDADSKE--NGLIKFKVVQRKSDIQASYKVVVHGDKV-YI-IGQLDYETTPKFSIAVEAKDGGGLTNVTNIDVTLEDCNDNTPKITVTSLSPLPRENLSDWSYYKLTDIWISEEDGREIKLATITVSDADTGENAAVSCDIEWNNLVCTNPFSLVPLKTPAAAIRVPTVFMLLKRDGIKFDREATSRVQVTIVCADRGRPQANIARQMVDIGVWDINDNAPKFKHR-GDIGVQENEPDGTVAGYVHASDIDFGRNAALKYSIKNCKHNVSTLSFTIDERTGKISTLRSLDRENKAVYCVTVEAVDEGDPQLSSSVDVNITVLDVNDSPPVFQGNKNESGRIVFEIPESFDQERLMERFIGQVNATDADSGANGTLEFSIKQTPGPFWHSNPPAYFRITRKGQLYVDGVLDREKQQEHEVTVVVSDTGAFHQRLTSEIGVTIRLQDQNDNSPVFTEPGALSKGPHAGPATLNTTHDVTVNSSILRICAKDNDLQENGKLNFTLRCAKYLRPYFGIGS 814          

HSP 2 Score: 89.7373 bits (221), Expect = 2.981e-14
Identity = 128/522 (24.52%), Postives = 212/522 (40.61%), Query Frame = 1
Query: 1138 TIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIF----------QLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF-----------------------ETEFKTF----SISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG-DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYS------------FKIVESW--EREHKHFYIGKLNASDRDIGQNGTFR-------------FRVRSRSTPID-IQVYNEGKIIYFGNI--DREXXXXXXXXXXXXXNGNP-PRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD---GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDS 2481
            T++L I D ND+ P+ +  S ++ + E+     L       D D G N   S  L+  +  S       P         F          QL  I GL +++ +   Y +     D G   ++S+ +I + I D NDN P +                         E ++F      + D      I +  A D+DS  N +I + ++    +++ ++ +  H  ++++   LD E   ++   VEAKD G   L +   I + + D NDN P+I+ TS S            +K+ + W  E + +   +  +  SD D G+N                 F +    TP   I+V     ++    I  DRE   ++ V +   D G P    A   V I V D+NDN PKF +        + + ++   G++ G V A+D DFG N ++ Y++ N  H     S   D   G+I   + LD + K    + VEA D+G P LS++  + I      DS
Sbjct:  118 TVQLTIIDMNDNSPIFEPSSVTISVPESSPIGGLFYLPPAKDADLGKNGISSYHLSRIH--SDSGPQACPSYTANDDGYFTLSMTDENTPQLRQISGLDYEKFQNLFYCLHAY--DGGG--LTSALLIAVEIQDVNDNSPQWVGLPYHVHLRECAQQSQQSLWKTSAELRSFLRLSGFAYDTPFRFLIQLA-AIDADSKENGLIKFKVVQRKSDIQASYKVVVHGDKVYIIGQLDYETTPKFSIAVEAKDGG--GLTNVTNIDVTLEDCNDNTPKITVTSLSPLPRENLSDWSYYKLTDIWISEEDGREIKLATITVSDADTGENAAVSCDIEWNNLVCTNPFSLVPLKTPAAAIRVPTVFMLLKRDGIKFDREATSRVQVTIVCADRGRPQANIARQMVDIGVWDINDNAPKFKH-----RGDIGVQENEPDGTVAGYVHASDIDFGRNAALKYSIKNCKHNVSTLSFTIDERTGKISTLRSLDRENKAVYCVTVEAVDEGDPQLSSSVDVNITVLDVNDS 625          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A1L8GVL1 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18021541mg PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.302e-74
Identity = 244/800 (30.50%), Postives = 377/800 (47.12%), Query Frame = 1
Query:  142 FWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVT-SAIDREEI--CQ---PISKCLTGAFLNY------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLY 2454
            F  LFF   ++ S  S K+   V E Q PN  IG+L         S  + K +            G   + VD K GDI+ T ++IDRE +  CQ   P  KC    FL +      ++    ++ + QIEI+DINDN P+F     T+ IPEN      F +P A DRDS   GV  Y L     +      ++ +  +   P L V+G+LDRE   S++  +   DGG         + + I D NDN P++  L Y  E+ E +     VLQ+ A D D  Q +  +I +   + S   + + R+ ++  S   + + G +           VIA D     ++  T + + I+D ND++PVI++    L         I E+   +  V  + V+D D+G+N+  +C +     V       S   +  +KK F L +   L  D E    Y++E++  D+G P +SS+  + + ++D NDN P F          E+  I   +  V A D+DS  N+ + YSI+ D   +  F IN + GQI +N +LDRE ++ Y+F V A D G P+L  +  + I VLD NDN P+ +   Y+F ++E+  R      +G +   D D G+N   +  V   S    IQ    G I+   + DRE        +  +D G+PPR+A   V I VLD NDN P    P   ++ YL  T     G+ V  V+A D D G+N  ++Y++ + N   +LF I S +G++ L+K +  K     RLVV   D+G PS   T  ++
Sbjct:    9 FLWLFFQLPILGS--SSKVAYRVPEEQPPNILIGSLASDY-GYPDSKHLYKLE-----------LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGQKC----FLEFEVSMTDLMSPVPRLLDGQIEILDINDNTPNFNAPVITLSIPENTMVGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGNLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKLAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS---DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVIAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVV--AGDVPFQLKQVSDTGSDSKKKYF-LQTTTSL--DYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDMNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGSNSRLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAADKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSP---VGMVTVIDADKGENAHIQLSVEPDSGEFVIQ-NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSAYVGVTINVLDENDNAPVIVVPSNISYKYL--TPQTHPGTQVNWVRAEDMDTGINAELVYSIASGN-PFELFQISSNNGEVTLEKAIIRKHYGLHRLVVRVNDKGKPSRHGTALVH 773          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 275.404 bits (703), Expect = 5.093e-76
Identity = 254/816 (31.13%), Postives = 393/816 (48.16%), Query Frame = 1
Query:  118 LFGLM-FKMFWQLFFLYTV--VKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPISKCLTGAFLNYIIFA-------DHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSLK--------IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDN-----PPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            L G+M F + W L F   V  + S     LY  V E Q PN+ IG+L    Q    S  +     ++LE       G   + VD K G+I+ T   IDRE +  C+   K     FL + +           ++ E +IE+ DINDN P F     T+ + EN    + F++P A DRD+E+ GV KY L +   +      ++ +      P L V+G+LDRE   S++  + A DGG         + V ITD NDN PQ+    Y  E+SE +     VLQ+ A D D    +G  G+I + I + S   + + ++  I  S   +++ G L   + +     VIA D     +S+ T + +E+ D ND+ P +++    L+        I E+      V  + V+D+D+G N+  +C +       L     S ++N  +KK F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN     PP FE EF     +E+ + G ++  VIA D+DS  N  + YSII D   +  F I+  +G++     LDRE K+RYEF V A D G P+   +  + I VLD NDN P+ + +SYSF ++E+         +G +   D D G+N   +  V        +Q    G I+   + DREK       +  +D G PPR++   V I VLD NDN P  T P  +  ++  ++   A  S+V  V+A D D+G N  ++Y++   N  +  +   SDG+I L K+L  K     RLVV+  D+G PS  A   ++I
Sbjct:   33 LGGVMDFSVGWFLLFALLVDSINSALGGILY-HVREEQPPNTLIGSLAA-DQGLPDSGHL-----YKLE------VGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKP---CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSD----LGPNGEIEYTIHQAS---DPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDN--KKKYFLQTTTP---LDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEF-----AEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSP---VGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ-NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP--SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHI 809          

HSP 2 Score: 132.109 bits (331), Expect = 1.233e-30
Identity = 130/461 (28.20%), Postives = 210/461 (45.55%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIST------SYSFKIVESWEREHKHFYIGKLNASDRDIGQN--------GTFRFRVRSRSTPIDIQVYNEGKIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYF 2466
            +E++D ND+ P       +L ++EN            TD D   N      L+     S  ++++  + N   +K+ QL  +  L  DRE    Y + +   D GTP+  SS ++ + I+D NDN P FE       +SE++ +G+ +  V A DSD  PN  I Y+I      V +   I  + G I +   LDRE    ++F V A+D G    + +  + I V D NDN P +        ++S  +    E       +  +  SD+D G+N        G   F++R      D  V N+ K  YF      +D E++    V +  +D+GNP  ++T ++ ++V D NDN P F+ PL      +   ++   G  V +V A D D G N  ++Y++   + T+ LF I  S G++  +  LD + K      V A D+G PS   T T+ I+  
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEAS--ALFSLQMANDRGEKLPQLIVLGNL--DRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAG---DSSVDNKKK--YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFE----VEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVL 602          

HSP 3 Score: 91.6633 bits (226), Expect = 3.329e-18
Identity = 141/573 (24.61%), Postives = 235/573 (41.01%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH------QIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHG-----NNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLND--TNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS 1851
            NSP+G    ++Q +   +++      +    +++     ++ +++  G I V   +DREEI          +F  ++I  D           + IE+ D NDN P+ +          +    I E++   +  +L    D+D  +  V    +           F+L   G     N    +L+    LD E I+ +   + A D G         + V++TD NDN+P +    +  E +E      KVL + A D D       ++ + I  +S    +    F I  S   +     L    + +    V AAD    S+  T  + IK  D ND+ P   + S S  + EN      V  +TV D D+G N++   S+     NFV         ++NG    +  ++      FDREK S Y+  +   D G P  SS   +TI + DENDN P       + F+   +S  A     + +V A+D D   N  + YSI G     E F I+  +G+I L K L R+    +   V+  D G+P+ +    I ++ + VN+ I  +S
Sbjct:  291 NSPVG--YSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEIS---------SFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP------FQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDAD--SGTNAELVYSIIADSSTRGL----FEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV---------VQNGTGTILSSIS------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR--RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGG-NPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRH---AIALVHIYVNETISNVS 819          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 272.707 bits (696), Expect = 6.093e-76
Identity = 251/807 (31.10%), Postives = 389/807 (48.20%), Query Frame = 1
Query:  133 FKMFWQLFFLYTV--VKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPISK-CLTG---AFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLK--------IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDN-----PPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            F + W L F   V  + S     LY  V E Q PN+ IG+L    Q    S  +     ++LE       G   + VD K G+I+ T   IDRE +  C+   K C      +  + I     ++ E +IE+ DINDN P F     T+ + EN    + F++P A DRD+E+ GV KY L +   +      ++ +      P L V+G+LDRE   S++  + A DGG         + V ITD NDN PQ+    Y  E+SE +     VLQ+ A D D    +G  G+I + I + S   + + ++  I  S   +++ G L   + +     VIA D     +S+ T + +E+ D ND+ P +++    L+        I E+      V  + V+D+D+G N+  +C +       L     S ++N  +KK F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN     PP FE EF     +E+ + G ++  VIA D+DS  N  + YSII D   +  F I+  +G++     LDRE K+RYEF V A D G P+   +  + I VLD NDN P+ + +SYSF ++E+         +G +   D D G+N   +  V        +Q    G I+   + DREK       +  +D G PPR++   V I VLD NDN P  T P  +  ++  ++   A  S+V  V+A D D+G N  ++Y++   N  +  +   SDG+I L K+L  K     RLVV+  D+G PS  A   ++I
Sbjct:    3 FSVGWFLLFALLVDSINSALGGILY-HVREEQPPNTLIGSLAA-DQGLPDSGHL-----YKLE------VGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSD----LGPNGEIEYTIHQAS---DPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDN--KKKYFLQTTTP---LDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEF-----AEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSP---VGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ-NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP--SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHI 773          

HSP 2 Score: 131.724 bits (330), Expect = 1.188e-30
Identity = 130/461 (28.20%), Postives = 210/461 (45.55%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIST------SYSFKIVESWEREHKHFYIGKLNASDRDIGQN--------GTFRFRVRSRSTPIDIQVYNEGKIIYF----GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYF 2466
            +E++D ND+ P       +L ++EN            TD D   N      L+     S  ++++  + N   +K+ QL  +  L  DRE    Y + +   D GTP+  SS ++ + I+D NDN P FE       +SE++ +G+ +  V A DSD  PN  I Y+I      V +   I  + G I +   LDRE    ++F V A+D G    + +  + I V D NDN P +        ++S  +    E       +  +  SD+D G+N        G   F++R      D  V N+ K  YF      +D E++    V +  +D+GNP  ++T ++ ++V D NDN P F+ PL      +   ++   G  V +V A D D G N  ++Y++   + T+ LF I  S G++  +  LD + K      V A D+G PS   T T+ I+  
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEAS--ALFSLQMANDRGEKLPQLIVLGNL--DRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAG---DSSVDNKKK--YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFE----VEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVL 566          

HSP 3 Score: 90.5077 bits (223), Expect = 6.214e-18
Identity = 143/581 (24.61%), Postives = 237/581 (40.79%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH------QIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHG-----NNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLND--TNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS 1851
            S E     NSP+G    ++Q +   +++      +    +++     ++ +++  G I V   +DREEI          +F  ++I  D           + IE+ D NDN P+ +          +    I E++   +  +L    D+D  +  V    +           F+L   G     N    +L+    LD E I+ +   + A D G         + V++TD NDN+P +    +  E +E      KVL + A D D       ++ + I  +S    +    F I  S   +     L    + +    V AAD    S+  T  + IK  D ND+ P   + S S  + EN      V  +TV D D+G N++   S+     NFV         ++NG    +  ++      FDREK S Y+  +   D G P  SS   +TI + DENDN P       + F+   +S  A     + +V A+D D   N  + YSI G     E F I+  +G+I L K L R+    +   V+  D G+P+ +    I ++ + VN+ I  +S
Sbjct:  247 SYEAEVSENSPVG--YSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEIS---------SFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP------FQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDAD--SGTNAELVYSIIADSSTRGL----FEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV---------VQNGTGTILSSIS------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR--RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGG-NPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRH---AIALVHIYVNETISNVS 783          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 268.47 bits (685), Expect = 2.891e-74
Identity = 236/794 (29.72%), Postives = 377/794 (47.48%), Query Frame = 1
Query:  145 WQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSA-IDREEI--CQ------PISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSL--------KIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            W +  LY+   S  S+   L   E Q PN+ +G+L         + + L       + E    Y R    VD K GDI+ T   IDRE +  C+      P       +  + +  +  ++ E +IEI D NDN P F      + IPEN    + +S+PVA D+D+   G+  Y L S S ++     ++ D+ +   P L V+G+LDRE   +++  +   DGG         + + ITD NDN P++    Y  E++E T   + VLQ+ A D D      GQ+ +   + S N + ++ I + T  I        +     K S+       + +S++  + + +KD ND+ P I++    L         + E+      V  + V+D+D+G N+  +C +       L S   S  ++  ++K F   + P    D E+   Y +E++  D+G P +SS+  + + ++D NDN P F         +E+ + G ++  V+A D+DS  N  + YSII D   K  F IN N G++ +   LDRE K+RYEF VEA D G P+L  +  + + VLD NDN P+ +   YSF ++E+         +G +   D D G+N   +  V   +    IQ    G I+   + DREK       +  +D G+PPR++   + I VLD NDN P  T P  +++ +L      +  + V +V A D D GLN  ++Y++T  N    LF I S DG+I L K+   K     RLVV+  D+G PS   T  ++I
Sbjct:   20 WTVLLLYSCGSSLASITYQL--REEQPPNTLVGSL--------AADQGLPDTGHLYKLEVGGPYLR----VDGKTGDIYTTDVPIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDD--LGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASAS--DSTSKRKYFLQTTTP---LDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSP---VGMVTVIDADKGENAHVQLSVEPENGKFVIQ-NGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPL--TSPDTRVEKVDAEDIDTGLNAELVYSITGGN-PHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHI 785          

HSP 2 Score: 133.65 bits (335), Expect = 3.717e-31
Identity = 135/467 (28.91%), Postives = 215/467 (46.04%), Query Frame = 1
Query: 1147 LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSM--YTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS------TSYSFKIVESWEREHKHFYIGKLNASDRDIGQN--------GTFRFRVRSRSTPIDIQVYNEGKIIYFGN----IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            +EI+D ND+ P        L I EN       +     D+D G N      LN  +    D+M  ++  + +   +K+ QL  +  L  DRE+   Y + +   D GTP   SS ++ I I+D NDN P FE       ++E+  +G  +  V A D D   N  +TYS       V+    I+HN G I +   +DRE     +F+V+A+DNG    +    + I V D NDN P I        ++   I    E       +  +  SD+D G+N        G   F++RS S        +  K  YF      +D E++ +  + +  +D+GNP  ++T ++ ++V D+NDN P F+  L      ++  ++   G  V +V ATD D G N  ++Y++   + TK LF I  + G++ +  +LD + K      VEA D+G PSL  T T+ +R     D
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGS----DAMNLFSLQVADNTDEKVPQLIVLGNL--DREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASA-----SDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYE----VDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRND 582          

HSP 3 Score: 85.1149 bits (209), Expect = 2.727e-16
Identity = 127/525 (24.19%), Postives = 212/525 (40.38%), Query Frame = 1
Query:  340 RHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG-EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN--FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFET------EFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGD-----YEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNI 1839
            + L+ +D   G I V  ++DREE+  P+ K    A  N       +   + I + D NDN PS +         ++    + E++   +  +L    D+D  +  V    +         +     D  +    +L+    LD E IK +   + A D G         + V++TD+NDN P +    Y  + +E      KVL + A D D       ++ + I  +S   + +  I   T  +  +N    + +KE     V  A  G        T+ + + D ND+ P   ++  S  + EN      V  +TV D D+G N+    S+   N  FV         ++NG    +  ++      FDREK S Y+  +   D G P  SS   ITI + DENDN P+         +F     S D ++      V A+D D+  N  + YSI G      + +  T     +G+I L K   R+    +   V+  D G+P+ + +  + I V +   N+
Sbjct:  302 QRLLHIDHNTGIIQVKGSVDREEV--PLLKFSVQARDNGPQAKSSKAM-VTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSA-SASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDAD--SGTNAELLYSIITDSAT-KGLFDINPNTGEVRVMN-QLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKFV---------IQNGTGTILSSIS------FDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEK----VDAEDIDTGLNAELVYSITGGNPHGLFRISST-----DGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNETISNV 794          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000016369.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8904389:8910149:1 gene:ENSAMXG00000015901.2 transcript:ENSAMXT00000016369.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 235.728 bits (600), Expect = 1.939e-64
Identity = 213/697 (30.56%), Postives = 338/697 (48.49%), Query Frame = 1
Query:  115 ILFGLMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENY-FELIDHGNNIN-PYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRS---NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL-NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDY--EVKETFGINHN---GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI----STSYSFKIVESWERE-HKHFYIGKLNASDRDIGQNGTFRFRVRSRS--TPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLD 2142
            + F L+  +FW+  F           ++  +V E Q+ ++ +GN+ K +    ++   LK + F++ S    T G  L  V++  G + V   IDREE+C+  S CL    L   +    +I  + +EI+DIND+ P F   EK ++I EN    + F L  A+D DS    V+ Y L        E++  ++ D G +   P+L +   LDRE     + HL A DGG  Q  G   IIV++ DVNDN P +    Y  ++SE       V+Q+NA D D  +   G++ F    +  +   ++R+F +      + +     F++     + I A  +  +    E +I ++I D ND+ P I+V S S+ I EN K    V  I+V+D D G+N + SCS+  D  F          L    QK I+ L +   L  DREK S+Y + +   D G P +SS + IT+F+SD NDN P F     TF + E+   G  +  V A D D   N +I+Y I+ D   E K    +N N   G+I+  K  D E    Y+F + A D+G P+++ +  + + +LD NDN+P I    S++ S + VE   R  +    + K+ A D DIG NG   F ++  S  +   +  Y  G+I    +          +++ V DNGN   +AT TV I++++
Sbjct:    9 VTFRLLL-LFWRGVF----------AQMRYTVLEGQRNDTVVGNIAKDLGIDQRT---LKERGFRIVS----TTGEPLFRVNRNDGVLHVNGKIDREEVCERSSSCLIN--LKIALENPLEIHYITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQLQAARDADSGVNSVQLYKLSQN-----EHFRIDIKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRPQKSGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVNATDAD--EGTNGEVFFSFGHDVDSN--LLRLFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKASAPLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSVPEDIPF---------SLMQSSQKNIYSLTTTSSL--DREKTSQYDITLTAKDAGHPPLSSIKTITVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLDLDENGVISYHIVRDTAEENKHLSFLNINPETGEIYALKRFDFENIKSYQFNIVASDSGTPSMSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEISRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFGLDRYT-GQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVE 664          

HSP 2 Score: 166.777 bits (421), Expect = 7.857e-42
Identity = 159/588 (27.04%), Postives = 275/588 (46.77%), Query Frame = 1
Query:  817 IIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADGEGRSNETTIEL--EIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLN---DTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKI-----LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY------NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLN---AHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN-QNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSN 2496
            I VEI D+ND+ P +     R EISE        QL A    D      Q+ +K+S+N +++ + ++       I +L +   L     +K  I + A DG       T+E+  ++ D ND+ PV    + S+K+ EN      V ++  TD D+G N E   S     D+N +                ++F L+ + G        D E+  +Y +++  +D  +  +++ + I I I D NDN P  E    + +I+E++K G  + ++   D DS  N  ++ S+  D      F +  + Q ++  +     LDRE   +Y+ T+ AKD G P L+    I + V DVNDN PE S + Y+F + E+       F +   +A D D+ +NG   + +   +   +  +         G+I      D E +      +   D+G P  ++  TV++ +LD NDN P   YP+ +   A     I+ ++ AG +V +V+A D D G NG ++++L    +H+  LF + +  GQI   +      +   +LV+  +D G  SLSAT T+ I+  +P+++F  S+
Sbjct:  113 ITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQLQAARDADSGVNSVQL-YKLSQN-EHFRIDIKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRPQKSGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVNATDADEGTNGEVFFSFGHDVDSNLL----------------RLFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKASAPLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSVPEDIP----FSLMQSSQKNIYSLTTTSSLDREKTSQYDITLTAKDAGHPPLSSIKTITVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSV---SAHDLDLDENGVISYHIVRDTAEENKHLSFLNINPETGEIYALKRFDFENIKSYQFNIVASDSGTPSMSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEISRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHS--LFGLDRYTGQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVEPKEAFAASD 673          

HSP 3 Score: 53.1434 bits (126), Expect = 1.844e-6
Identity = 61/215 (28.37%), Postives = 105/215 (48.84%), Query Frame = 1
Query: 1678 FGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRII---VLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRV-RSRSTPIDIQVYNE-GKIIYF---GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            F +N N G +H+N  +DRE  +  E +     N +  L +  +I  I   ++D+ND+ P        K +E  E            A D D G N    +++ ++    IDI+   E GKI +      +DRE   K  + +  +D G P ++ T  + ++V+DVNDN P FT    +A++ + ++++   G+ V +V ATD D G NG + ++ 
Sbjct:   69 FRVNRNDGVLHVNGKIDRE--EVCERSSSCLINLKIALENPLEIHYITVEIVDINDHAPIFPEKE--KRLEISENAVAGARFQLQAARDADSGVNSVQLYKLSQNEHFRIDIKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRPQKSGTMEIIVDVIDVNDNVPVFTK---DAYS-VKLSENAPIGTAVIQVNATDADEGTNGEVFFSF 275          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000035285.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8923404:8955697:1 gene:ENSAMXG00000041384.1 transcript:ENSAMXT00000035285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.024 bits (580), Expect = 1.567e-61
Identity = 217/695 (31.22%), Postives = 338/695 (48.63%), Query Frame = 1
Query:  124 GLMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENY-FELIDHGNNIN-PYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISEN-SQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETT---IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL-NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGD--YEVKETFGINHN---GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI----STSYSFKIVESWERE-HKHFYIGKLNASDRDIGQNGTFRFRVRSRS--TPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLD 2142
            GL+F +FW+  F           ++  SV E Q+  + +GN+ K +    ++   LK + F++ S    T G  L  V++  G + V   IDREE+C+  S CL    L   +    +I  + +EI+DIND+ P F   EK ++I EN      F L  A+D DS    V+ Y L        E++  E+ D G +   P+L +   LDRE     +  L A DGG  Q  G   IIV++ D+NDN P +    Y  ++SE      KV+Q+NA D D+     G++ +   ++ ++N   +  +  +T  I+   +     F++     + I A  +  +  TT   I ++I D ND+ P I+V S S+ + EN  S   V  I+V+D D G+N + SCS+  D  F  L S          Q+ I+ L +   L  DREK S+Y +  I  D G P +SS + +T+F+SD NDN P F     TF + E+   G  +  V A D D   N II+Y I  D   E K +  +N N   G I+  K  D E    Y+F + A D+G P+L+ +  + + +LD NDN+P I    S++ S + VE   R  +    + K+ A D DIG NG   F ++  S  +   +  Y  G+I    +          +++ V DNGN   +AT TV I++++
Sbjct:   17 GLLF-LFWRGVF----------AQIRYSVLEEQRNGTVVGNIAKDLGIDQRT---LKERGFRIVS----TTGETLFRVNRNDGVLHVNGKIDREEVCERSSSCLIN--LKIALENPLEIHYVTVEIVDINDHPPIFSEKEKRLEISENAIAGVRFQLQGARDADSGVNSVQMYKLSQN-----EHFRIEVRDRGEDGKMPFLILQKSLDRETCARHKLLLTALDGGRPQKSGTMEIIVDVIDINDNAPVFTKDTYSAKLSENAPIGTKVIQVNATDLDNGPN--GEVFYIFGQDVNRNLRRVFDLDPVTGEIV---VKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEVTSLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPEDIPFSLLQS---------SQENIYSLVTKSSL--DREKTSQYDITFIAKDAGHPPLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLDLDENAIISYHIWRDPAQENKHSSFLNINPETGAIYALKSFDFESTKSYQFYIVASDSGTPSLSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFGLDRYT-GQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVE 669          

HSP 2 Score: 152.91 bits (385), Expect = 2.183e-37
Identity = 156/590 (26.44%), Postives = 269/590 (45.59%), Query Frame = 1
Query:  817 IIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADGEGRSNETTIEL--EIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE-FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKI-----LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRV-------RSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLN---AHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN-QNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENS 2505
            + VEI D+ND+ P +     R EISE        QL      D      Q+ +K+S+N +++ + VR       + +L +  +L      +  +++ A DG       T+E+  ++ D ND+ PV    + S K+ EN      V ++  TD D G N E F     D N                 +++F L+ + G        D E+  +Y +++  +D     +++ +II I I D NDN P  E    + ++ E++  G  + ++   D DS  N  ++ S+  D      F +  + Q ++  +     LDRE   +Y+ T  AKD G P L+    + + V DVNDN PE S + Y+F + E+       F +   +A D D+ +N    + +          S+ ++I     G I    + D E        +   D+G P  ++  TV++ +LD NDN P   YP+ +   A     I  ++ AG +V +V+A D D G NG ++++L    +H+  LF + +  GQI   +      +   +LV+  +D G  SLSAT T+ I+  +P+++F  S+  S
Sbjct:  118 VTVEIVDINDHPPIFSEKEKRLEISENAIAGVRFQLQGARDADSGVNSVQM-YKLSQN-EHFRIEVRDRGEDGKMPFLILQKSLDRETCARHKLLLTALDGGRPQKSGTMEIIVDVIDINDNAPVFTKDTYSAKLSENAPIGTKVIQVNATDLDNGPNGEVFYIFGQDVN--------------RNLRRVFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEVTSLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPEDIP----FSLLQSSQENIYSLVTKSSLDREKTSQYDITFIAKDAGHPPLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSV---SAHDLDLDENAIISYHIWRDPAQENKHSSFLNINP-ETGAIYALKSFDFESTKSYQFYIVASDSGTPSLSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHS--LFGLDRYTGQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVEPKEAFAASDVKS 681          

HSP 3 Score: 56.6102 bits (135), Expect = 1.633e-7
Identity = 62/221 (28.05%), Postives = 101/221 (45.70%), Query Frame = 1
Query: 1678 FGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRII---VLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIG----------QNGTFRFRVRSRSTPIDIQVYNEGKIIYF---GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIY 2289
            F +N N G +H+N  +DRE  +  E +     N +  L +  +I  +   ++D+ND+ P  S     K +E  E            A D D G          QN  FR  VR R          +GK+ +     ++DRE   +  +L+  +D G P ++ T  + ++V+D+NDN P FT    +A     ++++   G+ V +V ATD D G NG + Y
Sbjct:   74 FRVNRNDGVLHVNGKIDRE--EVCERSSSCLINLKIALENPLEIHYVTVEIVDINDHPPIFSEKE--KRLEISENAIAGVRFQLQGARDADSGVNSVQMYKLSQNEHFRIEVRDRG--------EDGKMPFLILQKSLDRETCARHKLLLTALDGGRPQKSGTMEIIVDVIDINDNAPVFTKDTYSA----KLSENAPIGTKVIQVNATDLDNGPNGEVFY 278          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.216 bits (513), Expect = 1.378e-53
Identity = 213/754 (28.25%), Postives = 331/754 (43.90%), Query Frame = 1
Query:  346 LISVDQKKGDIWVTSAIDREEIC--QPISKCLTGAFLNYIIFA---------DHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXE-NYFELIDHGNNI---------------NPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRK-EISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGE--GRSNETTIELEIKDCNDHRPVIKVHS--------SSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF------ETEFKTFSIS--EDAKIGHEIGIVIAKDSDSSPNNIITYSI---IGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESW---EREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE---GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVG-EVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQG 2421
            L  V++  G++ V   +DRE +C  +P   C +  F++ +  A         + ++ ++Q+ + DIND+ P+F+     + I E+ A      LP A D D+    ++ Y + + S    +   F L++  ++                   L +   LDRE + S+E  L+  DGG  +  G   + + + D NDN P +V  P R   I+E       V+QL A D D          F     S   +  + +   T  +   N   L         +VV+A DG    RS   T+ +E+ D ND+ PV +V +          +KI EN  S   V  I+V+D D G +      L       L     SP      K  F L +      D E+A +Y+V V+  D GTP +S    + I + D NDN P F      E +   + +S  E+   G  +  ++A D+DS PN  IT+++    G   V E F +N   GQ+ L   LDRE + RYE +VEA D G P       +R+ VLD NDN P  +  S S   +  +   E      Y+G ++ SD D G N      +   + P  I    +   G +     +DRE   + ++ V  +D+G P  +A+  V I V D NDN P  T P  N   + ++     AG +VG  V A D D G NG  +Y +   N  K +F + +D G + L + + +  +   RLVV  RD+G
Sbjct:   73 LCIVNELSGELSVALRLDREALCMEEP-DACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAEL----ASP-----NKVQFLLKTT--RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTN-DTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGN-PKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 117.087 bits (292), Expect = 8.881e-27
Identity = 135/507 (26.63%), Postives = 213/507 (42.01%), Query Frame = 1
Query: 1096 VVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINS----EFSCSLNDTNFVSLDSMYTSPLENG------------GQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF-ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKI-----LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIP---------EISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGN----IDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLL----NAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLT---NQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            V   A G+G SN     ++L ++D NDH P  +    ++ I E+E     V      D D G NS      S +  D   +   S+  S  ++             G + + +L        DRE    Y + +   D G P +S S ++TI + D NDN P F +   +   I+E +K+G  +  + A D D+ PN  I YS         T    H +G   L  +     LDRE    +   V A+D G+ + + S  + + + D NDN P         E       KIVE+         I   + SD D+G +GT   R+     P   ++ +  K+ +       +D E+  + +V V   D G P  +    + I V+D+NDN P F  P       A   +++ ++  AG++V  + ATD D G NG+I + L+         +LFS+    GQ+ L   LD + +    L VEA D G+P   A   + +      D
Sbjct:  113 VAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELRE----QLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLI---SVSDPDLGSSGTVDVRLE---FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDEND 609          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 187.963 bits (476), Expect = 6.480e-49
Identity = 195/721 (27.05%), Postives = 313/721 (43.41%), Query Frame = 1
Query:  301 SFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEIC---QPISKCLTGAFLNYIIFADHQIF---ELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFEL----IDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV---RIFYITESILYLNIGALKSFKENKASIVVIAADGEG---------------RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSI--PGLY-------FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI 2331
            ++++   K+      L+ V+ + G+++     +DRE +C    P  +C     +  +       F   E++I + DINDN P+F     T+ +PEN      F +  A D DSE  GV++Y L     +   + FEL      +G  + PYL V   LDRE  + +E +L A DGG   + G   + + +TD NDN+P +       EI E       V+QL+A D+D       ++ +++  ++          R+F + ++   + +  L + +E+    ++I A  +G                 N+ +  +EI+D      ++   +  + I E     + V  ITV+D D G N   +C + +                      FQL  +  P  Y        D E  + Y V++   D G  ++S +  +TI + D NDN P F       S+ E+  IG  +  V A D D   N  + Y +  D      F ++   G I L + LDRE K  Y FT+ AKD G P L  +  + + VLDVNDN P  S + + F + E+     KH  +G +  +D D G+NG  R  +          +  E  +I      DRE+     + V   D G P R++T  V I V+D+NDN P    P  N   Y  +      G+IV EV A D D  +N  + Y++   N   +LF I
Sbjct:   70 TYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATV-SAFELSVTETANGEKV-PYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSN--AEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD------IVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVP------------------FQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPD--APTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVP---KHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNT-TYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGN-PHNLFHI 755          

HSP 2 Score: 83.9593 bits (206), Expect = 1.205e-16
Identity = 108/478 (22.59%), Postives = 190/478 (39.75%), Query Frame = 1
Query: 1141 IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI-------IGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNG----------------EPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY---NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPD-RLVVEARDQGTPSLSATTTLYIRYFKPRDSFDR 2490
            + + ++D ND+ P       ++ + EN  +          D D   N      L  ++  ++ +   S  E    +K+  L     L  DRE+   Y + +   D G+P  S S ++ I ++D NDN P F+       I E++ +G  +  + A D D+  N  + Y +             K  F ++ N G + +N +L+RE    Y   + A D G                  + + + +IR IV  VN             ++   E  H +  +  +  SD DIG NG     + +   P  ++     N+  +     +D E  ++  V +   D G    + T +V I++LD NDN P FT P       +++ ++   G  +  V ATD D   N  ++Y L     T  +F +  +  II   +   + K  +    + A+DQG P L    T+ +      D+  R
Sbjct:  139 VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSL--DREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVN------------GVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYK----VSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPT--MFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPR 596          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 9.721e-44
Identity = 204/768 (26.56%), Postives = 324/768 (42.19%), Query Frame = 1
Query:  340 RHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQ---------IFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISE--------CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV-----RIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQK-KIFQLNSIPGLY-FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKET-FGIN-HNGQIHLNKILDREVKDR------YEFTVEAKDNGEPN-LNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRY---------FKPRDSFDRSNEN 2502
            R +  +D   G +    ++DREE+ +            Y +    Q           ++ + + D+NDN P F P +    I EN    +  +   A D D    G  +Y L +  ++     F++    N +   +     LDRE    ++  + A DGG  + +   IV IT  D  D  P +    Y   + E         +  A  L LNA            + + I    Q     +     RIF            A+   ++    + V+A  G G + E ++ + + D N+H PV    S  + I E+E        +  TD+D G N E    + +               NGG+K  IF    +   Y  DRE    YS+ V   D G   +SSS  + + + D NDN P F +    F   E+ ++G  +G V A D+D+  N  +TYS    +E  +  F ++   G+I   ++ DRE   R      + F+V A D G P  L D   +++ V DVNDN P+ + S Y   + ES     +     ++ ASD D G NG  R+ +   +      V  + G+I   G++DRE+     ++V   D+G  P  A+ TV ++VLD NDN P+FT  LL+    ++  +    G ++  + A+DED G +G + Y +   N T   F+I +S G + L ++LD + +   RL V A D G P  S+ T L +           F P D F    EN
Sbjct:  494 REMFRLDSLTGKVTTLKSLDREELEE------------YPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR----FQV----NAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNA-----------NVTYLIVSGDQRGSFSIEWSGGRIF---------TANAIDREEQAFYQLRVVANSG-GVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEG--------------NGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYS----FEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLL---RVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLS----VDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGN-THATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMEN 1194          

HSP 2 Score: 171.014 bits (432), Expect = 3.533e-43
Identity = 194/739 (26.25%), Postives = 320/739 (43.30%), Query Frame = 1
Query:  250 IKLIQNQT---KSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDI------WVTSAIDREEICQPI--SKCLT-------GAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE------CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIA--ADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNG---TPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKET--------FGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIST-SYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE-GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQ 2346
            I L+Q QT    S+ +        E E    +   L+ V +  G I      W  S  D    C  I  S  L+       G+F+   + + +Q+   +I + D+NDN P F   E  +++ EN           A D D  +  +  Y + S S    E  F ++D  + +   LR    LDRE   S+   + ASDG  +    R+ V + D NDN+P++    Y  +++E       TT A +  + A D D      G++ + ++  S++ +     F +      LN+      +E++A  V+ A   DG G +    + + + D ND+ P ++  S + ++ E+      + RI+ TD+D+G+N+E   S++     S D      + N GQ  + +         DRE+ S Y++ V  +D        +SS+  +++ ++D NDN P F T  ++    ED+ +G  +  V A D DS  N+ + Y++  D E            F +N   G++ L + LDRE +  Y  TV A D G P L  +  + + V D NDN P      Y   I E    E     + +L+A D D G NG  R+ + S     D ++    G +     +DRE+    ++ V   D G P R+ T +V + + DVND  P F       H   N         ++ +V A D+D G +G + Y     N     FS+  DG 
Sbjct: 1409 INLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVS-FDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQV---EISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGS----EGAF-VVDAASGV---LRASRRLDREERASYLLTVRASDGT-HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPF--GEVTYALAP-SEDSDWADGAFGLHPVTGALNV-TRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSIS-----SGDPEGRFAVGNDGQLSVARA-------LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAED---EPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENT---QGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGG-AFSVSPDGH 2110          

HSP 3 Score: 159.844 bits (403), Expect = 1.213e-39
Identity = 167/658 (25.38%), Postives = 284/658 (43.16%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSF-QPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELI---DHGNNINP---------YLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKV-----HSSSLKIKENEKSKILVTRITVTDEDQ-GINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS--IPGLY-------FDREKASRYSVEVICNDNGTPTM-SSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-----GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE--------GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTK 2316
            E+++ + D+NDN PSF +P    +   E+ A   +  L  A DRD    GV              + ++++   + G  + P         +L   G LDRE   S+   + A DGG  +  G+ ++ V + D NDN P +    YR  ++E +     L+        P  +    +  +    Q  +   R  Y                     ++ + AADG     S   T  +++ D ND+ P I+       + S  + E+     +   +TVTD D    N E S S                +  G ++  F L++  +PGL         DRE+   Y++ ++ +DNG P   S++  + ++++D ND+ P F       ++SE A  G  +  V A D+DS  N  + YSI+     G + V E+ G+     +  +  +DREV       + A+D G         + + +LDVND  P  + T Y   +  + E      ++  ++A+D D+G+NGT R+       P     Y E        GK+    ++DRE++++  ++V   D G+PP  +T  V + V D+NDN P F YP+     + +I ++   G+ V  V ATD D G NG++ Y LT  +  +
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVN------------HHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQY---------------------TLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVS----------------IVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGL-----VTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKY---VATAVENSLPGLFVVSVSAADSDLGENGTVRYNF----DPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPV---QYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR 600          

HSP 4 Score: 157.532 bits (397), Expect = 5.917e-39
Identity = 172/681 (25.26%), Postives = 281/681 (41.26%), Query Frame = 1
Query:  340 RHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQ--IFELQIEII--DINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPY-------LRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR----SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTP-----IDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPP----RTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN 2301
            R   S++   G I+  +AIDREE           AF    + A+      E  + ++  D+N++ P F      + I E+   +S F    A D+DS K G              E  +E I  GN    +       L V  +LDRE  + +   + A D G       + V +T  DVNDN P +    Y     E   E   L    Q  D      G + +   +   N+E+      I    ++     ++       S  V+A DG GR     +  T+++ ++D ND+ P          + E+  +   + R+T +D D+G+N     ++N+ N       +T     G   +I  L S+     DRE+ + Y++ V   D+GT  +++S  + + + DENDNPP F     +    E  ++G  +  + A D D+ P+  + Y+I+       TF I+ + G + L + LD E +  Y   V A+D G P  + +  + + V D NDN P       F  +   E       +  + A D D   NG   + +  +  P     ID +    G+I     IDRE    +  +     +   P    R+A   V + V D NDN P+F  P     + L      AAGS+VG ++A+D D   N ++ Y +T 
Sbjct:  701 RGSFSIEWSGGRIFTANAIDREE----------QAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNG--------------EVKYE-IGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCE-EQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDG-GRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGN---EGGKFTVDASTG---QITLLGSL-----DREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAG-NTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASI--MENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPE---SGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLR----AAAGSVVGTLQASDPDEAENAAVRYAVTG 1333          

HSP 5 Score: 153.295 bits (386), Expect = 1.176e-37
Identity = 199/754 (26.39%), Postives = 316/754 (41.91%), Query Frame = 1
Query:  352 SVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFE-------LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLP-------VAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG----GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDP-QTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKA--SIVVIAADG---EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNG--TFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXX------XXXNGNP-PRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMN 2511
            SVD+  G +     +DRE          +   LN  I A  Q  +       L + ++D+ND  P F   +        VA + E SLP        A D D  + G  +Y       + Y   F L    +++   +  +  LDRE ++ +   + A D G    G+  K  ++V   D+NDN P +  + Y   I E   E     +      DP +   G +R++++        +  +     + + L+       +E +A   + V A DG     RS    + + + D  D  P       S  + EN     LV  ++ +  D   N  +         VS D   +  +E  G  +IF  N+I     DRE+ + Y + V+ N  G    +S   +++ + D N++ P F+      SI+ED  +      V A D DS  N  + Y I G+    E FGI  +GQ+++   LDRE ++ Y  TV A D G   L+ S  + + VLDVNDN P   S+SY F   E  E       +G + A+D D G NG  T+ F     +  +D +    G+I      DRE + +              D G P P     TV + V DVNDN P+F   +  A    ++++  +  + +  V A+D D G+NG++ Y +   N         S GQI L   LD +      LVV A D GT  L+A+ T+ ++     D+  R  E+ ++
Sbjct:  390 SVDESTGLVTTDGKVDRE--------VASSVVLN--ISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKY-------VATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRL----DSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVV--GDLNDNHPVFYPVQYFASILE--NEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLD-------REERAVYQLQVTALDGGHLRARS-PAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYL-------IVSGDQRGSFSIEWSG-GRIFTANAI-----DREEQAFYQLRVVANSGGVAGEAS---VSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEI-GEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGS---LVGAVQATDADAGSNGGVTYSFEKPQVNFELDSET---GRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQA----SVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLS 1083          

HSP 6 Score: 147.902 bits (372), Expect = 5.646e-36
Identity = 175/657 (26.64%), Postives = 282/657 (42.92%), Query Frame = 1
Query:  376 IWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIG--GQIRFKISEN-SQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD-GEGRSNETT-IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-GDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYL-NITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            + V S +DRE I  P+      A  N    A      L + + D+ND+ P F        + E     S      A D DS   G+      SI S     +F  +D    +   +   G +DRE   S   ++ A D G         + V + DVND  P +    Y     E +     V+ ++A D D    +G  G +R+    +    Y  + R+  +T  +  L   +L   +  +  +VV A D G      T  + + + D ND+ PV         I ENE     VT +T TD D+G N      L                   G    FQ+N++ G     +  DRE+ + Y ++V   D G     S  I+TI ++D  D PP F  +  +F + E+   G  +G V A   D + N  +TY I+ GD   + +F I    G+I     +DRE +  Y+  V A   G   +     + ++V DVN++ P     SY   I E      + F +    A+D+D G+NG  ++ +   +      ++ +G++     +DRE  ++  + V  +D G  P +++ TV++ VLDVNDN+     PL N+ +Y+ +  ++   GS+VG V+ATD D G NG + Y+ 
Sbjct:  292 LKVASQLDRERI--PMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADS---GLNAKLRYSIVSGNDLGWFS-VDESTGL---VTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSD----LGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLK--SLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL-----------------TAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN--VTYLIVSGDQ--RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSV---RATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNK-----PLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF 901          

HSP 7 Score: 137.502 bits (345), Expect = 7.057e-33
Identity = 158/646 (24.46%), Postives = 254/646 (39.32%), Query Frame = 1
Query:  184 FSV-KLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPV-----AKDRDSEKYG-VXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR------SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-----GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDRE 2049
            F+V ++ L VEEN      I  L     +Q ++   L T S    SE +         VD   G +  +  +DREE     S  LT    +     D +   L + + D NDN P F     +  + E+ A   + +  V     A D DS  +G V      S  S   +  F L    + +   L V   LDRE+   +     A+DGGG     R+ V + D NDN P         E+ E       +L+++A D D  + +  ++ F IS            F +          AL   +++  ++VV  +D   R      S+   + L + D ND+ P      S+L  +++    ++ T +   D D G NS    +L                        F LN++ G        DRE    Y++ V+  D G P ++S+  + + + D NDN P F       +I+ED   G E+  + A D D   N  + Y I      GD+ +    G      + + + LDRE    YE  V A+D G P  +D+  +R+ + DVND  P    S  + +      +     I ++ A D D+G +G   +     +      V  +G +    ++DRE
Sbjct: 1516 FAVPEMELEVEENTGEGEVIFTLSATDADQGQNA--LVTYSVLSGSEGA-------FVVDAASGVLRASRRLDREERA---SYLLTVRASDGTHATDAR---LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGL----HPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDD--EGVNAELEFSISSGDPEGR-----FAVGNDGQLSVARALDRERQSFYNLVVRVSD-RARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVAT-VQAVDPDSGRNSYVEYALATDGEEGGGGAGAG-------PGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGT-----LAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLS-PYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDRE 2120          

HSP 8 Score: 133.265 bits (334), Expect = 1.605e-31
Identity = 171/676 (25.30%), Postives = 283/676 (41.86%), Query Frame = 1
Query:  493 IEIIDINDNFPSFQ-----PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG---GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVV-IAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIST-SYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            I+++D+NDN P+ +     P  ++  + E+ A  +  +L    D DS           SI       +F L   G      L+V   LDRE I  +   + ASD G          ++V + DVND+ P++    Y   +SE       V  + A D D    +  ++R+ I S N   +      F + ES   +     K  +E  +S+V+ I+A  +G   ++  T++ + + D ND  P+           EN    + V  ++  D D G N     + +      + + Y         +++F+L+S+ G        DRE+   Y + V   D G+P + S+  +T+ + D NDN P F       SI E+   G  +  V A D D   N  + Y +      +  F +N   G +     LDRE +  Y+  V A D G         + I V D  D  P  +   YSF +   +E       +G ++AS  D+  N T+      +     I+ ++ G+I     IDRE+     + V     G        +V + V DVN++ P F      A   ++I +D    S    V+ATD+D G NG + Y +   N  +  F I  DGQ+ ++ +LD + +    L V A D G   LS++ T+ +
Sbjct:  213 IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPT--ANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDAD--SGLNAKLRYSIVSGNDLGW------FSVDESTGLVTTDG-KVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDP----DMPAQY---------REMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVV---FENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIE-WSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFD----RASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK-FGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNV 850          

HSP 9 Score: 131.339 bits (329), Expect = 6.349e-31
Identity = 131/513 (25.54%), Postives = 230/513 (44.83%), Query Frame = 1
Query:  997 NYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHE-----IGIVIAKDSDSSPNNIITYSIIGDYE---VKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNG-NPPRTATTTVHIEVL--DVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN--------QNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++++  R  +I  S L      L S ++N A   +        S+   +E+ ++D ND+ PV  V    L+++EN     ++  ++ TD DQG N+  + S+                   G +  F +++  G+       DRE+ + Y + V  +D    T ++   +++ + D NDN P F     +F ++EDA    +     IG V+A D+DS P   +TY++    +       FG++   G +++ + LDRE +  Y     A D G   L  + ++ + VLD NDN P +         E  E       + +++A+D D G N    F + S        V N+G++     +DRE+    +++V V D   +PP   ++ V + ++  DVNDN P FT P           +D   G++V  V+A D D G N  + Y L                 F++ +  G++ L ++LD + +    L V A D+G P L++T TL +
Sbjct: 1464 SFDLTARCMFIVFSSL------LSSLRDNGAGSFIRPP----MSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLS-----------------GSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDS--LAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-----RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAV 1937          

HSP 10 Score: 129.413 bits (324), Expect = 2.641e-30
Identity = 136/575 (23.65%), Postives = 244/575 (42.43%), Query Frame = 1
Query:  814 RIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVL-QLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKAS--IVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKEN-----EKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGE---PNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE----------GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            ++ + + DVNDN P +       E+ E T E +V+  L+A D D  Q     + + +   S+   ++     +  +   L+       +E +AS  + V A+DG   + +  + + ++D ND+ P    H+ S  + E+     + ++ ++  +   D D G   E + +L  +     DS +            F L+ + G        DRE  + Y +     D G   ++++  + + + D NDN P  + +     + EDA  G  +  + A D D   N  + +SI  GD E +  F + ++GQ+ + + LDRE +  Y   V   D        L+ + ++ +I+ DVNDN P  ++  S     + E       +  + A D D G+N    + + +                      G++     +DRE      + V  +D G PP T+T T+ + V D NDN P+F      A     I +D   G+ V  + A D D G NG + Y++ + + T D       G + + + LD +      L V ARD G P+ S T ++ +
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQN--ALVTYSVLSGSEGAFVVDAASGVLRASRRLD-------REERASYLLTVRASDGT-HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSE----DSDWA--------DGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR--FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS---ALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAA----IAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRV 2042          

HSP 11 Score: 128.257 bits (321), Expect = 5.076e-30
Identity = 150/586 (25.60%), Postives = 243/586 (41.47%), Query Frame = 1
Query:  370 GDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENI------KSFEFHLYASDGGGN---QGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTE-AKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRS---NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYF-----DREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDR-YEFTVEAKDNGEPNLNDSCKIR---IIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGN-IDRE 2049
            G ++V   +DRE   +     LT + ++  +        + + ++D+NDN P F          E     S      A D D+   G       + S    +  FEL      I   LRV    DRE +       SF F + A+DGG     Q +  + V + DVNDN PQ+    Y+  +SE  +   ++L++ A D D  + + G +R+ I+E ++  +     F +  S   + +      +E  +  +V++A   G S      T+ +++ D ND+ P  +   S L +   E +++  L+  +T +DED G + +   ++                  G     F ++   G  F     D E    Y + V   D G P  SS+ I+ + + D NDNPP F       SI E+  IG  +  V A+D D+  N  + YSI   +     F I+  +G+I     +DREV    +E TV A D   P       ++   ++V D NDN P   T  +  I+    R      +G L ASD D  +N   R+ V      I  ++     II     +DRE
Sbjct:  812 GQLYVRYELDRETREE---YSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNG-----GVTYSFEKPQVNFELDSETGRIA-SLRV---FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD--EGVNGALRYAINEGNEGGK-----FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPP--RFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI----------------VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA--ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 12 Score: 126.331 bits (316), Expect = 1.890e-29
Identity = 136/552 (24.64%), Postives = 241/552 (43.66%), Query Frame = 1
Query:  739 LDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP--QWVGLP---YRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGE---GRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL---NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDY--EVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDG 2343
            LD E  + +   L A+DGG     G+   ++++ DVNDN P  ++V LP       + E      V  L      D  T  G++   I   ++    ++    +    +      L   +    ++ ++A+D      RS   ++ + + D NDH P   + + +  + E   +   V  +T  D D G+N++   S+   ND  + S+D   T  +   G+              DRE AS   + +   D G    ++   +T+ + D ND PP F       +  E++  G  +  V A DSD   N  + Y+   D   + +E F ++   G++   K LDRE  + Y   V+A+D G P L  + K+ ++V D+NDN P       F  +   E E     +  + A+D D G NGT R+++ +       QV    G +    ++DRE+     + V  +D G+    +   V I V D  D  P F     + ++++ + +++A G++VG V A+  D  LN ++ Y + + +  +  FSI+  G
Sbjct:  183 LDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDES-TGLVTTDGK-------------VDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASI--LENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDA-ARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFAR---DDYSFV-VFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQ-RGSFSIEWSG 710          

HSP 13 Score: 107.071 bits (266), Expect = 1.805e-23
Identity = 143/578 (24.74%), Postives = 238/578 (41.18%), Query Frame = 1
Query:  808 KCRIIVEITDVNDNTPQWVGLPYRKEIS---ECTTEAKVLQLNAQDKD-DPQTIGGQIRFKISENSQNYEMIVRIFYITESILYL-NIGALKSFKENKASIVVIAADGEG--RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPP-----HFETEFKTFSISEDAKIGHEIGIVIAKDSDS-SPNNIITYSIIGDYE----VKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEP-NLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY----NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFT---YPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQ--NHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            + R++V   DVNDN P +   P   E++   +     +VL   A D+D  P  +     +KI   ++   ++        + L+L   G L        ++ V A DG    R     + + ++D ND+ P  +  +    + E+                    S    +L D     L      PL      K   +++   L F+  +  +Y++ +   D G P +S      I + D NDN P     +     ++ S+ E A  G    +V   D+DS + N  ++ SI+G  E    V    G+     + +   LDRE    Y  T+ A DNG+P   + +  + + V DVND+ P  + S         E      Y+  + A D D G N   R+ + S +   D+  +    + G +   G +DRE    + + +   D G  P+TA T++ + +LDVND  P FT   Y      N L        G  V  V A D D G NG++ YN         +++F + S  G++   K LD +      LVV+A+D+G+P L +T  + +
Sbjct:    8 EVRVVV--GDVNDNAPSFPE-PGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHA-YKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAED--------------------SPVGAALRD-----LLHRGRGPLAVPFDPKTGMVSTRQPLDFEARR--QYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAA--ALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGN---DLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSL-------PGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTV 542          

HSP 14 Score: 93.9745 bits (232), Expect = 1.382e-19
Identity = 120/506 (23.72%), Postives = 197/506 (38.93%), Query Frame = 1
Query:  328 NTYGRHLISVDQKKGDIWVTSAIDRE-EICQPI-SKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN-----QGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI--GALKSFKE------NKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGI--VIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKD 1770
              +G H ++     G + VT  +DRE   C  + ++   G  L            L + ++D NDN PS Q D    ++PE+    +      A D D    GV      SISS   E  F + + G      L V   LDRE    +   +  SD   +         R+ + +TDVNDN P +          +    A V  + A D D      G+  +     + + E              LN   G ++  +E         ++ V+A D +GR   ++  T+ + + D ND+ P          I E+E     V R++  D D+G N E    +                 +G     F+L+ + G        DRE+ + Y + V   D G P  S +  + + +SD ND  P F+    T    E+ + G  + I  V+A+D D   +  +TY+          F ++ +G +HL + LDRE + ++   + A D
Sbjct: 1672 GAFGLHPVT-----GALNVTRPLDRESRACYVLRARATDGGGL-------AATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDE---GVNAELEFSISSGDPEGRFAVGNDGQ-----LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDS-----GRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVD-KGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI----------------ASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQ-GPPVLILQVVARDDDLGSSGQVTYAAA-GGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 8.061e-41
Identity = 167/577 (28.94%), Postives = 270/577 (46.79%), Query Frame = 1
Query:  775 LYASDGGGNQ-GKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKEN-KASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDS--CKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFG-NIDREX------XXXXXXXXXXXXNGNPPRTATTTVHIEVL--DVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            L+A++  G   G  R+ + + + NDN P +    Y   + E  T    V+Q+ A D D    + GQ+ +  S++S         F +  +   +++ A   F+   + ++ V+A DG G+     + + + D ND+ PV +  S     +EN+ S   V R+  TDED   N++ + S+  T   S  S Y S   +GG   +    +   L +++      S+ ++  D G+P ++S+    + + DENDN P F+    + +I E+   G  +  V A D D SP      S+I   E    F IN  +G I    +LDRE   +Y   V A D G+ N   +    + I +LDVNDN P      Y+  IVE+       F +   +A+D D+ +NGT  + +   +    I   + GKI   G  +DRE            ++V   D G+PPR AT +  + VL  DVNDN P F    +     L + + + A S + +V ATD D G NG++ Y++T      D     + G I    +LD +     +L + A D+GTP+LS+TTTL +
Sbjct:    1 LFANETSGEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLD--AGVFGQVSYHFSDDSDK-------FSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPT---SAYSSYFSITVSGGYGVVTLARA---LDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSP-EYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTV---SAADPDLNENGTLVYAIDPPNPFYRINAAS-GKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSF----VGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSL 553          

HSP 2 Score: 155.992 bits (393), Expect = 1.954e-38
Identity = 201/756 (26.59%), Postives = 321/756 (42.46%), Query Frame = 1
Query:  217 NQKPNSPIGNL----IKLIQNQTKSTEILKTKSFQLESEKSNTYGRHL------ISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFAD----HQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSL-PVAKDR--DSEKYGVXXXXXXXXXXXXXENYFEL-IDHGNNINPYLRVIGDLDRENIK--SFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKD-DPQTIGGQIRFKIS-ENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG----EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTN-FVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREK------ASRYSVEVICNDNGTPT--MSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG-----DYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYS-FKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNG--NPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDG 2343
            N+  N PI +L    + + +N T  T +++  +  L++        H        S+D   G I V +A+D E          T  F   ++  D         ++I ++D+NDN P FQ D          AR ++ SL PV + R  D +     +     + +S Y +YF + +  G  +    R    LD E I   +    + A DGG          IVE+ D NDN+P +    Y   I E     A VL +NA D D  P+   GQ+    S E S  + +  R   IT + L      L     ++  ++V A DG    + ++   T+ + + D ND+ P  +    ++ I EN      +  ++  D D   N     +++  N F  +         N    KI       GL  DRE       AS  S+ V   D G+P    ++S  +T+ + D NDN P F        + E       +  V A D D   N  +TYS+       D+++    G+     I     LDRE    Y+  + A D G P L+ +  + ++VLDVNDN P    + S   ++ES  R+     +  LN +D D G N    F +   +      V + +G +    ++DRE      ++++ IDNG     RT TTT+ + VLDVNDNRP F    L     +++ +++  G+I+ +V+ATD D G+NG + Y + + N   +     S G
Sbjct:   22 NENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGLISVAAALDFEA---------TPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYV-----GTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARA---LDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEY--GQLSLIYSLEGSTQFRINARSGDITSTTL------LDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRI---------NAASGKI----RTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGL-----ITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDS---VVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLF----LEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSG 727          

HSP 3 Score: 144.05 bits (362), Expect = 7.619e-35
Identity = 190/686 (27.70%), Postives = 293/686 (42.71%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISEC-TTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENK-----ASIVVIAADGEGRSNETTIE--LEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFIS--DENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKI-LDREVKDRYEFT------VEAKDNGEP--NLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLS---ATTTL 2451
             + I +I+ NDN P F      + + EN    +     +A D D+  +G       S   S   + F L D  + +   + V   LD E    F   + A DGGG +   R+ + + DVNDNTP +    Y     E   +   V+++ A D+D P     QI + I   S         F IT S  Y  +   ++    K      S+ ++A DG      +T+   +E+ D ND+ P+   +S S+ I EN  +   V  +  TD DQ              +  L  +Y+  LE   Q   F++N+  G        DRE  S+Y + V   D G      + I T+ I+  D NDN P +       +I E+   G +I  V A D D + N  + Y+I         + IN  +G+I    + LDRE  +   F       V   D G P      S  + +++ DVNDN P  +   Y+ +++E        F   ++ A+D D G NG   + + +     D Q+    G I     +DRE V    + +   D G P  ++TTT+ + VLDVNDN P F +P   A + +++ + +A  S+V  +  TD D GLN  + + +T  N          DG +     LD + K    LV+EA D G P+ S    TTTL
Sbjct:   15 RVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFG-----QVSYHFSDDSDKFSL-DPASGL---ISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPN--NQITYSILPTSAYSSY----FSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQ-----------SPEYGQLSLIYS--LEGSTQ---FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI---DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLF---QVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-HP---ARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNG-PAGSRRTGTTTL 658          

HSP 4 Score: 124.405 bits (311), Expect = 7.730e-29
Identity = 179/747 (23.96%), Postives = 287/747 (38.42%), Query Frame = 1
Query:  337 GRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSL---PV-AKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKS--FEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA--KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESI-LYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCN--DHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNG------TPTMSSSEIITIFISDENDNPPHFETEFKTF-SISEDAKIGHEIGIVIAKDSDSSPNNIIT---YSIIGDYEVKETFGI--NHNGQIHLNKILDREVKDRYE-------FTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYF---GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            G      D + G ++V   +DRE + +           +   +A      + + I+D NDN P F       +IPEN    +  ++   P+ A D D   +GV      S+       YF LID     N  + +   LDRE I     E  +   DGG      R+ V + DVNDNTP +        + E +      V+ + A D+D      G +R+ I+    +       F I ES  L + +  +      +  ++V+A D     +  + EL +   N  D +    + +    + E      +V R+               ++    +           +N       Q         DRE    Y + V+  D G        T      + + ++DENDN P FE    T   + E A  G  + ++ A D D+  N  ++   ++  G     +   I  N +G      I+D    D  E       F + A D G P  + +  + +IVLDVNDN+P I  S     V   E       +  + A+D D G NG   FR+ S      + +     II      NIDRE      ++V  +D GNPP + +  V + V DVND RP F  P+      +++ + ++ GS V  VKAT+   G N    Y +      K+ F++ +   ++   +L    +  + L   A D G P L     LY+      D
Sbjct: 1436 GERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDAD---FGVNATLAYSLLGGSSA-YF-LIDRDRG-NVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGND------TFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGV----TIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVP-IFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGD-KLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPV----QTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIG--KNAFTVHATSGLVTSTRLLKSYERFN-LTAVATDHGRPPLWGQAGLYVEVLDVND 2157          

HSP 5 Score: 121.324 bits (303), Expect = 6.587e-28
Identity = 142/560 (25.36%), Postives = 229/560 (40.89%), Query Frame = 1
Query:  739 LDRENIKSFEFHLYASDGG--------GNQGKCRIIVEITDVNDNTPQW-VGLPYRKEISECTTEAKVLQ-LNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIV---VIAADGEGRSNETTIELEI--KDCNDHRPV-IKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQ------LNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFR------VRSRSTPIDIQVY----NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPR-TATTTVHIEVLDVNDNRPKF-TYPLLNA-HNYLNITDDMAAGSIVGEVK-ATDEDFGLNGSIIYNLTNQN 2307
            LDRE   S+   + + DGG         N+    + V +TD NDN+P++  G     E+ E      +L  L+A D+D         R      ++     + I      +  +++ A   F E  +  +   ++A DG      TT  L +   D ND+ P+ +     ++ + E      LV  +  TD D G N +                 T  +E+GG  K+        +   PG   DRE  + Y++ V+  D G P +S S I+ + + D ND  P F    +T S+ E   +G  +  V A ++    N   TY I G    K  F ++  +G +   ++L  +  +R+  T  A D+G P L     + + VLDVND+ P      +  +V   E       I ++ A D D GQNG  R+       V SR    D + +      G I     +DRE      +++   D G P    +T  + + + D++DN P F   P   A +   +I +    G+ VG V  A D D G N  + Y +   N
Sbjct: 1791 LDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDV-AKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQV----------------TFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIG--KNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSR----DWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGN 2325          

HSP 6 Score: 116.701 bits (291), Expect = 2.083e-26
Identity = 175/734 (23.84%), Postives = 280/734 (38.15%), Query Frame = 1
Query:  436 TGAFLNYIIFAD-------HQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR-----IIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQ-----LNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGA---LKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKS-KILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-----GDYEVKETFGINH------NGQIHLNKILDREVKDRYEFTVEAKDNGEPNL------NDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRS-TPIDIQ----VYNEGKI----IYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDR-------LVVEARDQGTPSLSATTTLYI 2457
            T AF N  I A        +    + + ++D++DN P F        + E  A  +  S   A D +  +           S    E  F    + ++    + V   LDRE +  +   L   D   N    R     +IV I D NDN+P +  + Y  EI E +    VL      + A D D    +   + + +   S  Y +I R        + + +G     +     +  + ++  DG  R+    + + + D ND+ P   V S +  + EN  +    V  +   D D G+     C      +          + +GG    F ++   GL       D E    Y + V+  D   P  ++S  + + + +E D    F       ++SE A  G  +  V A    + P   +  +I+      D   K+    N        G+I     LDRE  D Y  TV ++D G               + + V D NDN PE     S  +VE  E       +  L+A+DRD G NGT   R  + + T I  Q    + NE  +    +   +   +    I   +  +D G+PPR+ T  + + VLDVNDN P F  P       +++ +  A G++V  V ATD D G NG + + +  ++   D  SI  SDG             N DR       L+V A D+G P LS +  + +
Sbjct: 1351 TQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAF----YADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDAD--FGVNATLAYSLLGGSSAYFLIDR----DRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGV-----CDAGTVRY---------SIASGGNDT-FGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAG-SATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSP---GGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRI--ESGGGDKLSIGPSDG-----IIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRV 2048          

HSP 7 Score: 113.235 bits (282), Expect = 2.486e-25
Identity = 139/573 (24.26%), Postives = 247/573 (43.11%), Query Frame = 1
Query:  802 QGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLN-IGALKSFKENKASIVVIAADGEGR------SNETTIELEIKDCNDHRP-VIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN--NIITYSIIGDYEVKETF-GINHNGQIHLNKILDREVKDRYEFTVEAKDNGE-PNL--NDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYI-GKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKI-IYFG-NIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGL--NGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPD-RLVVEARDQGTPSLSATTTLYI 2457
            Q    +++ ITD NDN P +    Y   ++E  + A V   N    D  +    ++ + I   +         F I      L  + AL         ++V+ A  + R      ++  T+ + + D ND  P  ++ +   + + E +    + T    +D+D G+N E   S+ D +    +    SP +   + + +       +  DRE  + Y++ ++  D GTP ++S+  + + + D +DN P F       S+SE A +   +  V A D++   N   ++ +S       +  F   +  G +++N+ LDRE    Y  T+  +DN + P+    DS  + + +LD NDN P  S  +Y  +I E+         + G + ASD D G N T  + +   S+   +   + G + +  G  +DRE +    + + ++      R AT  + + VLDVNDN P F      AH   N     A G+ V  VKA D D G+   G++ Y++ +  +  D F I     +I+          P+  L+V A DQ  P  +A+  L +
Sbjct: 1153 QATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNT-----AATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIAT-FMASDQDSGLNGELEYSIIDGD--PRNEFVISPADGDLRVRRY-------VELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLEN---SPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGN--DTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRV 1705          

HSP 8 Score: 99.3673 bits (246), Expect = 3.599e-21
Identity = 151/689 (21.92%), Postives = 274/689 (39.77%), Query Frame = 1
Query:  367 KGDIWVTSAIDREEICQPISKCLT---GAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKT-IKIPENVARSSEFSLPVAKDRDSEKYG-VXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK---VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDR---EKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF--ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVK----ETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCK-IRIIVLDVNDN------IPEISTSY-SFKIVESWEREHKHFYIGKLN-ASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTT-------------VHIEVLDVNDNRPKFTYPLLNAHNY-LNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +G+I   +A+DRE     +   L+   G      +  +     + + + D NDN P F+    T +++ E+ A  +  ++  A DRD+   G V         + I   Y  +I + + +        D   +  +   F + A DGG         + V + DVNDN P ++  P    +S     A    V  + A D D      GQ+ F+I     +   I      ++ I+ +  GA    +   A  +++ A   G    S    + + + D ND RP       ++ + E+      V  +  T+  +G N++++  +                  G  K  F +++  GL       +   R+++  +  D+G P +     + + + D ND+ P F         +I+E   +   I  V+A D D   N  + YS +    V     E+F IN  +G I   + LDRE +  Y   + A D G+P   +S + +++++ D++DN      +P+    Y SF I E          +G ++ A D D+G N    + + + +      +   G ++   ++DRE      ++V    N N     TT              V + + D+ND  P FT      H Y   +  D   GS + +++A D D G N  ++Y +
Sbjct: 1782 QGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLS-PGGYAVSVVELGAPGTLVASVWATDADAGPN--GQVTFRIESGGGDKLSIGP----SDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIA-----------------GIGKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPE---HSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTN-----HEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 9 Score: 92.4337 bits (228), Expect = 4.598e-19
Identity = 118/494 (23.89%), Postives = 221/494 (44.74%), Query Frame = 1
Query:  865 GLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSK-ILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICND---NGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKI--LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIP---EISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY---NEGKIIYFGN-IDREXXXXXXXXXXXXXNGNPP---RTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            GL      +  TT ++  +++    +   TI G     +SE + N +  ++I  IT+  L   +   ++   +   I + A   +     T++ + I D ND+ P     +  + + E   +  + V  +T +D D+G N+    ++     VS ++  T  ++NG       L ++  L F+   A  Y + V   D   +    ++S+  +++ ++D ND  P F   ++      + + G  I   +A D DS  N  + YSII D + +  F I+  +G + + +   LDRE +  Y  T+ AKD G P LN +  + + VLDV+DN P    +  + S       E       + ++ ASD + G+N     +    S     + +   ++  ++Y    +DRE+V +  + + V DN + P   R  +  + + +LD NDN P F+     A    N  +      + G + A+D DFG+N ++ Y+L
Sbjct: 1071 GLANCAGATTLTTLSRGFEMSISQIEAAVTISGA-SGVLSEATLNKQASIKITTITQR-LCTKVLVKRAASASTRGICLTATPAQA---TTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI-----VSGNTAATFGIDNGTGV----LTAVKALDFE-VSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSII-DGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLS-----EAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSL 1543          

HSP 10 Score: 90.5077 bits (223), Expect = 1.746e-18
Identity = 125/544 (22.98%), Postives = 228/544 (41.91%), Query Frame = 1
Query:  481 FELQIEIIDINDNFPSF-QPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNN---INP---YLRVI--GDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYI-TESILYLNIGALKSFKENKASIVVIAADGEGRS---NETTIELEIKDCNDHRPVIKV--HSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTP-TMSSSEIITIFISDENDNPPHF------ETEFKTFSISEDAKIGHEIG-IVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSC---------------KIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS 1977
            F L + ++D+NDN P F  P    + + E  A  +  +   A D D+   G              +  F +   G +   I P    +RV    ++DRE   ++   + A D G     G   + V + DVND  P ++       + E  +    +    +  ++ +    +  +KI+   +N       F +   S L  +   LKS++  + ++  +A D  GR     +  + +E+ D NDHRPV  +  + + + I E     I +  +   D D+G N     S     F+    + +   E+      F++N+  G+       DRE  + YS+ ++ +D G P +  S++ + + + D +DN P F         +++FSI E +  G  +G +  A D+D   N I+ Y I    E    F ++  G + +   LDREV   Y   V+A  N  PN   +                ++R+ + D+ND  P + T++ +    + + +     + +L A DRD+G N    +R+ S
Sbjct: 1937 FNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNG--------------QVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVA-TVKATENYKGHNTKYTYKIAGIGKNA------FTVHATSGLVTSTRLLKSYE--RFNLTAVATD-HGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYS-----FLHAGGVGSRDWES------FRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNE-GNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSN--PNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWP-VFTNHEYTAGVAVDAKVGSELL-QLEAVDRDVGNNSIVLYRILS 2440          

HSP 11 Score: 50.8322 bits (120), Expect = 1.999e-6
Identity = 58/240 (24.17%), Postives = 110/240 (45.83%), Query Frame = 1
Query: 1795 SCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN-EGKIIYFGNIDREXXXXXXXXXXXXXNG--NPPR--TATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDR-------LVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            +  + I + D NDN P    + +++++ +         +  + ASD D G N    + + S +T     + N  G +     +D E    + +LV    +   +P R  T+T TV + V DVND  P F   L +    +++++    G  +    A+D+D GLNG + Y++ + +   +     +DG + +++ ++      DR       L + A+D GTP L++T T+ +R     D
Sbjct: 1155 TTSVLIRITDENDNAPAFGAA-TYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF---LRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVEL-----DRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHD 1384          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 8.806e-38
Identity = 185/733 (25.24%), Postives = 303/733 (41.34%), Query Frame = 1
Query:  202 LSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDRE-----EICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKC--RIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVV-IAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNF-VSLDS---------MYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS--RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLN-ITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI 2331
             S  E+Q P    G  I ++    +S+      S+ L S      G  + +VD + G++ V  A+D E     E+   + +     F  +  +      +L+++++DINDN P F       K+PEN    +   L  A D+DS   G+      SI      N F +  +   I    R +  LDREN+ S+E  + A+D G     C  ++++ +TD NDN+P++  +       +      VL+++  D D+       I F + + S  + +      IT S   LN       +E+++   V + A     +  T + + + D ND+ P     +  ++  E  + + LV R++ +D D G N +  F       NF V  DS          Y  P   G    +                ++YS  V   D G P +SS   +TI I   N N P F  E  +  ++   + G  I  + A D D   N  I YS++G       F ++  G +HL   L  +    +  TVEA+D G P L+      I V + N   P    ++    +   E       + ++ A+D D G NG   + + S   S   DI     G ++  G +D E     ++ V   D G   +T  + V I V DVNDN      P+LNA +Y   I ++  +G+ V  + A D D   N   +Y+L   +   DLF +
Sbjct:  239 FSFREDQPP----GTTITVVA--ARSSRRAGPVSYHLAS--GGNLG-DVFAVDPQSGEVSVHRALDHEYQHHYEL---VVEARDSGFPPFSAY-----LKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDS---GINGQVDYSIIDGNIGNVFRVNPNSGEI----RSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPN--AAITFSLLDPSLPFSIHPSTGEITVS-RRLN-------REDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANL----------------NKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGG-NASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRF--AHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDIS-RASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNP-----PMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL--DDGEADLFVL 909          

HSP 2 Score: 149.828 bits (377), Expect = 1.419e-36
Identity = 173/682 (25.37%), Postives = 282/682 (41.35%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVI---GDLDRENIKSFEFHLYASDGGGNQG---KCRIIVEITDVNDNTPQWVGLPYRK-EISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISEN-SQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEG--RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQG--INSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNH-------TKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKP 2472
            + + + D NDN P F   E    +PE+    S+ +L  A D D+    +  Y L+       + +F       ++NP    I     LDRE  +S+   + A DGG   G      ++V +TDVND+TP+++  PY     S       V  + A+D D      G +RF +S + S  + +  R   I  +       AL+  +++  ++ V  +DG    RS  TT+ +  +D  +  P       S   +E++     +T +      +   ++   +   N  +  ++D          G+  + +         D E    Y + V   D+G P  S+   + + + D NDN P F +      + E+      I ++ A D DS  N  + YSII D  +   F +N N G+I     LDRE    YE TV+A D G P  + + K+ I V D NDN P  +  +S  + E        F + +++  D D G N    F +   S P  I   + G+I     ++RE      V V      +P  T +T V I V DVNDN P+F         Y+   +     ++V  V A+D D G NG + + + +Q         + ++ S++                N    VV A D+G P LS+  T+ I    P
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-----DGHF-------SVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDAD--AGPNGDLRFSLSGSASAGFSVDPRRGVIHAAR------ALQGPRDD-LTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVD-------PQSGEVSVHRA-------LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSII-DGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVRED---AAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHP-STGEITVSRRLNREDRSGYAVKVRAS---DPAWTVSTDVTIVVDDVNDNAPRFG----QTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVP 644          

HSP 3 Score: 140.198 bits (352), Expect = 1.183e-33
Identity = 128/454 (28.19%), Postives = 212/454 (46.70%), Query Frame = 1
Query: 1141 IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDI-----QVYNEGKIIY---FGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            +E+++ D ND+ P         K+ EN   + +V  +T  D+D GIN +   S+ D N                   +F++N   G        DRE  + Y + V   D G+PT   +  + I ++DENDN P F T+  +  + EDA +G  +  V   D+D  PN  IT+S++   +    F I+   G+I +++ L+RE +  Y   V A D   P    S  + I+V DVNDN P    T+Y  +  E  E E     + +++ASD D G NG   F +RS++    +     ++++   + Y    G      ++K   +V  +D G PP ++  TV I ++  N N P+F    L       +   + AG+ + ++ A D D  +NG I Y++   N ++  F + + G + L+  L     +   + VEARD+G P LS+  T  I
Sbjct:  322 LEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNI----------------GNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF-TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL---DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEA---LVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRF----LRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRR-FDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAII 743          

HSP 4 Score: 128.642 bits (322), Expect = 4.730e-30
Identity = 136/514 (26.46%), Postives = 222/514 (43.19%), Query Frame = 1
Query:  805 GKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIV--VIAADG---EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY-------NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            G   + V + D NDN P++     R  + E     + V  +NA D D    +   I +++     ++ +      I      +   +L   +E + S V  V A DG    G S+  T+ + + D NDH P             +  +   V  +T  D D G N +  FS S + +   S+D           +  I    ++ G   D       ++ V  +D G P  S+   +T+   D  + P  F    ++FS  ED   G  I +V A+ S  +    ++Y +     + + F ++  +G++ +++ LD E +  YE  VEA+D+G P  +   K+ + VLD+NDN PE S+S +  K+ E+         I  L A D+D G NG   + +      ID  +        N G+I     +DRE V   ++ V   D G+P +  T  V I V D NDN P+FT  + +AH    + +D A G  V  V   D D G N +I ++L
Sbjct:    8 GTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDAD--AGLNAIISYRLRGGDGHFSVNPSTGQI------ITTASLD--REGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPR---------RGVIHAARALQGPRDD------LTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFP-RFAPGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPR----TIVVLTAVDKDSGINGQVDYSI------IDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ-IFSAH----VREDAAVGFPVLRVSTLDADEGPNAAITFSL 478          

HSP 5 Score: 117.857 bits (294), Expect = 7.499e-27
Identity = 168/687 (24.45%), Postives = 282/687 (41.05%), Query Frame = 1
Query:  346 LISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAK----DRDSEKYGVXXXXXXXXXXXXXENYFELIDHGN--NINPY---LRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECT-TEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLN----IGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKA----SRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-GDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE--GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI 2331
            +  V+   G+I   S +DRE +    S  LT    +      H   ++ I + D NDN P F     T     +V   +    PV +    D D                      F L+D     +I+P    + V   L+RE+   +   + ASD         + + + DVNDN P++    Y  E  E +  EA V +++A D DD     GQ+ F +   ++N+  + R      S+  L      G       NK S VV A D  GR   S++ T+ + I   N + P       S  +    ++   +  ++  D D+ +N + + S+                  G   + F +++   L+     A    S +SV V   D G P +SS     I +++EN   P F       S+ E+   G  +  V A D+D+  N  I YSI  GD      F I+  +G + L   LD E +  Y  +V A D G     +   + I V DVNDN P ++ S  + ++   E       +  ++A D D   N    + +       D+ V N+  G +   G +D E     ++ V   +  +    +T  VH+++  VN+  P+F   +   +N++ +++    G+ VG V ATD D G++G++ Y L  ++ +K  FS+
Sbjct:  382 VFRVNPNSGEIRSVSTLDRENV---ASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF-----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAIT--------------FSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTV-STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADD--GANGQVFFFMRSQTENFR-VGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD-RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV----------------VGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG--SGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIP--ENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA--DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRF---VQREYNFV-VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-FSV 1014          

HSP 6 Score: 114.39 bits (285), Expect = 9.107e-26
Identity = 99/336 (29.46%), Postives = 153/336 (45.54%), Query Frame = 1
Query: 1459 GTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGE-PNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            G P ++ +  +T+ + DENDN P F       ++ EDA IG ++ +V A D+D+  N II+Y + G       F +N   GQI     LDRE ++ Y   V A D G  P L+ S  + + V DVND+ P    +       S        +   + A D D G NG  RF + S S      V     +I+     +   D + + V V D G PPR+A TTV +   D  +  P+F           +  +D   G+ +  V A        G + Y+L +  +  D+F++    G++ + + LD + ++   LVVEARD G P  SA   L +
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG---DGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVF--AVTARDADAGPNGDLRFSL-SGSASAGFSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFA----PGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEV 324          

HSP 7 Score: 105.145 bits (261), Expect = 5.738e-23
Identity = 141/565 (24.96%), Postives = 239/565 (42.30%), Query Frame = 1
Query:  808 KCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVL-QLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGL-----YFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNL--NDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNG-TFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLN-GSIIYNLTNQNHT-KDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            +   I+ +T+ N   P++   P    + E       L ++ A D D    + G I + I+  S +   +  I   +  +L   +G L    E   ++ V AADG  + ++  + + + + D ND+ P++        I EN  S   V  +   D D   N+    SL+D                 G+  +F LN   G+     + D E    Y + V   +       S+  + + I+  N+  P F      F +SE A +G  +G V A D D+  +  + Y + G+   K  F +N H G+I ++  LDRE +      V AK+ G       D   + + + D ND     S  Y  ++ E+        ++  ++A D D      TF F ++S +      +  + G I+    +DRE V   ++ V  +D G PP T TT V + + DVNDN P     LL +     +T++  AG  V  ++A D D   N G   + L   +   +  FS+ S G +   + +D + K    L V   D G+P L++T TL++
Sbjct:  738 RATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTD--AGVNGAIVYSIA--SGDGSGLFDISRASGDVLL--VGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDD-----------------GEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSK-GFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEA---ASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPF----LLTSS--AKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHL 1269          

HSP 8 Score: 93.2041 bits (230), Expect = 2.666e-19
Identity = 113/457 (24.73%), Postives = 200/457 (43.76%), Query Frame = 1
Query: 1114 GEGRSNET-TIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNG-TPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIST---SYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            GE R   T T+ + ++D ND+ P          + E+      V  +  TD D G+N+  S  L        D  ++    N    +I    S+     DRE    Y +EV   D G TP +SSS  + + ++D ND+ P F            A  G  +  V A+D+D+ PN  + +S+ G       F ++   G IH  + L +  +D    TV   D G P  +    + +   D  +  P  +    S+SF+     E +     I  + A  R   + G   + + S     D+   +   G++     +D E     +++V+  D+G PP +A   + ++VLD+NDN P+F+    ++  +  + ++    +IV  + A D+D G+NG + Y++ + N   ++F +  + G+I     LD +      L V+A D+G+P+   T  + I
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG-----DGHFSV---NPSTGQIITTASL-----DREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSG--SASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFR-----EDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS----SSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGN-IGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLI 428          

HSP 9 Score: 63.1586 bits (152), Expect = 4.274e-10
Identity = 90/375 (24.00%), Postives = 150/375 (40.00%), Query Frame = 1
Query:  433 LTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQG----KCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYI-TESILYLNIGALKSFKENKASIVVIAAD-GEGRSNETT-IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINS---EFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNP 1524
            LT    NY     +   ++ ++I  +N+ FP F   E    + E+    +      A DRD+   G+       +        F + +H   I     V   LDRE   S    + A + G  +G    +  + V ITD ND  P +    Y   +SE  +    V+ ++A D D P    G   F     S N     R F I   + L +    L        ++ V+A D GE  +  TT + + ++D ND+ P +   +SS K+ EN+ + + V  +   D D   N     F    +D  +    S+ +S L    +              DRE+   + + V   D G+P ++S+  + + + D+NDNP
Sbjct:  932 LTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDA---GIDGTVFYMLFGESRSKGFSVNEHTGEII----VSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPP---GWRTFSFLIQSGNAG---RAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL--TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARP------------IDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 191.815 bits (486), Expect = 2.490e-49
Identity = 187/676 (27.66%), Postives = 299/676 (44.23%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTT-EAKVLQLNAQDKDDP-------QTIGGQIR--FKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYF-GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            L I + DINDN P F P     ++ EN    ++ S   A DRDS   G   + +   +    ++    ID    I   + +    D EN   ++  + A D G        ++ + I DVND++P +    Y K+I E T   + V+ + A D D         + I G ++  F I  NS +  +   +   T     L + A      +++S              T + + ++D ND+ P+ +      ++ E+      + ++  TD D   N +   +L+D                     +F +N+  GL       D EK ++Y V V   D GTP+ SS  ++ + + D NDNPP F     T ++ E+   G  +  V A D+DS  N  I+YSI+   E    F ++   G+I     LDRE    Y  T+ A D        +  + I + D NDN P  +    F I E      +   +G+L A+DRDIG NG   + + S +     Q+     I+     +DRE +    ++V   D G+P ++ T ++H+ VLDVNDN P+F   L +      I +D +  S V +VK  D+D G NG+I  +L+ +    D F+I S G ++ K  LD +     +L V ARD G+PS SAT  + I
Sbjct:  362 LLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGN----DDGVFTIDGSTGI---ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSS-------------STRVTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD------------------NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE-NMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTR---VGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGE----IREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEG--SDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKI 985          

HSP 2 Score: 188.734 bits (478), Expect = 2.048e-48
Identity = 177/623 (28.41%), Postives = 271/623 (43.50%), Query Frame = 1
Query:  472 HQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL---NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNH 2310
            H  F   I + D+NDN P F        + E+VA  S      A D D    G+      S+ S    +YF +   G      +R  G  DRE   S++  L A DGG     G+  + +EI DVNDN P +    Y   + E     A ++ + A DKD+       +R+  +  + N+      F +      + +     F++  +  + ++    G    ++ + + + + D ND+ PV    +   ++KEN  +    T+++ TD D   N      +   ND    ++D          G   I  +   P    D E  +RY + V   D G P    +  +TIFI D ND+ P F     +  I E   IG  +  V A D DS P   + Y +I    VK  F I+ N G I ++  LDRE    Y   VEA+D G  + + S ++ I + D+NDN P     Y F++ ES    H+   IG++ A+D D   NG  R+ +   +    I   + G I     +D EK  +  V V   D G P R++ T V + V DVNDN P+F   L        + +++AAG  V  V ATD D G NG I Y++ + N 
Sbjct:  149 HTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD---VGINARLSYSLVSGDT-SYFTVDSQG-----VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGN--NADLRYSFTSGNTNHA-----FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG---TQVSATDRDSSTNGALVFGIIKGNDDGVFTID----------GSTGIISIAKSP----DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISG-NVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQ---IGQVAATDADDSSNGDVRYALSDNTDVFSINT-STGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTC----TVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE 729          

HSP 3 Score: 188.734 bits (478), Expect = 2.157e-48
Identity = 189/704 (26.85%), Postives = 312/704 (44.32%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASD--GGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGA-LKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNK 2556
            ++ I I D+ND+ P F P   + +IPE+    S      A D DS   G        + S   +  F +  +  +I    RV  +LDRE   S+   + A D          R+ + + D+NDN+P + G PY   +SE ++   ++ Q+ A D DD     G +R+ +S+N+        +F I  S   + +   L   K+ +  + V A DG    RS+ T +++ + D ND+ P       +  + EN  + + V  +T TD D G N + S S                + +G +   F ++   G     +  DRE  + YS+ +  +D       ++  + I I+DENDN P F T    F+ISED+  G  +G + A D D  PN  +TY+II   +   +F ++  +G + +   LDRE    Y   V+A D G P  + +  I + VLDVNDN P    S +S +I    E    H  + ++   D+D G NG     +    +  +  + + G ++    +D E      + V   D G+P ++AT  V I +++VNDN P F  P        +I +D+A  + V ++ ATD D      + +++   N        QS G I + K+LD +      LVV A + G+   S      IR     D          N+   NP  Y +++++
Sbjct:  463 QVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRG---RLEYRLISGNVKGAFNIDANSGSI----RVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQG-PYVFRVSESSSPGHQIGQVAATDADDSS--NGDVRYALSDNTD-------VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYS----------------ILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ-GNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEI---REDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSD-NFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSP----AQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVND----------NAPVFNPGSYAKSLHE 1110          

HSP 4 Score: 186.808 bits (473), Expect = 8.981e-48
Identity = 189/681 (27.75%), Postives = 308/681 (45.23%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN-EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDR 2490
            ++IEI+D+NDN P F   + T  + E+VA  +      A D+D+   G       S +S    + F L    + +   + V   LD E   S+   L  +D G         +++ + D+NDN P +    Y+  + E T      Q++A D+D   +  G + F I + + +      +F I  S   ++I     ++      + + A   G   + +   + + I+D NDH PV    + S +I E+      V  +T TD D G                        L +G  K  F +++  G        DRE    YS++V   D G+ + SSS  +TI + D NDN P F+  +  F +SE +  GH+IG V A D+D S N  + Y++  + +V   F IN   G I L   LD E K +Y  TV AKD G P+ +    ++++V DVNDN P+ + S Y+  + E+        Y+    A+D D G NG   + + S +  +   +    G+I     +DRE +    + ++  D       A TTV+I + D NDN+P FT P     +  NI++D   G+ VG++ ATD D G NG++ Y + + N           G + ++  LD +      LVV+A D G+P  S T ++++      D+  R
Sbjct:  257 VEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDN---GNNADLRYSFTSGNTNHAFTL----DAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT--QVSATDRD--SSTNGALVFGIIKGNDD-----GVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR----------------LISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPY-VFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV---FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYV---TATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGP-----SRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPR 893          

HSP 5 Score: 172.94 bits (437), Expect = 1.841e-43
Identity = 191/673 (28.38%), Postives = 305/673 (45.32%), Query Frame = 1
Query:  493 IEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKAS--IVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-----GDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            I++ D NDN P F  +     I EN   +++ ++  A DRDS           + S    EN F +    N+    +R +  LD E   S+   + A D  G       ++ + DVNDN P +    Y+  + E     + V QL A D D    I  ++ + +     +Y      F +    +    GA    +E KAS  + + A DG    RS + T+E+EI D ND+RPV      +  + E+      +  +T +D+D G N++   S                  +G     F L+++ G+       D E+ S Y++ +   D G+P ++ +  + I ++D NDNPP F        + E+   G ++    A D DSS N  + + II     G + +  + GI     I + K  D E K RY+ TV+A+D G P   D+ ++ I + DVND+ P  S S YS +I ES         +  + A+D D G  G   +R+ S +      +  N G I     +DRE      + V+  D G+  R+++T V I + D+NDN P F  P +       +++  + G  +G+V ATD D   NG + Y L++     D+FSI  S G I LK +LD + K    + V A+D GTPS S+ T + +
Sbjct:   58 IDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDS-----GTNAAITYSLFSGENKFMM----NSKTGEIRTVTPLDHETKDSYTMRISAFD--GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD--VGINARLSYSLVSGDTSY------FTVDSQGVIRTKGAFD--RETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFT----------------SGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGI-----ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGST---VVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV-----FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT---DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKV 673          

HSP 6 Score: 164.851 bits (416), Expect = 5.104e-41
Identity = 202/731 (27.63%), Postives = 319/731 (43.64%), Query Frame = 1
Query:  355 VDQKKGDIWVTSAIDREEICQ---PISKCLTGAFLNYIIFADHQIFE-LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGD---LDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI---GALKSFKENKASIVVIAADGEGRS---NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRD---------IGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            +DQ  G I V   +DRE        +    TG+           ++    I ++D+NDN P F P      + EN+      +   A DRD  +       +    S    + FE       +NP   ++     LDRE+  S+   + A D G         I + I D+NDN+PQ+    Y   ++E T     +L++ A D D     G   R   S  S N+    RI   T  I  + +    AL S+       + I+A   G     +   + + + D ND+ P+   + +S  I E       V  +T TD D+G N++  +S    DT+  ++++M      NG      ++N        RE    Y++ +  +D G+P M+S + +T+ ++D NDNPP F ++    S+ E++     +  V A DSD   N ++ YSII   + K  F IN  +G I     LD E K +Y   V A D+          + I V+++ND  P  +  +Y+  +    E       + K++ASDRD         +G   + +F +  RS          G I     +DRE V    + V V D GNPP +  T V I++LD NDN PKF     ++    +I ++ A  S   ++ ATD D G N  I YNL+      D F I  S G I L + LD + K+   L ++ARD GTP  +++ T+ +
Sbjct: 1044 IDQSSGLISVAKRLDRETTANYTLVVRATETGS-------QGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGE----NAKVTYELSVGDTSKFE-------VNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPD----AGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYN------LTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAM------NGVLTVKKEIN--------RETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR-FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASV---RENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRS----------GIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFD----SSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN----DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRV 1707          

HSP 7 Score: 162.155 bits (409), Expect = 3.607e-40
Identity = 190/684 (27.78%), Postives = 306/684 (44.74%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGD------LDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIG--GQIRFKISENSQ--NYEMIVR--IFYITESILYLNIGALKSFKENKASIVVIAADGEG--RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLN---DTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIG----KLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            +++ + D+NDN P F     T  + EN+A         A D DS   G               +Y  L  + N      R  G+      LDRE I S+   + A DG   +      + + I D NDN P + G P R  ISE   T  +V QL A D+D    IG  G + + I   +Q  ++++  R  I  +  +   L+   + S+     ++VV A+D     +S   +I + + D ND+ P  +    S +I+E+      V ++ V D+D+G N   + SL+     NF ++DS              F L+  P    D E  + Y + V   D G+P+ S++  + I I + NDN P F +  +  SI ED  I   +  + A DSD +P   +T+ I+ +     +F I+  +G I + K LDRE    Y   V A + G    +      I VLDVNDN P  +  SY+  +       H++  IG    K+ A+DRD G+N    + +    T         G +     +DRE      + V  +D+G P ++A   + + + D+NDN P+F+     +   L +T++ A GS +  V A+D D G NG + Y++ + NH  + F I S  G+I +   +D +      L + A+D G P   +T  + I
Sbjct:  671 VKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANG-------------KISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTG-PSRFNISEDSPTGTRVGQLTATDRD----IGPNGAVTYAIISGNQGNSFQLDPRSGILSVRST---LDRETIPSY-----TLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNF-TIDSTG------------FVLSKTP---LDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP---LTFDIV-EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSL-------HENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFS----QSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNH-GNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAI 1296          

HSP 8 Score: 150.599 bits (379), Expect = 1.240e-36
Identity = 170/653 (26.03%), Postives = 281/653 (43.03%), Query Frame = 1
Query:  355 VDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHG-------NNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKC--RIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGL-----YFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE-GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDED 2262
            +D   G I V   +DRE +    S  LT +  +  +        + I + D NDN P F  +E +  I E V+  S  ++  A DRD                      F  I  G       N +N  L V  +++RE + ++   + ASD G         + V + DVNDN P +    Y   + E + ++  VL + A D D    +G     + S  S N E   + F I  +   +       F+E     + + A     + +T + + + + ND  P     + +  ++EN  +   V +++ +D D              +F SL    +  +  G     F ++   G+       DRE  S Y+++V   D G P +S+   +TI I DENDN P F++   + SI E++        + A D+D   N  ITY++       + F I   +G I L + LDRE K  Y+  ++A+D+G P    S  IR+ V+D+ND+ P I++S     V   E + K  ++ ++ ASD D G N    F + S        + N  G I     +DRE+     + + V D GNP  ++   V I+V+D +DN P+F     N    + I++ +  G+ + +V A D D
Sbjct: 1253 IDSTTGRITVVGVVDREALA---SYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRD---------------EGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSD----VGANAVLRYSIISGNDE---KRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--------------SFGSL----SYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL----SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVR--ENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYN----VTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 150.599 bits (379), Expect = 1.251e-36
Identity = 176/689 (25.54%), Postives = 297/689 (43.11%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKC---RIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYIT---------ESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGL-----YFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-GDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNY-LNITDDMAAGSIVGEVKATDED-FGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            +++I II++NDN PSF    +   IPE+VA ++      A D D             I      + F+ ID  + +   + V   LDRE   ++   + A++  G+QG+       + + DVNDN P +    Y K + E       V ++ A D+D+ +         + + S+ +E+      +T         ++   L + A+   K +++++  I              L I D ND+ P       +L + EN  +   + R+  +D D G N   + S                + +G     F+++S  G        DRE  + Y++ +   D+G P   S+  + I ++DENDN P F +   ++ I E   IG  + +V A D D   N  + YSI+ GD      F IN  NG + + K ++RE    Y  T+ A D G P +    ++ ++V DVNDN P +  S S+ I    E   +   +  + A D D+G N   R+ + S +     ++    G I+    +D E+  +  + V      +   TA T V I V+++ND  P FT       NY  ++ ++    + V +V A+D D F   GS+ Y++     + D FSI Q  G I     LD ++ +   + V   D G P LS  T + I+     D
Sbjct:  982 QVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPL------TFDIVEGNAGSSFK-IDQSSGL---ISVAKRLDRETTANYTLVVRATE-TGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK-FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAIT-------------LTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYS----------------IISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD---TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDN-PPVFNSQSY-IGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTAT---DSKYTAKTNVTIRVINLNDITPAFTQ-----QNYTASVRENSPTSTSVVKVSASDRDSF---GSLSYSIVGGKDS-DKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDEND 1612          

HSP 10 Score: 148.288 bits (373), Expect = 5.647e-36
Identity = 197/761 (25.89%), Postives = 332/761 (43.63%), Query Frame = 1
Query:  355 VDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKE-NKASI----VVIAADGEGRSNETT---IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYL-NITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNA 2580
            V+   G +     +DRE+     S  L    +++   +   +  + + I D+NDN P F   + T+ + EN A  S     +A D D+   G       SI S  + N F +    ++    + V+G +DRE + S+   + A D G         V IT  D NDN+P +        I E  +  ++V  + A D+D+              N+Q +  IVR      +I  +N G L   KE N+ ++    + I A   G    T+   + + + D ND+ PV    S    ++EN      V  +   D D G N+    S+                 +G  +K F++NS  G+       D E+ S+Y +EV   D+     ++   +TI + + ND  P F  +  T S+ E++     +  V A D DS  +  ++YSI+G  +  + F I+  +G I    +LDRE+   Y   V   D G P L++   + I +LD NDN P+  +S     +   E      +  KL A+D D G N    + + SR+    I   + G I     +DRE     D+ +   D+G PP+ ++ T+ + V+D+ND+RP     L+N+ +   ++ ++    + V  + A+D D GLN  + ++L +  H K +F++  + G I  K  LD + +    L +   D+G PSLS+   + I      D          N     P +Y  T+++S  LP  A
Sbjct: 1148 VNPATGLVTTKRPLDREDQA---SYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDA---GANGRVTYSIISGNHGNAFRI----DSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDE------------GSNAQVFYSIVRGDTSAFAINAMN-GVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI----------------ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS--LSYSIVGGKD-SDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSI--LENSAPSSFSFKLAATDADEGTNARITYNL-SRNDAFMIGA-SSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP-----LINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEH-KSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDD----------NCPRFQPTEYNVTISES--LPRGA 1841          

HSP 11 Score: 134.806 bits (338), Expect = 9.664e-32
Identity = 152/578 (26.30%), Postives = 243/578 (42.04%), Query Frame = 1
Query:  739 LDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIG-------GQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL--NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY----NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYL-NITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPD-RLVVEARD 2415
             DRE+   +   + A D     ++G+  +++++ D NDN P++    Y   I E T  A+V  + A D+D             G+ +F ++  +     +  + + T+    + I A                  +G+       + + D ND+ P   +      + E+     +V ++T  D D GIN+  S SL   DT++ ++DS     +   G              FDRE  + Y V +   D G+P+ S    + I I D NDN P F +   T S+ ED  IG  +  V A D D+  N  + YS          F ++   G + +++ LD E +  Y   +   D G P L D+  + I V D+NDN P  S ++Y  ++ E+           +++A+DRD   NG   F +   +   D  V+    + G I    + D E   + D+ V   D G P +  T  V I + DVND+ P F+       NY   I +    GS V  V ATD D G  G + Y L + N  K  F+I ++   I       +   P   L VEARD
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAF-----------------DGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV--IRTKGA-------------FDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSG-NTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT------QVSATDRDSSTNGALVFGIIKGN---DDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS-----PSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN-VKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 12 Score: 130.568 bits (327), Expect = 1.874e-30
Identity = 125/423 (29.55%), Postives = 190/423 (44.92%), Query Frame = 1
Query: 1348 LENGGQKKIFQLNS------IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLT--NQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR---------YFKPRDSFDRSNENSMNSKYINPKDYPRTVNKS 2559
            + +G  + +F ++S        G  FDRE  SRY + V+  D          ++ I + DENDN P F      F+I E+     ++ IV A D DS  N  ITYS+   +  +  F +N   G+I     LD E KD Y   + A D             I V DVNDN P  + S Y   +   +E       + +L A D D+G N    + + S  T     V ++G I   G  DRE      V +   D G+P R+   TV IE+LDVNDNRP F+    +A    ++ +D+A G+ +  V A+D+D G N  + Y+ T  N NH   L ++   G + + + LD + ++   L +   D+G+P L+ T+ L I           F P     R  EN+     ++  D   + N +
Sbjct:    3 IMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSL---FSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTF----VPLITVDDVNDNAPFFALSVYKTGV---YEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSY-FTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFS----SAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVT--GVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSATDRDSSTNGA 407          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 184.882 bits (468), Expect = 3.631e-47
Identity = 206/689 (29.90%), Postives = 300/689 (43.54%), Query Frame = 1
Query:  481 FELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPV-AKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNN-------INPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRI---FYITESILYLNIGALKSFKENKASIVVIAADGEGRS---NETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPD-RLVVEARDQGTPSLSATTTLYIRYFKPRDS 2481
             +L I ++D+NDN P F+ +     IPE+ +   +F L V A D DS   G                Y  L   G+N       ++  + V+  LDRE + ++   + A D G       + V+IT  DVND TPQ+    Y   I E       V  + A D D  Q   G++ F+I S N  N+  I RI     + + + Y  IG            +++ A  +G+    N+TT+++ + D ND+ P          I EN        R+   D+D G N E  FS   ND  F        S  EN G   I +         DREK  +++  +   D G P    +  ITI + D NDNPP F  E    SI+E+++ G  +  V A D DS P N++ YSI+        F IN  G I L+  L+   K  Y F+V A D     L+ +  + + V D N + PE    SYS ++ E          +  + A+DRD G N    + + +      +     G I   G++DREKVD     V   D+G P   A + V+I + DVNDN P F  P   A     + +D+  G  V EV A+D D G N  IIY+  +    +  F+I S   II   K   +   P+  L V A DQGTP   A+  + +     +DS
Sbjct:  112 MDLTINVLDVNDNGPIFERNIYAADIPEDKS-IGDFVLAVRASDADSGSNG-------------EVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCD--QGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFN---------LLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPF--------SINENTGGISIKE-------ELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTS---VLTVLATDRDTGSNAKISYSIATLVPEFSVD-ETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEA----KVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDS 748          

HSP 2 Score: 141.739 bits (356), Expect = 7.057e-34
Identity = 153/567 (26.98%), Postives = 237/567 (41.80%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY----NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRP 2160
            + I +ID+NDN P F        IPEN A   EF    A D+D    G       + S    +  F + ++   I+    +  +LDRE +  F F + A D G    +G  +I + + D+NDN P++    Y   I+E +     VLQ+ A D D   T    + + I  +S +     R F I    L + +    ++      +  ++A     S+   + + + D N H P  K  S S ++KE+      V  +  TD D G N++ S S+      +L   ++     G  K    L        DREK   Y  EV   D+G P + +   + I I+D NDN P F        + ED + G  +  V A D+D   N  I YS   + + + TF I+   G I   K LDRE    YE TV A D G P    S K+++I+ DV D+ P      Y   + E          +  + A  +D+       + +   ++P   QV+    N G I     +D E   +  + V    +   P    TTV + + D+NDN P
Sbjct:  325 VDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNG-----EITFSFMQNDLPFSINENTGGIS----IKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT---NVVYSIVSSSGHD----RCFRINPQGL-ITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI-----ATLVPEFSVDETTGVIKTAGSL--------DREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSP---VITVKAKSQDLSPETGMMYSIVRGNSP---QVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLS---PFFTETTVMVYLKDINDNTP 852          

HSP 3 Score: 134.806 bits (338), Expect = 1.046e-31
Identity = 114/321 (35.51%), Postives = 170/321 (52.96%), Query Frame = 1
Query: 1516 DNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKET--FGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE--GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            +NPP F    +  S+SEDA++G  +  V A D DS  N +I YS+     +     F I+   G I   + LDRE  DR+ F V+A+D GEP+L     + I VLDVNDN P    + Y+  I E  ++    F +  + ASD D G NG  ++ + +           E  G +     +DREKV    + V   D GNPPR+AT TV I +LDVND  P+F+  + +A     I +D+    +V  V+ATD D G NG + + + + N   + FSI + +G++ +K+KLD ++     L+V A+D+G P L   TT+ I
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPE--DKSIGDFVLA-VRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSA----TIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDM-NFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDI 327          

HSP 4 Score: 132.88 bits (333), Expect = 3.401e-31
Identity = 170/636 (26.73%), Postives = 264/636 (41.51%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHG-------NNINPYLRVIGDLDRENIKSFEFHLYASDGGG----NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGA-LKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI---IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPE-ISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSR-----STPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQN 2307
            ++I ++D+ND  P F     +  I E+V  +   +   A D D    G              E +FE++          N IN  +RV   LD E I  F   + A D G     NQ    + + + DVNDN PQ+V   ++  I E      +  ++ A DKD      G+I F   +N          F I E+   ++I   L   K  K +  + A D      E T ++ I   D ND+ P          I EN +    V ++   D D G           TN V       S + + G  + F++N   GL       +      Y   V  +D     +SS+ ++ + ++D N + P F+    +  + EDA +G  +  V+A D D+  N  I+YSI   + ++ V ET G+     I     LDRE  D Y F V A D+G P L     + I + DVNDN P  +  SY  K+ E      +   + +++ASD DIG+N    +   S      +  ID     +G I     +DRE + + ++ V   D G PP  A+  V + + DV D+ P F  PL      + + +D    S V  VKA  +D      ++Y++   N
Sbjct:  220 VKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNG--------------EVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTT--VDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKD--HGTNGEITFSFMQNDLP-------FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG----------PTNVVY------SIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGV-----IKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGR---VIEVSASDADIGKNAQIIYSFASNGDGQGTFTID---STQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYE----VTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGN 795          

HSP 5 Score: 98.5969 bits (244), Expect = 1.247e-20
Identity = 128/505 (25.35%), Postives = 206/505 (40.79%), Query Frame = 1
Query:  484 ELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP--YLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYL-NIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFR 1962
            ++ I ++DINDN P F  +E    I EN    +      A D DS    V    + S             D    INP   + +   L+      + F + ASDG  +     + V +TD N + P++    Y  E+ E  +    VL + A D+D       +I + I+        +V  F + E+   +   G+L   K +     V A D        ++ + + I D ND+ PV    S   K++E+ +    V  ++ +D D G N++   S     F S          NG  +  F ++S  G+       DRE    Y + V+  D GTP   +S  + + + D  D+PP FE      ++ ED      +  V AK  D SP   + YSI+      + F IN N G I     LD E +  Y  TV A  +  P   ++  + + + D+NDN P +   +    V+  +   +  Y  K+ A D D+    TF+
Sbjct:  427 QITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGH----------DRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSS-TALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSN--AKISYSIAT-------LVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYS-----FAS----------NGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRG-NSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLS--PFFTET-TVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARY--KIPAYDPDVSDKLTFK 890          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 167.933 bits (424), Expect = 5.255e-42
Identity = 181/674 (26.85%), Postives = 273/674 (40.50%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV----RIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELE--IKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPR-TATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDE-DFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            + I + D+NDN P F  DE T+ I ENV   +      A D D+   G       +     + N F +      I       G  DRE    +  ++ ASD G       C ++V + D NDN+P++  L Y  +I+E     A +  ++A D D            I EN++    IV      F +      + +G     +    SI V A D        ++E+   + D NDHRPV   H  ++ I EN      +  +   D D G+N+E   +     FV+           G     F +NSI G        DRE   R+++EV+  D G P   S   +T+ + D NDN P F        +SE   +   I  V+A+D D   +  +TY I    E    F IN N G I +   LDRE K +Y   V+A D G P L+    + + VLD ND+ P  + +     V+  E       + K++A D D+G N    +            +    + I F          I  L     N  PP   A   + IEVLD ND+ P F    + +   L    D  +G  +G V+A D+ D+G N  + Y   + N T         G++++   L   +     + V A D G P +S T  +Y+
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDA---GDNAKVSYATYGGSHGNKFAIDASSGRI----YTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDAD------------IGENARLTYSIVSPEKATFSMNPVTGEITVGQRLDREGANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYA-----FVT-----------GNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSE-GVVESNIVTVVAEDRDIGSDGSVTYCITQGRE-GGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPAT--LTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYST---------GMITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVF----IKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYV 622          

HSP 2 Score: 150.599 bits (379), Expect = 1.152e-36
Identity = 141/454 (31.06%), Postives = 219/454 (48.24%), Query Frame = 1
Query: 1141 IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-LY----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN-EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            + + ++D ND+ PV      ++ I EN      V  +T TD D G N++ S              Y +   + G K  F +++  G +Y    FDRE    YS+ V  +D+G P+ SS+ ++ + ++D NDN P F      F I+EDA +G  IG V A D+D   N  +TYSI+     K TF +N   G+I + + LDRE  + Y   V A D G P L+ S +I +IV D ND+ P   +      ++  E       I  L A D D G N   R+   + ++     + +  G++    N+DRE   +  + V   D G P + + T V + + DVNDN+P FT     A     +++ +   +IV  V A D D G +GS+ Y +T Q     LF I ++ G I +  KLD + K+   L V+A D G+P+LS+   + +      D
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVS--------------YATYGGSHGNK--FAIDASSGRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPE--KATFSMNPVTGEITVGQRLDREGAN-YSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFID--ENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAE----VSEGVVESNIV-TVVAEDRDIGSDGSVTYCIT-QGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQND 427          

HSP 3 Score: 117.857 bits (294), Expect = 1.185e-26
Identity = 153/614 (24.92%), Postives = 255/614 (41.53%), Query Frame = 1
Query:  493 IEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEIT--DVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIV--RIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETT------IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVIC----NDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNI---ITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQN-GTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDF 2265
            +E+ + N + P F          E++A  S      A DRD   +G        I +   + YF +       N  L V   LD E+ +++  ++ A+DGG         V IT  DVNDN P +  + YR E++E TT   V+  + +  D  +     +R+ I   S   + ++  R   I  ++ +        F+   +S ++IAA  EG S + T      + + I   N+  PV      +  + EN      V R++ TD+D+G                 D +    L     ++ F L+S  G        D E+A   ++ VI      ++ TP+  +   I + ++D ND PP F     +  ++E ++IGH +  V A D DS   +I   I+    G+  V +       G +     LDRE    Y  TV A DNG P +  +  + + + D+NDN P ++       V   E + +   +  LNA D D+  N G F++ +            + G +    ++DREK D  ++ + V D           +H+E  D NDNRPK T   +  H +    +    G +V +V+  D D 
Sbjct:  622 VEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRD---FGRNGEISYDIIAGNSQEYFGI----GLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEIRATVEF-------DFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKG----------------PDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRSIRYGISAGNTGNAFVMDAV----TGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVT--ENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGSFRLNVSSGVVSTVKSLDREKQDAYNISIKVTDARGLSAVNFCMIHVE--DQNDNRPKATSRDVYVHTF----EGKFLGGVVADVRPDDPDI 1192          

HSP 4 Score: 114.775 bits (286), Expect = 1.200e-25
Identity = 156/625 (24.96%), Postives = 269/625 (43.04%), Query Frame = 1
Query:  478 IFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECT-TEAKVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITES--ILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDE-DQGINSEF---SCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASR-YSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE--GKIIYFGNIDREXXXXXXXXXXXXXNG-NPPRTA--TTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL 2295
            +  + + + D+NDN P F   E   ++ E V  S+  ++ VA+DRD    G        I+       F + ++   I     +   LDRE    +   + A+DGG      +  +IV + D ND+ P +       ++ E T +   V++++A D D    +G    + +     + N  +  + F    +  I  L + A   +  +  +             +  I++E+ D NDH PV       L   ++  S + + R+   D+ D G N+     + S N T          +P E G   ++   +S+      R+  ++ Y + V  +D G P MS +  + + +++ N +PP F       S +ED  +G  +  V A D D   N  I+Y II     +E FGI   NG ++++K LD E ++ Y   V A D G+        +RI + DVNDN P  S   Y  ++ E+     +   +  + A+DRD     + R+ +   S   D  V +E  G+I      D E      +++   D G +P RTA    +VHI +  VN+  P F   +  A     + ++   G  V  V ATD+D G +G ++Y+L
Sbjct:  311 VTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIVTV-VAEDRD---IGSDGSVTYCITQGREGGLFVINENTGTIG----ITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGD----VGSNADVTYSTGMITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKA-------------DAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTG-----RFRVAP-ETG---EVLIASSL------RDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNS-QEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAEN--TTPRSVVVCSVRATDRDERGQQSVRYSILGGSGK-DKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTA----TVAENAPIGHSVLRVSATDKDKGPDGVVLYHL 887          

HSP 5 Score: 114.775 bits (286), Expect = 1.263e-25
Identity = 168/681 (24.67%), Postives = 274/681 (40.23%), Query Frame = 1
Query:  352 SVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH------QIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTPQW---VGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFK-ISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD-GEGRSNETT-IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDR-DIGQNGTFRFRVRSRSTPIDIQVYNE-GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI 2331
            ++D   G I+ T   DRE             +   +  +DH          + + + D NDN P F        I E+ A  +      A D D  +       L     S  +  F +    N +   + V   LDRE   ++   + A+D G         I V + D ND+ P +   +G  +  E +   TE  ++ L A D D    +  +IR+  ++ NS N   I  I     +   L+      F     ++ V+A D G  R +  T + + ++D ND++PV  +   + ++ E      +VT   V  ED+ I S              D   T  +  G +  +F +N   G        DRE  S+Y++ V   D G+P +SS   + + + D+ND+ P F     T  + ED   G  +  V A D D   N  +TYS         T  I  N  I           + Y  TV A++   P+      I+I VLD ND+ P      S  ++ + +       IG++ A D+ D G N   R+   S +     +V  E G+++   ++  +      + V   D G P  + T  V++EV + N + P F+  +          +D+A GS +  V ATD DFG NG I Y++   N +++ F I
Sbjct:   64 AIDASSGRIYTTGTFDRET---------KDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGE----NARLTYSIVSPEKATFSM----NPVTGEITVGQRLDREG-ANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTE--IITLQAVDGD--SGVNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRF-----TLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIVT---VVAEDRDIGS--------------DGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYS---------TGMITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIK--SVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSE----NEDIAVGSALLTVTATDRDFGRNGEISYDIIAGN-SQEYFGI 684          

HSP 6 Score: 87.8113 bits (216), Expect = 2.235e-17
Identity = 125/514 (24.32%), Postives = 215/514 (41.83%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPV-AKDRD-----SEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGK-----CRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKI--SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD------GEGRSNETTIELEIKDCNDHRPVIK-VHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN-NIITYSIIG-DYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDI 1941
            ++I + D+NDN P F P E   ++ EN    S     V A DRD     S +Y +             ++ F + +    I    R   + D E   S    + A D G +  +       + + IT VN+  P +V   +   ++E       VL+++A DKD  +   G + + +  S+N Q +++      ++ S      G L + +    ++ VIA +              TI + + D ND    +K V+S+   + E  +   +VT +T  D+D  I S                     +  G     F ++++ G        DRE  + Y + V   DNGTP M+ +  + + + D NDNPPH         ++E+   G ++  + A+D D +PN     YSI G DY    +F +N  +G +   K LDRE +D Y  +++  D    +  + C I   V D NDN P+ ++   +  V ++E +     +  +   D DI
Sbjct:  725 VRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSG--------KDKFVIDERTGEI----RATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKD--KGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVS------GDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDPPRFLKSVYSA--HVTEGSRIGHVVTNVTAVDDDSDIRS-----------------IRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDY---GSFRLNVSSGVVSTVKSLDREKQDAYNISIKVTDARGLSAVNFCMIH--VEDQNDNRPKATSRDVY--VHTFEGKFLGGVVADVRPDDPDI 1192          

HSP 7 Score: 86.2705 bits (212), Expect = 5.573e-17
Identity = 148/632 (23.42%), Postives = 267/632 (42.25%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENI-KSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYR-KEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSK-ILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNG-TP--TMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKD----NGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTP-IDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFT-YPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLN-GSIIYNLTNQNH 2310
            +QIE++D ND+ P F      +   ++    S  S+   +  D   YG          S      F +      +     +I    R+++ K++   + ASD G  +      + VE+T+ N + P +    Y+  E  +    + +L + A D+D  +   G+I + I + NSQ Y  I     +T   LY++       +EN  S+ V A DG  E +++  T+ + ++D ND+ PV        ++ EN   + ++V  +  TD D+                   S+  S L   G+ K F ++   G     + FD E      + +   D G +P  T      + I I+  N+  P F     T +++E+A IGH +  V A D D  P+ ++ Y ++G  + ++ F ++ N G + ++  LD E        V AK+    +  P+      I + V D ND    + + YS  + E     H    +  ++  D DI    + R+ + + +T    +     G +     +DRE + +  + V   DNG PP T   T+ + + D+NDN P  T  P +       +T++   G+ V  + A D D   N G   Y+++  ++
Sbjct:  514 IQIEVLDTNDHAPVFIKSVYLLFAVQDAG--SGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEV-----LIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRN--GEISYDIIAGNSQEYFGI----GLTNGSLYVSKPLDYEHQENY-SLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDE---------------RGQQSVRYSILGGSGKDK-FVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGS-DNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDPPRFLKSVYSAHVTEGSRIGHVVTNVTAVD-DDSDIR---SIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIG-----RVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDY 1105          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO36707 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT2])

HSP 1 Score: 159.844 bits (403), Expect = 9.700e-42
Identity = 150/469 (31.98%), Postives = 235/469 (50.11%), Query Frame = 1
Query: 1090 SIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEI--ITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS--RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTAT--TTVHIEVLDVNDNRPKFTYPLLNAHNY-LNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL--TNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPD-RLVVEARDQGTPSLSATTTLYI 2457
            S+ V+A+DG+ ++    I++ I+D ND  PV    + S+ I E    ++ V ++T  D D G NS+ + S+ D N     S    P  N GQ  + +         D E    + + V   DNG P + S +   +TI I+DENDN P F+     FSI+ED   G   G V A D+DS  N  ++YSI  D +V++TF ++   G + +   +DRE    Y F V   D+G         + + V DVNDN P     +Y+ +I E      K  ++   +A D DIG N    + + S  + +  DI+   +G I+  G +DRE +D+  + +   DNG PP+ +     V I + D+NDN P+F     NA  Y +NI++D + G+ V  V A+D+D G N  + Y +  +  +  K +F + ++ G I     LD +  N   +  VEARD G P+L + TT+ I
Sbjct:   25 SVTVMASDGKFQA-FLEIDVHIQDINDQYPVFSPQNYSVAISEESWVRLPVLQVTAVDMDSGSNSQVTYSIVDGN----SSFSIDP--NTGQIIVHRT-------LDFEVTRSFILRVQARDNGKPALVSRDYAYVTINITDENDNNPVFDKRSYNFSITEDVAKGTVFGFVRANDADSGKNAKLSYSI-PDEDVRKTFAVDEITGNLSVVGDIDRERTGIYSFVVVVTDHGSSPRVGFAVVSVQVKDVNDNQPIFRPQNYTVRISEGTSVGTKIVWV---HAHDEDIGPNALITYHIDSGNKESIFDIE---DGTIVLNGTLDREVMDQYTLGILATDNGEPPQLSRDPAIVVITIEDINDNYPEF-----NASVYSVNISEDTSIGTQVLSVYASDKDLGSNAHVQYFIIASANDDIKRVFDVNKTTGAISTTSNLDFESANNRFQFQVEARDNGKPALYSQTTVEI 467          

HSP 2 Score: 134.806 bits (338), Expect = 2.164e-33
Identity = 141/491 (28.72%), Postives = 216/491 (43.99%), Query Frame = 1
Query:  721 LRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETT-----IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNL--NDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN----EGKIIYFGNIDREXXXXX-XXXXXXXXNGNPPRTATTTVHIEV 2136
            ++V   LDRE+  S+   + ASDG   Q    I V I D+ND  P +    Y   ISE       VLQ+ A D D       Q+ + I + + +       F I  +   + +     F+  ++ I+ + A   G+    +     + + I D ND+ PV    S +  I E+     +   +   D D G N++ S S+ D +                 +K F ++ I G        DRE+   YS  V+  D+G+       ++++ + D NDN P F  +  T  ISE   +G +I  V A D D  PN +ITY I  D   KE+     +G I LN  LDREV D+Y   + A DNGEP     D   + I + D+NDN PE + S YS  I E      +   +  + ASD+D+G N   ++ + + +     +V++     G I    N+D E  +      V+  DNG P   + TTV I V
Sbjct:   10 IKVTRSLDRESNASYSVTVMASDGKF-QAFLEIDVHIQDINDQYPVFSPQNYSVAISEESWVRLPVLQVTAVDMDSGS--NSQVTYSIVDGNSS-------FSIDPNTGQIIVHRTLDFEVTRSFILRVQARDNGKPALVSRDYAYVTINITDENDNNPVFDKRSYNFSITEDVAKGTVFGFVRANDADSGKNAKLSYSIPDEDV----------------RKTFAVDEITGNLSVVGDIDRERTGIYSFVVVVTDHGSSPRVGFAVVSVQVKDVNDNQPIFRPQNYTVRISEGTSVGTKIVWVHAHDEDIGPNALITYHI--DSGNKESIFDIEDGTIVLNGTLDREVMDQYTLGILATDNGEPPQLSRDPAIVVITIEDINDNYPEFNASVYSVNISEDTSIGTQ---VLSVYASDKDLGSNAHVQYFIIASANDDIKRVFDVNKTTGAISTTSNLDFESANNRFQFQVEARDNGKPALYSQTTVEIMV 469          

HSP 3 Score: 130.183 bits (326), Expect = 8.761e-32
Identity = 138/518 (26.64%), Postives = 224/518 (43.24%), Query Frame = 1
Query:  352 SVDQKKGDIWVTSAIDREEICQPISKCLT--GAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPV----AKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGN---NINP---YLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR----IIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQ-LNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLN-IGALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSE--IITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDY--EVKETFGINH-NGQIHLNKILDRE-VKDRYEFTVEAKDNGEPNLNDSCKIRIIV 1818
            +V++  GDI VT ++DRE         +   G F  ++        E+ + I DIND +P F P   ++ I E     S   LPV    A D DS                  +  + ++D GN   +I+P    + V   LD E  +SF   + A D G      R    + + ITD NDN P +    Y   I+E   +  V   + A D D  +    ++ + I +     E + + F + E    L+ +G +   +    S VV+  D     R     + +++KD ND++P+ +  + +++I E       +  +   DED G N                ++ T  +++G ++ IF +     +     DRE   +Y++ ++  DNG P   S +  I+ I I D NDN P F     + +ISED  IG ++  V A D D   N  + Y II     ++K  F +N   G I     LD E   +R++F VEA+DNG+P L     + I+V
Sbjct:    2 AVNKTTGDIKVTRSLDRESNASYSVTVMASDGKFQAFL--------EIDVHIQDINDQYPVFSPQNYSVAISE----ESWVRLPVLQVTAVDMDSGS--------------NSQVTYSIVD-GNSSFSIDPNTGQIIVHRTLDFEVTRSFILRVQARDNGKPALVSRDYAYVTINITDENDNNPVFDKRSYNFSITEDVAKGTVFGFVRANDADSGK--NAKLSYSIPD-----EDVRKTFAVDEITGNLSVVGDIDRERTGIYSFVVVVTDHGSSPRVGFAVVSVQVKDVNDNQPIFRPQNYTVRISEGTSVGTKIVWVHAHDEDIGPN----------------ALITYHIDSGNKESIFDIEDGTIVLNGTLDREVMDQYTLGILATDNGEPPQLSRDPAIVVITIEDINDNYPEFNASVYSVNISEDTSIGTQVLSVYASDKDLGSNAHVQYFIIASANDDIKRVFDVNKTTGAISTTSNLDFESANNRFQFQVEARDNGKPALYSQTTVEIMV 469          

HSP 4 Score: 113.62 bits (283), Expect = 2.237e-26
Identity = 113/347 (32.56%), Postives = 171/347 (49.28%), Query Frame = 1
Query: 1405 FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNL--NDSCKIRIIVLDVNDNIPEIST-SYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN-EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNY-LNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTP 2427
             DRE  + YSV V+ +D           I + I D ND  P F  +  + +ISE++ +   +  V A D DS  N+ +TYSI+   +   +F I+ N GQI +++ LD EV   +   V+A+DNG+P L   D   + I + D NDN P     SY+F I E      K    G + A+D D G+N    + +          V    G +   G+IDRE+      +V V D+G+ PR     V ++V DVNDN+P F        NY + I++  + G+ +  V A DED G N  I Y++ + N  + +F I+ DG I+L   LD ++ +   L + A D G P
Sbjct:   16 LDRESNASYSVTVMASDGKFQAFLE---IDVHIQDINDQYPVFSPQNYSVAISEESWVRLPVLQVTAVDMDSGSNSQVTYSIV---DGNSSFSIDPNTGQIIVHRTLDFEVTRSFILRVQARDNGKPALVSRDYAYVTINITDENDNNPVFDKRSYNFSITEDVA---KGTVFGFVRANDADSGKNAKLSYSIPDEDVRKTFAVDEITGNLSVVGDIDRERTGIYSFVVVVTDHGSSPRVGFAVVSVQVKDVNDNQPIF-----RPQNYTVRISEGTSVGTKIVWVHAHDEDIGPNALITYHIDSGNK-ESIFDIE-DGTIVLNGTLDREVMDQYTLGILATDNGEP 346          

HSP 5 Score: 78.5666 bits (192), Expect = 5.732e-15
Identity = 94/353 (26.63%), Postives = 147/353 (41.64%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD-GEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKAS-RYSVEVICNDNGTPTMSSSEIITIFIS 1506
            + I I D NDN P F        I E+VA+ + F    A D DS   G       SI        F +    + I   L V+GD+DRE    + F +  +D G +   G   + V++ DVNDN P +    Y   ISE T+   K++ ++A D+D    IG         +S N E    IF I +  + LN G L     ++ ++ ++A D GE      +   + + I+D ND+ P       S+ I E+      V  +  +D+D G N+                 +     N   K++F +N   G        D E A+ R+  +V   DNG P + S   + I ++
Sbjct:  146 VTINITDENDNNPVFDKRSYNFSITEDVAKGTVFGFVRANDADS---GKNAKLSYSIPDEDVRKTFAV----DEITGNLSVVGDIDRERTGIYSFVVVVTDHGSSPRVGFAVVSVQVKDVNDNQPIFRPQNYTVRISEGTSVGTKIVWVHAHDED----IGPNALITYHIDSGNKE---SIFDIEDGTIVLN-GTLDREVMDQYTLGILATDNGEPPQLSRDPAIVVITIEDINDNYPEFNASVYSVNISEDTSIGTQVLSVYASDKDLGSNAHVQ-------------YFIIASANDDIKRVFDVNKTTGAISTTSNLDFESANNRFQFQVEARDNGKPALYSQTTVEIMVT 470          

HSP 6 Score: 63.929 bits (154), Expect = 2.113e-10
Identity = 59/212 (27.83%), Postives = 94/212 (44.34%), Query Frame = 1
Query:  340 RHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQ------IFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCR----IIVEITDVNDNTPQWVGLPYRKEISECTT-EAKVLQLNAQDKD 942
            R   +VD+  G++ V   IDRE          TG +   ++  DH          + +++ D+NDN P F+P   T++I E  +  ++     A D D    G        I S   E+ F++ D    +N      G LDRE +  +   + A+D G      R    +++ I D+NDN P++    Y   ISE T+   +VL + A DKD
Sbjct:  205 RKTFAVDEITGNLSVVGDIDRER---------TGIYSFVVVVTDHGSSPRVGFAVVSVQVKDVNDNQPIFRPQNYTVRISEGTSVGTKIVWVHAHDED---IGPNALITYHIDSGNKESIFDIEDGTIVLN------GTLDREVMDQYTLGILATDNGEPPQLSRDPAIVVITIEDINDNYPEFNASVYSVNISEDTSIGTQVLSVYASDKD 398          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 167.162 bits (422), Expect = 1.129e-41
Identity = 189/670 (28.21%), Postives = 291/670 (43.43%), Query Frame = 1
Query:  355 VDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGK-CRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIG--GQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY---NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI 2331
            V +  GDI V S +DRE     I   L     N +  A     ++ I + D+ D+ P F     T+K+ EN +  +  +   A D+D     +      SI++      F +    +N+   +R + +LDREN+  +E  + A D         +++V++ DVNDN P +    Y  E  E + E   +LQ+ A D D    IG    + + I EN  +Y   V +  IT  ++ L    L    E   +  + A D    S  +T  + IK  D ND+ PV         ++EN+ +   V  +T +D+D G N++ S  L+      L + +    + G       LN        RE+   Y++ +   D+       +  + I ++D ND+ P F      FS+ ED K+GH +G V   D D + N  + Y  I        F +N   G I     LDRE    Y   + AKD+G P L  +  + I + DVNDN P  S S Y+  + ES   + +   + ++ A+D D G NG F +++ +  T  D   Y   N G I     +D EK    ++ V   D G PP T    V I V DV+DN P F  P  +A  Y N+T     G  V  V ATD D   +   +Y      +T  +F I
Sbjct: 1137 VSRSTGDIIVDSPLDREFKNVYI---LNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKD-----IGDTISYSIANGDPYGLFTI----DNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDAD----IGDNAAVLYSIVENVTDY---VTVNAIT-GVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGV----LYTRFAIDPDTGNITTREPLN--------REETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRY-YISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQ---VVQVIATDPDEGANGQFTYKITAGDT--DDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVT----RGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLI 1764          

HSP 2 Score: 143.665 bits (361), Expect = 1.628e-34
Identity = 193/789 (24.46%), Postives = 325/789 (41.19%), Query Frame = 1
Query:  250 IKLIQNQTKSTEILKTKSFQLESEKSNTYG------RHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIG----DLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIG------------ALKSFKENKASIVVIAADGEGRSNETT--IELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLN-----SIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDI-GQNGTFRFRVRSRSTPIDIQVYNEGKIIYF-----GNIDREXXXXXXXXXXXXXNGN-PPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYL-NITDDMA--AGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSF 2484
            +KL +N +  T + K  +   +   + +Y         L ++D   G+I   + +DRE + Q          +N +      + ++ +++ D+NDN P F     TI+  E     +      A D D            ++  SI EN  + +     +N    VI      LDRE  + F F + A+D G         + +++ D+NDN+P +    Y   + E       VL + A DKD            +  N+       ++ Y+   +LY                 L   +    ++ + A D   R+ E T  + + + D NDH P       +  ++E+ K    V R+  TDED          +ND   V     Y S   +G    +F +N            DRE+ + Y++ +   D+G P + S+  + I I D NDN P F       ++ E   +  ++  VIA D D   N   TY I    +  + F I+ N G I +   LD E    Y  TV A+D G P L  +C + I V DV+DN P      YS ++ E+  R H   ++  +NA+D D    +    +R+ S +T     +  +  +I       G ++RE   + ++ V  I   N   + +     I VLDVNDN P+F     ++ +Y+ ++ +D      + +  VKA D D G +G II+ + + N           G +   + LD +  +   LVV A D+G P+LS++ T+ I      D+ 
Sbjct: 1199 VKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLV----SDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDAD-------IGDNAAVLYSIVENVTDYV----TVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKD------------VGTNA-------KLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDED----------INDNARVR---YYIS---SGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAG-DTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGH---HVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF-----DSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNL 1928          

HSP 3 Score: 138.658 bits (348), Expect = 6.133e-33
Identity = 165/638 (25.86%), Postives = 275/638 (43.10%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPY----RKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLN----KILDREVKDRYEFTVEAKDNGEPNLNDSCKIR---IIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE-GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPL----LNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTK 2316
            + I+++DINDN P F   +    + EN    +   +  A D+D    G        +S  +Y  +    D GN     +     L+RE   S+   L A D      +G  R+I+ +TD ND+ PQ+    Y    R+++    T  +V   +    D+      ++R+ IS  + +      +F + E+   ++  +    ++N +  ++I A   G     + T++ + I+D ND++P+      ++ ++E+   K  V ++  TD D+G N +F                T  +  G    +F +++  GL       D EK S Y++ V   D GTP ++ +  + I +SD +DN P F     +  + E+   GH +  V A D D+  ++   Y  I        F I   +G I LN      L+RE   RYE  V A      NL +   +    I VLDVNDN P   S SY   ++E          I  + A D D G++G   F + S +     Q+ N+ G +     +DRE      ++V   D G P  +++ TV+I VLD+NDN P    P+           ++ +++ AG  VG V A  +D      I Y +TN    K
Sbjct: 1385 VAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKD---VGTNAKLSYVLSGVLYTRFAIDPDTGN-----ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDN-----ARVRYYISSGNTSL-----MFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQF----------------TYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAI--SRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLED-TGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAA--QDLDTKNLIYYYITNTEEQK 1983          

HSP 4 Score: 132.494 bits (332), Expect = 5.034e-31
Identity = 171/667 (25.64%), Postives = 302/667 (45.28%), Query Frame = 1
Query:  508 INDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGD------LDRENIKSFEFHLYASD--GGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYL------NIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSE--FSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHF-ETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNE--GKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSA 2439
            IND  P F+     + + E+ +R        A DRD    G+      S + +  + Y              R  GD      LDRE    +  ++ A++   G      ++ + +TDV D+ P +       ++SE  +    V ++ A DKD    IG  I + I+ N   Y +   I  +T  I  +      N+   + F + K S+ ++       S+   + ++++D ND+ PV  +   +++  E       + ++   D D G N+   +S   N T++V+++++ T  +  G  +             DRE    ++  +   D+G P+ SS+  + I + D NDN P F  T++  + + E+   G  + +V A D D   N  ++Y + G    +  F I+ + G I   + L+RE    Y  T+ A D+       + ++ I V D ND++P+ + S Y+F + E  +  H    +G++  +D DI  N   R+ + S +T +   V NE  G I     +DRE+     +++   D+G P   + T+V I + DVNDN+P F+  + N    + + + +   + V +V ATD D G NG   Y +T    T D+F I ++ G I +K KLD +  +   L V A+D GTP L+ 
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDE---GINAIIFYSSNGAEAKFYVS------------RSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKD----IGDTISYSIA-NGDPYGLFT-IDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLV-------SDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAI-TGVISLGSSQ------------LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAY-VRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTR--FAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHT---VGRVATTDEDINDNARVRYYISSGNTSLMFSV-NETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYN----VTLRESVFLKTQVVQVIATDPDEGANGQFTYKIT-AGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTG 1695          

HSP 5 Score: 127.872 bits (320), Expect = 1.224e-29
Identity = 179/688 (26.02%), Postives = 284/688 (41.28%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG---NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKEN-----EKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY------FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVI---AKDSDSSPNNIITYSIIGDYEVKETFGINH-NGQIHLNKILDREVKD---------RYEFTVEAKDNGEP---NLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNY-LNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS-DGQXXXXXXXXXXXXNPDRLVVEARDQGTPS 2430
            + + +I++NDN P F        + E +   +  +   A D D   +G   Y L+   ++    YF +    N  N  +     LD + ++ ++F L   DGGG         + V + DVNDN P++ G+PY  +I+E       V Q+ A DKD  +   G++ F IS            F I  S L      L        ++ V A D    S    ++L +   D ND+ P I   +  L I  N         +L++ I   D D G N + + S+                 +GG  + F LNS  G         DRE    Y + +   DNG+P  ++S  + + I D NDN P F+        T+ I+ D   G     +I   A D D+  N  + YS+ GD      F ++   G++ + K LDRE            R+   + A D   P     + + ++ I V D NDN P+  S +Y  ++ E+         + +++A+D+D+   G   + +         +V    K++   N  ++           ++         T V I V DVNDN P F     N   Y  ++ ++   G+ V  V A+D D G NG I Y LTN N   D FSI +  G+I +   +D +  +   L V+A DQG PS
Sbjct:  375 VTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAA----YFSV----NADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGE--NGRLSFNISAGDDGGH-----FSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI---TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM-----------------SGGDSR-FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEH--GFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSN---VIQVSATDQDLEYKGKVIYNITDGDENRKCEVE---KLVRHYNWHKKNCVLCKESKCSVER--------TYVVIYVDDVNDNDPVF-----NQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNK-DDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPS 1004          

HSP 6 Score: 122.094 bits (305), Expect = 6.593e-28
Identity = 113/408 (27.70%), Postives = 178/408 (43.63%), Query Frame = 1
Query: 1117 EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSS-EIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKF-TYPLLNAHNYLNITDDMAAGSI---VGEVKATDEDFGLNGSIIYNLTNQNH 2310
            E  S   ++ L + + ND++P+    S +  + E       +  IT TD D G     +  L                  GGQ   F +N+  G        D +   +Y   ++  D G      +   +T+ + D NDN P F     T  I+E+   G  +  V A D DS  N  ++++I    +    F IN +G +   + LDRE    Y  TV A D+G  + +   ++ + VLD NDN P+I+   +     S         +  + A D D G NG   + +    +   +        I    +DRE  D  D++++V DNG+PP T +TTVH+ +LDVNDN P F   P  +   Y+ IT D   G+I   + ++ ATD D   NG + Y+L+   H
Sbjct:  367 EKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELR-----------------GGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH-FSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYV-ITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEH 755          

HSP 7 Score: 108.227 bits (269), Expect = 1.322e-23
Identity = 142/570 (24.91%), Postives = 222/570 (38.95%), Query Frame = 1
Query:  199 YLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECT-TEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDED-QGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEI-ITIFISDENDNPPHFETEFKTFSISEDAK--IGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVE 1878
            Y  V ENQ    P G  + ++    K        S+ L       Y R   ++D   G+I     ++REE     S  LT   ++  I A      + I + D ND+ P F        + E+V            D D             +   I      L+   N     +     LDRE   S+   + A D G    +    +++ I DVNDN P +    Y   + E    + +V+Q+ A D D  +   GQ  +KI+    +      +FYI  +   + I A   +++     + ++A   G    +    +E+ + D +D+ PV      S ++ EN      V  +  TD D +  +      +   N    DSM+      G Q  +  LN  P    +RE  +RY ++V        T   S +   I + D NDN P F++E    S+ ED        I  V A+D D   +  I ++I+   E       N  G +   + LDRE    Y   V A+D GEP L+ S  + I VLD+NDN+P + T     I E
Sbjct: 1405 YAYVRENQ----PAGTPVLVVTASDKDVGTNAKLSYVLSGV---LYTR--FAIDPDTGNITTREPLNREETG---SYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDED-------INDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPD--EGANGQFTYKITAGDTD-----DVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGN---TDSMFLI----GEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPE 1941          

HSP 8 Score: 95.9005 bits (237), Expect = 7.114e-20
Identity = 152/597 (25.46%), Postives = 249/597 (41.71%), Query Frame = 1
Query:  478 IFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWV-GLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI---GALKSFKENKASIVVIAADGEG-RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKA---------SRYSVEVICNDNGTPT---MSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSII-GD----YEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN-EGKIIYFGNIDREXXXXXXXXXXXXXNGNP-PRTATTTVHIEVLDVNDNRPKFTY 2172
            I  + + + D+NDN P F     T  I EN+   +      A D+DS + G       +IS+     +F +  +G+ +    R   +LDRE I ++   + A D G        ++ V + D NDNTPQ   GL     ISE      VL  +    D      GQ+ + +S            F +  +   L I   G  +  K++   I+ +  +G    +N TT+ + I D ND+ P            +   ++ L T +   DE  G  ++    +N T+  +  +   +   +G +   F+L+ + G        DRE            R+ +++   D  TP     S++  ++I + D NDN P F+++     +SE A+ G  +  V A D D      + Y+I  GD     EV++   + H      N +L +E K   E T                + I V DVNDN P  + S Y+  ++E+         + +++ASDRD G NG   +++ + +      + N  G+I   G IDRE V    + V   D G P  R     V I V D NDN P+F++
Sbjct:  477 IATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENG---RLSFNISAGDDGGHFSI--NGSGLVTTAR---ELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSR-------FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAF----------DPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKL--VRHYNWHKKNCVLCKESKCSVERTY---------------VVIYVDDVNDNDPVFNQSKYAADVLENSPTGTP---VLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSF 1028          

HSP 9 Score: 88.9669 bits (219), Expect = 8.977e-18
Identity = 152/647 (23.49%), Postives = 254/647 (39.26%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEK------TIKIPENVARSSEFSLPV-AKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIK---------SFEFHLYASDGGG-----NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQN----YEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPT--MSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTF---------RFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTN 2301
            + + I+D+NDN P+F P+         I + E     ++  + + A D D++  G     +    S     +F L    + +   L V  +LDRE+ +          F   + A+D             R+ + + D NDN+PQ+    Y   +SE       V+Q++A D+D      G++ + I++  +N     E +VR +   +    L        KE+K S+             T + + + D ND+ PV      +  + EN  +   V R+  +D DQG N +                 T  L NG +   F +N++ G        DRE    + + V   D G P+   + +E++ I + DENDN P F        I+E++ +G  I +V        P+                            KI    ++ R      A       L  + + R I L +ND  P    S  +  V   E   +   IG++ A+DRD G N            +F V SRST         G II    +DRE  +   + V   +     +  TT VHI V DV D++P F    L     + ++++ + G+ V ++ A D+D G   +I Y++ N
Sbjct:  690 VHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANG----KVAYSLSGDEHGFFRL----DPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQD--LEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVL-------CKESKCSV-----------ERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKI----------------TYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVV-ITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV--------PD---------------------------QKISSSTLRPRSSPRAPAA------LLTAREKRPITL-INDESPLFEKSMYY--VNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYV-SRST---------GDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLT----VKLSENASIGTNVTKITALDKDIG--DTISYSIAN 1231          

HSP 10 Score: 85.5001 bits (210), Expect = 1.144e-16
Identity = 143/603 (23.71%), Postives = 257/603 (42.62%), Query Frame = 1
Query:  763 FEFHLYASD---GGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESI-LYLNIGALKSFKENKASIVVIAADGEG---RSNETTIELEIKDCNDHRPVIKVHSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNI---ITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEF------------------------TVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS-TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGN-PPRTATTTVHIEVLDVNDNRPKFT-YPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPS 2430
            +EF +Y  D   GGG   +G     + + D NDN P +   PY  +I+E       +L+++A D D       Q+++K S    N       F+   S+   L +G    F+  ++ ++V+ A+  G     + TT+ +E+ D +D  P   + S  LK I+EN      V  +   D D GIN+                +Y   + +G    +F ++S  G+       D EK   + + V  ++   P  +++  + + + D NDN P F      F + ED  +   +     + +D   N +   + Y ++G     + F I+  +G +++NK LD E +  + F                         V  + +     + +  + + +++VNDN P  + +SY++ + E         +I  + A+D D+G  G   + +R           + G I     +D + + +    + V D G      A  TV + + DVNDN P+FT  P  +     +I +++ AG+IV +V ATD+D G NG + +N++  +     FSI   G +   ++LD +      L V A D G  S
Sbjct:    9 YEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDAD--SGTNSQVQYKFS----NATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRF-LQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPI--------------LY--EIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVG--ADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEIT---PGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTS-----DIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH-FSINGSGLVTTARELDRETIATYTLTVSAYDHGVSS 577          

HSP 11 Score: 70.8626 bits (172), Expect = 3.048e-12
Identity = 100/363 (27.55%), Postives = 159/363 (43.80%), Query Frame = 1
Query: 1513 NDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEI-STSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYN--EGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIY----NLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTV--NKSNGLP 2571
            ND  P FE      ++SE A  G  IG V A D D   N II YS  G    +  F ++ + G I ++  LDRE K+ Y   V A +      + + ++ I V DV D+ P   S+S + K+ E+         + K+ A D+DIG   ++     +   P  +   +   G+I     +DRE V + ++ V   D+ N        V ++V DVNDN P F+ P      +    ++   G+ + +VKA D D G N +++Y    N+T+      +  + S G   L ++++          + A D G PS S+T ++ I+     D          NS   N  DY   V  N+  G P
Sbjct: 1083 NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNG---AEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTN---VTKITALDKDIGDTISYSI---ANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVV-VQVEDVNDNPPVFSMPGYTIEYW----EESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYF----NFTIRATDSGVPSKSSTASVAIKLVDIND----------NSPVFNNTDYYAYVRENQPAGTP 1417          

HSP 12 Score: 57.7658 bits (138), Expect = 3.183e-8
Identity = 64/209 (30.62%), Postives = 97/209 (46.41%), Query Frame = 1
Query: 1732 VKDRYEFTVEAKDN---GEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFR---VRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQS 2337
            ++D YEFTV  +D+   G      S    +IV D NDN P  +   Y  KI E+         I K++A D D G N   +++     +  TP        G++   G +D E      ++V   D G P   + TTV IEV D++D  P+F    L +     I ++   GS V  V+A D D G+N  I+Y + + N +  +F+I S
Sbjct:    5 IQDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTT---ILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRF----LQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGN-SDGVFTIDS 205          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 270.011 bits (689), Expect = 4.033e-75
Identity = 242/776 (31.19%), Postives = 374/776 (48.20%), Query Frame = 1
Query:  208 VEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPISKCLTGAFLNYIIFA-------DHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKV-------HSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            V+E Q PN+ IG+L         S  +     ++LE       G   + VD K GDI+ T   IDRE +  C+ + K     +L + +           ++ E +IE+ DINDN P F     TI +PEN    + FS+P+A DRDSE+ GV  Y L +   +      ++ D      P L V+G+LDRE   S++  + A DGG  Q   +  + V +TD NDN+P++    Y  E+SE +     VLQ+ A D D      G+I + + +       ++RI   T  I+Y+  G L   + N  S  V+A D   + +S++T + +E+ D ND+ P +++       HS  +  I E+      V  + V+D+D+G N+  +C +       L     S  +N  ++K F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN P F         +E+ + G  I  V A D+DS  N  + Y+I+GD  +K  F I+ N G++     LDRE K+RYEF V A D G P    +  + I VLD NDN P+   S YSF ++E+         +G +   D D G+N      V        +Q    G I+   + DREK       +  +D G PPR++   V I VLD NDN P  T P  +  ++  ++   +  S V  V+A D D G N  +++++   N  + LF I  S G+I L K++  K     RLVV   D+G P   AT  ++I
Sbjct:   28 VQEEQPPNTLIGSLAA-DHGLPDSGHL-----YKLE------VGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKG-KPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSD--MGPNGEIEYSLHQAVDPVPKLLRIDRTT-GIIYVK-GPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDN--KRKYFLQTTTP---LDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSP---VGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ-NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP--SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHI 774          

HSP 2 Score: 129.028 bits (323), Expect = 8.819e-30
Identity = 150/586 (25.60%), Postives = 240/586 (40.96%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYI--TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI---IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRS-------RSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEV 2136
            L++ + D NDN P F+      ++ EN           A D D    G  +Y L      + +     ID    I   + V G LDRE I S  F++ A D G      K  + +E+TD NDN P    + +GL    E    ISE       V  +   DKD+ +       + G + F++   S +     R +++  T  + Y  +      KE +  IV + +     S+  ++++++ D ND+ PV       +   E  +    +  +T TD D G N+E   ++   +++               K +F+++   G        DRE   RY   V   D G+P    +  + I + D NDN P F     +FS+ E+      +G+V   D D   N  +  S+    G + V+     N  G I  +   DRE +  Y F ++A D GEP  +    + I VLD NDN P ++  ++ SF+ +        H  +  + A D D G N    F +         R +P      + G+I     + R+      ++V V D G PPR AT  VHI V
Sbjct:  230 LRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPK--LLRIDRTTGI---IYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERV------KEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYI---------------KGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ-----NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDV--VEAEDLDSGPNADLVFSIAGGNPYQLFRISP------SSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 3 Score: 96.6709 bits (239), Expect = 7.500e-20
Identity = 141/605 (23.31%), Postives = 245/605 (40.50%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH-------QIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP-----YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESI-LYLNIGALKSF----KENKA--SIVVIAADGEG--RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGD--YEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWERE 1893
            S E     NSP+G+   ++Q +   +++      +    ++      L+ +D+  G I+V   +DREEI          +   Y++  D        + F + IE+ D NDN P+ +          E    I E++   +  +L    D+D  +  V    +           F+L    ++ +      +L+    LD E +K +   + A D G         + V++TDVNDN+P +    +  + +E     + +L + A D D               N++ +  IV   YI     +  N G +K+     +E+K      V AAD          T+ +++ DCND+ P   +   S  + EN      V  +TV D D+G N+    S+                E  G K + Q  +   +  + FDREK S Y+  +   D G P  SS   +TI + DENDN P       + F+   +S  A     + +V A+D DS PN  + +SI G   Y++   F I+  +G+I L K + R+    +   V   D G+P  + +  + I V +   N+  +       +    +R+
Sbjct:  248 SYEAEVSENSPVGH--SVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEI---------NSLSFYVVARDKGPQPKSSKTF-VTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP------FQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADS------------GTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSV----------------EPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR--QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQL---FRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRD 801          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 271.166 bits (692), Expect = 2.038e-74
Identity = 242/776 (31.19%), Postives = 374/776 (48.20%), Query Frame = 1
Query:  208 VEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPISKCLTGAFLNYIIFA-------DHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKV-------HSSSLK-IKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQ-SDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            V+E Q PN+ IG+L         S  +     ++LE       G   + VD K GDI+ T   IDRE +  C+ + K     +L + +           ++ E +IE+ DINDN P F     TI +PEN    + FS+P+A DRDSE+ GV  Y L +   +      ++ D      P L V+G+LDRE   S++  + A DGG  Q   +  + V +TD NDN+P++    Y  E+SE +     VLQ+ A D D      G+I + + +       ++RI   T  I+Y+  G L   + N  S  V+A D   + +S++T + +E+ D ND+ P +++       HS  +  I E+      V  + V+D+D+G N+  +C +       L     S  +N  ++K F   + P    D E+   Y VE++  D+G P +SS+  + + ++D NDN P F         +E+ + G  I  V A D+DS  N  + Y+I+GD  +K  F I+ N G++     LDRE K+RYEF V A D G P    +  + I VLD NDN P+   S YSF ++E+         +G +   D D G+N      V        +Q    G I+   + DREK       +  +D G PPR++   V I VLD NDN P  T P  +  ++  ++   +  S V  V+A D D G N  +++++   N  + LF I  S G+I L K++  K     RLVV   D+G P   AT  ++I
Sbjct:  105 VQEEQPPNTLIGSLAA-DHGLPDSGHL-----YKLE------VGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKG-KPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSD--MGPNGEIEYSLHQAVDPVPKLLRIDRTT-GIIYVK-GPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDN--KRKYFLQTTTP---LDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSP---VGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ-NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP--SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHI 851          

HSP 2 Score: 129.798 bits (325), Expect = 6.316e-30
Identity = 149/583 (25.56%), Postives = 241/583 (41.34%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGN--QGKCRIIVEITDVNDNTP----QWVGLPYRKE----ISE-CTTEAKVLQLNAQDKDDPQ------TIGGQIRFKISENSQNYEMIVRIFYI--TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPG-----LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI---IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS--TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY----NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEV 2136
            L++ + D NDN P F+      ++ EN           A D D    G  +Y L      + +     ID    I   + V G LDRE I S  F++ A D G      K  + +E+TD NDN P    + +GL    E    ISE       V  +   DKD+ +       + G + F++   S +     R +++  T  + Y  +      KE +  IV + +     S+  ++++++ D ND+ PV       +   E  +    +  +T TD D G N+E   ++   +++               K +F+++   G        DRE   RY   V   D G+P    +  + I + D NDN P F     +FS+ E+      +G+V   D D   N  +  S+    G + V+     N  G I  +   DRE +  Y F ++A D GEP  +    + I VLD NDN P ++  ++ SF+ +        H  +  + A D D G N    F +   +     Q++    + G+I     + R+      ++V V D G PPR AT  VHI V
Sbjct:  307 LRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPK--LLRIDRTTGI---IYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERV------KEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYI---------------KGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ-----NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDV--VEAEDLDSGPNADLVFSIAGGNP---YQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 3 Score: 98.2117 bits (243), Expect = 3.730e-20
Identity = 142/603 (23.55%), Postives = 244/603 (40.46%), Query Frame = 1
Query:  205 SVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH-------QIFELQIEIIDINDNFPSFQ--------PDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP-----YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAK-VLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESI-LYLNIGALKSF----KENKA--SIVVIAADGEGRSNETTIELEIK--DCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFE----TEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGIN-HNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWERE 1893
            S E     NSP+G+   ++Q +   +++      +    ++      L+ +D+  G I+V   +DREEI          +   Y++  D        + F + IE+ D NDN P+ +          E    I E++   +  +L    D+D  +  V    +           F+L    ++ +      +L+    LD E +K +   + A D G         + V++TDVNDN+P +    +  + +E     + +L + A D D               N++ +  IV   YI     +  N G +K+     +E+K      V AAD     ++ T  + IK  DCND+ P   +   S  + EN      V  +TV D D+G N+    S+                E  G K + Q  +   +  + FDREK S Y+  +   D G P  SS   +TI + DENDN P       + F+   +S  A     + +V A+D DS PN  + +SI G     + F I+  +G+I L K + R+    +   V   D G+P  + +  + I V +   N+  +       +    +R+
Sbjct:  325 SYEAEVSENSPVGH--SVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEI---------NSLSFYVVARDKGPQPKSSKTF-VTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP------FQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADS------------GTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSV----------------EPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR--QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPY-QLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRD 878          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 247.284 bits (630), Expect = 3.181e-67
Identity = 244/812 (30.05%), Postives = 376/812 (46.31%), Query Frame = 1
Query:  130 MFKMFWQLFFLYTVV-----KSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPI---SKCLTGAFLNY---------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--------LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            M  + W    L T+V      +  S  +Y  + E Q PN+ IG+L   +         L       + E  + Y R    VD K G+I+ T   IDRE +  C+ +    KC    FL +          I    ++ E  IE++DINDN P F     T+ IPEN    + FS+PVA DRDS   GV +Y L +   +      ++ +  +   P + VIG+LDRE   S++ ++   DGG         + + +TD NDN P++    Y  E+ E +     VLQ+ A D D      G I + + + S   + ++RI   T  I+Y+  G +   ++N     V+A D     +S++  + + IKD ND+ P I++    L I +N  + I         V  + V+D D+G N+  +C +     V       S   N  ++K F   +      D E+   Y +E++  D+G P +SS+  + + ++D NDN P F       + +ED + G ++  V+A D+DS  N  + YSII +      F IN N G+I +   LDRE  +RYEF V A D G P+   +  + I V D NDN P+   S YSF + E+    +    +G +  SD D G+N      V   +    IQ    G I+   + DREK       +  +D G+PPR++   V I VLD NDN P  T P  +++ +L  +      + V  VKA D D G+N  + Y +T  N    LF I  + G+I L +    K K   RLVV   D+G P    T  +++
Sbjct:   15 MAVLRWGCLVLLTIVLMVPCGAVPSNNIY-KLSEEQPPNTLIGSLAADLG--------LPDSGHLYKLEVGSPYLR----VDSKTGEIYTTEIPIDRETLSDCRNLFEDDKC----FLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDAD--TGANGDIDYSLHQASDTVQRLLRIDRST-GIIYVK-GLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVV--AGDVPFQLRPASESANDRKRKYFLQTTT---LLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSII-ESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNP---VGVVTVSDADKGENSQVTLFVEPDNGKFIIQ-NGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSS--PPDTPVEVVKAEDIDAGVNAELYYTITGGN-PHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHV 792          

HSP 2 Score: 133.265 bits (334), Expect = 4.883e-31
Identity = 144/580 (24.83%), Postives = 247/580 (42.59%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTP----QWVGLP----YRKEISE---CTTEAKVLQLNAQDKDDPQTI----GGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGI-NHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDN 2154
            L+I + D NDN P F+ ++   ++PEN           A D D+   G   Y L   S ++       ID    I   + V G +DRE     +F++ A D G N    K ++ + I D NDN P    + +GL     +   ISE     T   ++Q++ +D+ +   +     G + F++   S++     R +++  + L       +  K+ +  IV + +     S+  ++++++ D ND+ P        +   E+ +    V  +  TD D G+N+E   S+ +++  SL                F++NS  G        DRE   RY   V   D G P+ + + I+ I + D NDN P F     +FS++E+    + +G+V   D+D   N+ +T  +  D      F I N  G I  +   DRE +  Y F ++A D G+P  +    + I VLD NDN P ++   +               +  + A D D G N    + +   +     Q+ +N G+I        +      ++V V D G PPR  T  VH+ V +  +N
Sbjct:  249 LRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQR--LLRIDRSTGI---IYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLL----DYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASL----------------FEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPD---NGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 97.0561 bits (240), Expect = 7.372e-20
Identity = 96/349 (27.51%), Postives = 159/349 (45.56%), Query Frame = 1
Query: 1495 IFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-------GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPID--IQVYNEGKIIYF-GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKF---TYPLLNAHNYL-NITDDMAAGSIVGEVKATDEDFGLN--------GSIIYNLT----NQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR 2460
            I + D NDN P F +   T SI E+   G    I +A D DS  N +  Y++    +  + FG+           Q+ +   LDRE KD Y+  +   D G+P    S  +RI V D NDN P+   + Y  ++ E+    H    + ++ A+D D G NG   + +   S  +   +++     IIY  G +DRE+ + +   V   D G   +++   V I + D NDN P        L+   N++ NI++DM  G+ V  V+ +D D G N        G + + L     + N  K  + +Q+   +  ++  D       R+ + A D G P+LS+T +L ++
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHS---VLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDY------RIEIVAVDSGNPALSSTNSLKVQ 478          

HSP 4 Score: 91.6633 bits (226), Expect = 3.315e-18
Identity = 141/586 (24.06%), Postives = 237/586 (40.44%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH------QIFELQIEIIDINDNFPSFQPDEKTIKIPEN-VARSSE---FSLPVA----KDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP-----YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKT--FSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWERE 1893
            NSP G+ +  ++     T       + L  + S+T  R L+ +D+  G I+V   +DREE               Y++  D          ++ I I D NDN P+ +     + I +N VA  SE      PVA     DRD  +  V    +           F+L     + N      +L+    LD E IK +   + A D G         + V++TD+NDNTP +         +E      KV+ + A D D    +  ++ + I E+S        +F I  +   + +   L      +    V AAD     ++    + + ++D ND+ P   +   S  + EN      V  +TV+D D+G NS+ +             ++  P +NG  K I Q  +   +  + FDREK S Y+  +   D G P  SS   +TI + DENDN P+      +    +   +     + +V A+D D+  N  + Y+I G       F I+HN G+I L +    + K  +   V   D G+P  + +  + + V +  +N+  I       +    +R+
Sbjct:  275 NSPPGHSVLQVRANDADTGANGDIDYSLH-QASDTVQR-LLRIDRSTGIIYVKGLVDREE---------DNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVP------FQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDAD--SGVNAELVYSIIESSA-----ASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVT-------------LFVEP-DNG--KFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGG-NPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGLVGHSLYTPLDRD 819          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 246.899 bits (629), Expect = 1.186e-66
Identity = 244/812 (30.05%), Postives = 378/812 (46.55%), Query Frame = 1
Query:  130 MFKMFWQLFFLYTVV-----KSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTS-AIDREEI--CQPI---SKCLTGAFLNY---------IIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAAD--GEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKI--------LVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            M  + W    L T+V      +  S  +Y  + E Q PN+ IG+L   +     S  +     ++LE       G   + VD K G+I+ T   IDRE +  C+ +    KC    FL +          I    ++ E  IE++DINDN P F     T+ IPEN    + FS+PVA DRDS   GV +Y L +   +      ++ +  +   P + VIG+LDRE   S++ ++   DGG         + + +TD NDN P++    Y  E+ E +     VLQ+ A D D      G I + + + S   + ++RI   T  I+Y+  G +   ++N     V+A D     +S++  + + IKD ND+ P I++    L I +N  + I         V  + V+D D+G N+  +C +     V       S   N  ++K F   +      D E+   Y +E++  D+G P +SS+  + + ++D NDN P F       + +ED + G ++  V+A D+DS  N  + YSII +      F IN N G+I +   LDRE  +RYEF V A D G P+   +  + I V D NDN P+   S YSF + E+    +    +G +  SD D G+N      V   +    IQ    G I+   + DREK       +  +D G+PPR++   V I VLD NDN P  T P  +++ +L  +      + V  VKA D D G+N  + Y +T  N    LF I  + G+I L +    K K   RLVV   D+G P    T  +++
Sbjct:   15 MAVLRWGCLVLLTIVLMVPCGAVPSNNIY-KLSEEQPPNTLIGSLAADL-GLPDSGHL-----YKLE------VGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKC----FLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDAD--TGANGDIDYSLHQASDTVQRLLRIDRST-GIIYVK-GLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVV--AGDVPFQLRPASESANDRKRKYFLQTTT---LLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSII-ESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNP---VGVVTVSDADKGENSQVTLFVEPDNGKFIIQ-NGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSS--PPDTPVEVVKAEDIDAGVNAELYYTITGGN-PHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHV 792          

HSP 2 Score: 132.88 bits (333), Expect = 7.070e-31
Identity = 144/580 (24.83%), Postives = 247/580 (42.59%), Query Frame = 1
Query:  487 LQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQ--GKCRIIVEITDVNDNTP----QWVGLP----YRKEISE---CTTEAKVLQLNAQDKDDPQTI----GGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLY-----FDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGI-NHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQV-YNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDN 2154
            L+I + D NDN P F+ ++   ++PEN           A D D+   G   Y L   S ++       ID    I   + V G +DRE     +F++ A D G N    K ++ + I D NDN P    + +GL     +   ISE     T   ++Q++ +D+ +   +     G + F++   S++     R +++  + L       +  K+ +  IV + +     S+  ++++++ D ND+ P        +   E+ +    V  +  TD D G+N+E   S+ +++  SL                F++NS  G        DRE   RY   V   D G P+ + + I+ I + D NDN P F     +FS++E+    + +G+V   D+D   N+ +T  +  D      F I N  G I  +   DRE +  Y F ++A D G+P  +    + I VLD NDN P ++   +               +  + A D D G N    + +   +     Q+ +N G+I        +      ++V V D G PPR  T  VH+ V +  +N
Sbjct:  249 LRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQR--LLRIDRSTGI---IYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLL----DYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASL----------------FEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPD---NGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 96.6709 bits (239), Expect = 8.348e-20
Identity = 96/349 (27.51%), Postives = 159/349 (45.56%), Query Frame = 1
Query: 1495 IFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-------GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTS-YSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPID--IQVYNEGKIIYF-GNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKF---TYPLLNAHNYL-NITDDMAAGSIVGEVKATDEDFGLN--------GSIIYNLT----NQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIR 2460
            I + D NDN P F +   T SI E+   G    I +A D DS  N +  Y++    +  + FG+           Q+ +   LDRE KD Y+  +   D G+P    S  +RI V D NDN P+   + Y  ++ E+    H    + ++ A+D D G NG   + +   S  +   +++     IIY  G +DRE+ + +   V   D G   +++   V I + D NDN P        L+   N++ NI++DM  G+ V  V+ +D D G N        G + + L     + N  K  + +Q+   +  ++  D       R+ + A D G P+LS+T +L ++
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHS---VLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDY------RIEIVAVDSGNPALSSTNSLKVQ 478          

HSP 4 Score: 91.2781 bits (225), Expect = 4.839e-18
Identity = 144/586 (24.57%), Postives = 236/586 (40.27%), Query Frame = 1
Query:  229 NSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADH------QIFELQIEIIDINDNFPSFQPDEKTIKIPEN-VARSSE---FSLPVA----KDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINP-----YLRVIGDLDRENIKSFEFHLYASDGG--GNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEA-KVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNI-GALKSFKENKASIVVIAADG--EGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNS---IPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKT--FSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHN-GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWERE 1893
            NSP G+ +  ++     T       + L  + S+T  R L+ +D+  G I+V   +DREE               Y++  D          ++ I I D NDN P+ +     + I +N VA  SE      PVA     DRD  +  V    +           F+L     + N      +L+    LD E IK +   + A D G         + V++TD+NDNTP +         +E      KV+ + A D D    +  ++ + I E+S        +F I  +   + +   L      +    V AAD     ++    + + ++D ND+ P   +   S  + EN      V  +TV+D D+G NS+       T FV  D        NG  K I Q  +   +  + FDREK S Y+  +   D G P  SS   +TI + DENDN P+      +    +   +     + +V A+D D+  N  + Y+I G       F I+HN G+I L +    + K  +   V   D G+P  + +  + + V +  +N+  I       +    +R+
Sbjct:  275 NSPPGHSVLQVRANDADTGANGDIDYSLH-QASDTVQR-LLRIDRSTGIIYVKGLVDREE---------DNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVP------FQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDAD--SGVNAELVYSIIESSA-----ASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQV------TLFVEPD--------NG--KFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGG-NPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGLVGHSLYTPLDRD 819          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000005228.2 (pep primary_assembly:ASM223467v1:10:15165018:15172306:-1 gene:ENSORLG00000004176.2 transcript:ENSORLT00000005228.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.483 bits (576), Expect = 3.811e-61
Identity = 194/648 (29.94%), Postives = 302/648 (46.60%), Query Frame = 1
Query:   82 INHLTVRNNL*ILFGLMFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDH--GNNINPYLRVIGDLDRENIKSFEFHLYASDGGG--NQGKCRIIVEITDVNDNTPQWVGLPYRKEISE-CTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGR---SNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCS-LNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIG--DYEVKETFGINHN---GQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWE----REHKHFYIGKLNASDRDIGQNGTFRFRV 1971
            IN   V++ L +LF  +         L        SV+L  SV E   P + +GN+ K   + + + + L+T+ FQ+ + K     +    ++ K G ++V   IDREE+C    +C     +  +I    +++ ++IEI D+ND+ PSF    +T+ I EN      F+L  A D D  K GV      S        YF L+ H  GN I+P L +   LDRE   + E  L A DGG     G   I + + D NDN P +    Y+ +I E     +K+  LN  D DD    G       S  S++ + I+  F I      +++     ++E KA  +   A  +G+   S  + + +E+ D ND+ P I V S    + E+      +  ++V D+D G N E  C  LND  F  LD+ Y         K  + L  +     DRE  S+Y+V ++ +D G P  S+  ++T+++SD NDN PHF + F +  ++E+ K G  IG V A D+D   N  ITYS++      +  T  I+ N   G+I   K  D E    ++F V+A D+G P L+ +  + I VLD NDN P I   YS     + E         +++ K+ A D D G N    + +
Sbjct:    1 INTPVVQSGLQLLFTCL------ALALLDCNSGAASVQLAYSVSEEVNPETNVGNIAK---DLSLNVQDLETRLFQIVASK-----KKYFEINLKTGFLFVNERIDREELCAEEPRC--SVTVEAVINNPLKLYRVEIEIKDVNDHSPSFNTKLQTLDIAENTIPGFRFALSEANDADVGKNGV------SAYKLSQNEYFNLVTHKRGNTISPELVLQKALDREKKANIELLLTAVDGGSPPKSGTSEININVLDSNDNAPIFSSSLYKIQILENVAVGSKIFTLNVTDADD----GTNSEIVYSLRSKDQDHILDAFQIDPETGIISVKGKIDYEERKAFEIRAEARDKGQPPMSAHSKVLVEVIDVNDNTPEITVTSLLSTLNEDADVGTAIALVSVLDQDSGKNGEVKCEILNDVPF-RLDTNY---------KNYYSL--VVNGKLDREVTSKYNVTILVSDEGRPARSNISVVTVYLSDVNDNAPHFPSPFISIYVNENGKTGGVIGKVSAIDADVDTNAKITYSVLATNTSSLLLTTMISANPETGEITSLKSFDYEELKTFQFKVQATDSGVPPLSSNVTVNIFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHL 610          

HSP 2 Score: 145.976 bits (367), Expect = 3.173e-35
Identity = 156/562 (27.76%), Postives = 251/562 (44.66%), Query Frame = 1
Query:  814 RIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLN-AQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEG--RSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSL--NDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVY------NEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLL--NAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSI-QSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYI 2457
            R+ +EI DVND++P +       +I+E T       L+ A D D  +   G   +K+S+N + + ++      T S   +   AL   K+    +++ A DG    +S  + I + + D ND+ P+       ++I EN      +  + VTD D G NSE   SL   D + + LD+    P E G       + S+ G   D E+   + +     D G P MS+   + + + D NDN P         +++EDA +G  I +V   D DS  N  +   I+ D   +      +   + +N  LDREV  +Y  T+   D G P  ++   + + + DVNDN P   + +    V   E       IGK++A D D+  N    + V + +T   +           G+I    + D E++      V   D+G PP ++  TV+I VLD NDN P    P     + N  NI     AG  V +++A D D G N  + Y+L+ +    +LF I  S G+I  K+++         L+V   D G PSLSAT ++ +
Sbjct:  119 RVEIEIKDVNDHSPSFNTKLQTLDIAENTIPGFRFALSEANDADVGK--NGVSAYKLSQN-EYFNLVTHKRGNTISPELVLQKALDREKKANIELLLTAVDGGSPPKSGTSEININVLDSNDNAPIFSSSLYKIQILENVAVGSKIFTLNVTDADDGTNSEIVYSLRSKDQDHI-LDAFQIDP-ETG-------IISVKG-KIDYEERKAFEIRAEARDKGQPPMSAHSKVLVEVIDVNDNTPEITVTSLLSTLNEDADVGTAIALVSVLDQDSGKNGEVKCEILNDVPFRLDTNYKNYYSLVVNGKLDREVTSKYNVTILVSDEGRPARSNISVVTVYLSDVNDNAPHFPSPFISIYVN--ENGKTGGVIGKVSAIDADVDTNAKITYSVLATNTSSLLLTTMISANPETGEITSLKSFDYEELKTFQFKVQATDSGVPPLSSNVTVNIFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLS-EPKGNNLFRIGTSSGEIRTKRRMSDNDLKSHPLLVLVSDNGEPSLSATVSIEV 664          

HSP 3 Score: 84.7297 bits (208), Expect = 4.062e-16
Identity = 85/283 (30.04%), Postives = 146/283 (51.59%), Query Frame = 1
Query: 1669 KETFGIN-HNGQIHLNKILDREV----KDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEG-----KIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNL--TNQNHTKDLFSIQSD-GQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRD 2478
            K+ F IN   G + +N+ +DRE     + R   TVEA  N    L    ++ I + DVND+ P  +T    + ++  E     F      A+D D+G+NG   +++ S++   ++  +  G     +++    +DREK   I++L+  +D G+PP++ T+ ++I VLD NDN P F+  L      + I +++A GS +  +  TD D G N  I+Y+L   +Q+H  D F I  + G I +K K+D + +    +  EARD+G P +SA + + +      D
Sbjct:   73 KKYFEINLKTGFLFVNERIDREELCAEEPRCSVTVEAVINNPLKL---YRVEIEIKDVNDHSPSFNTK--LQTLDIAENTIPGFRFALSEANDADVGKNGVSAYKL-SQNEYFNLVTHKRGNTISPELVLQKALDREKKANIELLLTAVDGGSPPKSGTSEININVLDSNDNAPIFSSSLYK----IQILENVAVGSKIFTLNVTDADDGTNSEIVYSLRSKDQDHILDAFQIDPETGIISVKGKIDYEERKAFEIRAEARDKGQPPMSAHSKVLVEVIDVND 345          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 2010.73 bits (5208), Expect = 0.000e+0
Identity = 1046/1047 (99.90%), Postives = 1046/1047 (99.90%), Query Frame = 1
Query:  130 MFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAXXXXXXXXXXXXXXXXXXXXTIYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPVAIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV 3270
            MFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGI IYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPVAIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV
Sbjct:    1 MFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGIAIYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPVAIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV 1047          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 1985.3 bits (5142), Expect = 0.000e+0
Identity = 1042/1080 (96.48%), Postives = 1043/1080 (96.57%), Query Frame = 1
Query:  139 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAXXXXXXXXXXXXXXXXXXXXTIYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNP------------------------------------VAIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV 3270
            MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGI IYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNP                                    +AIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV
Sbjct:    1 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGIAIYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPGNQFSNRSKWSNLTMRPFLNSFMFIYIVLFMLYDDNMAIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV 1080          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 1984.53 bits (5140), Expect = 0.000e+0
Identity = 1043/1082 (96.40%), Postives = 1043/1082 (96.40%), Query Frame = 1
Query:  139 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAXXXXXXXXXXXXXXXXXXXXTIYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPV--------------------------------------AIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV 3270
            MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGI IYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPV                                      AIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV
Sbjct:    1 MFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIKNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGIAIYIYCRGKGLSRLGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPVLGNQFSNRSKWSNLTMRPFLNSFMFIYIVLFMLYDDNMAIGTFQPYYTNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSAFNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSITNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV 1082          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000009208.1 (SMESG000009208.1)

HSP 1 Score: 458.759 bits (1179), Expect = 8.092e-144
Identity = 276/727 (37.96%), Postives = 431/727 (59.28%), Query Frame = 1
Query:  349 ISVDQKKGDIWVTSAIDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKI--PENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXEN----YFELI---DHGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYT---SPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRV----RSRSTPIDIQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQXXXXXXXXXXXXNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDS 2481
            + ++++ GDI + S  DREE+C  +        +++I+       E  + I D+NDN P F+   K I I   EN A+  +  LP A D DS + G+ +Y +K + +S  +     YF+L+   D  N I P L V+  LDRE ++ F F+L A D     G+C+I + + D+NDN+P W    Y  EI EC+ + ++L+L A D DDP T  G++ ++ISE S++ + I  +F+IT ++L+++I  ++  +     I ++A DG G+S+  TI ++I DCN+++P I++   + +I E E     +T + V+D D+G+N+EF C ++D+    L SM +   SPL   G+  ++ LN+  G+ F+REK +  S+ + C D G P  S+++I+TI + D NDN P F     TFS+ E+  IG  +  V A D+D + N  ++Y I+ D   K+ F IN+ GQI  N  LDRE  D YEF V AKD+G+ +++ SC ++I VLDVND  PE+   + F+I ES      H  +GK+NA+D D G NGT  F++    +       +Q+ ++G++  +GN+DRE    I   + V DNG PP ++TTTV I +LDVNDN+PKF++P ++ +N++N++   +  SI+G V+ATD D G NGSI Y L      K  F +Q  GQ+IL K L  K  NPDRL+++A D G PSL+   TLY+RY+  + S
Sbjct:   13 LEINRRTGDIIIKSIFDREEVCPYLET--DDCKVDFILLYQTTPKEFSLYIKDVNDNSPVFKEKSKQISIHEGENSAQM-KHHLPKAVDLDSSENGIDRYTIKFVDNSKSDENFHEYFKLVNQKDKDNIITPVLHVMKLLDREKVERFSFNLIAWDKKQKSGECKISIIVLDINDNSPIWSNTQYSVEIKECSLQREILKLEAYDLDDPNTENGRVTYEISEKSKSNDKISSLFHITSNMLFVDIMKIRDIESYDFEIEILAKDGSGKSSSKTIYIKILDCNNNKPNIEISQRNPRIFEKEVRSTKLTNVIVSDPDRGVNAEFDCVIDDSLHFQLKSMMSKKISPL--SGRWVLYSLNTSEGVEFNREKQASLSIVITCTDKGLPAQSNTQILTIHVLDINDNKPEFTRHMYTFSVEENIPIGSVVASVKAIDADINENGRVSYEIVSD--PKDMFSINNKGQIQTNNDLDREKVDMYEFQVIAKDHGKESMSSSCTVKIFVLDVNDCKPEVDKQFVFEITESHGYTTIHKNLGKINATDADFGLNGTINFKISHIQQQNQRKNLLQITSDGQLSIYGNVDREVTKSIHTEIIVSDNGRPPLSSTTTVVINILDVNDNKPKFSFPNIHNNNHINLSLQSSVNSILGVVEATDPDNGNNGSITYKLLGGELIKSTFELQQSGQLILIKSLLDKRLNPDRLMIQASDSGNPSLTEMATLYLRYYNNKKS 732          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000066775.1 (SMESG000066775.1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.397e-142
Identity = 303/828 (36.59%), Postives = 454/828 (54.83%), Query Frame = 1
Query:  139 MFWQLFFLYTV-VKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISK-CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVXXXXXXXXXXXXXENYFELIDHGNN---------------INPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSF-KENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFR---VRSRSTPID----------IQVYNEGKIIYFGNIDREXXXXXXXXXXXXXNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDL-FSIQSDGQXXXXXXXXXXX---XNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSK 2517
            MF +L  L    +K   ++ +  SV+EN +    +GN+   +     S+     +S  +++ + ++Y     S+++  GD+ V S +DRE IC+   + C    +L+     D    ++ IEI DINDN P FQ  +K I I EN+   + + LPVA+D+DS KYGVK YY+        EN  + I  GNN               I P L +I ++DRE   SF F L A+D G   G C + V +TDVNDN P+W    Y+  I EC +E  +L+L A D+DDP T  G + +++S+ +++ +++ +IFYI  + L+L    +      N   I + A DG GR NET++++ I+DCNDH PVI + +   K+ EN+K KI++T + V DED+G N  F CSLND+  ++L +     +       I+++ + P   FDREK S Y+VE+ C D G P MSS +  +I I D NDN P F  + K F + E+  IG  +G V A D DSS N  I YSI+      + F I+  G+I      DRE  D YEF V A+DNGEP LNDS  +++ + D+ND  P     Y F+I ES+    K+  + ++ A+D+D+GQNGT ++R   V+    P +          I+V  +G I  +GN+DRE++  I +LV   D+G P  + TTT+ IEVLD+NDN P F +P  N  N++N++ +   G  +  VK  D D G+NG+I ++L N N  ++  F IQS+G+II+   +         PDRL+++A D G    +   TLYIRY     S   SN  S+  K
Sbjct:    1 MFIELDILIIFSIKLVITLNVEFSVDENCRIGHVVGNVYSKLNQLPNSS-----RSSLMKANEKDSY----FSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLD----QDTHAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTI--GNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIAADFGNQTGSCTVTVLVTDVNDNAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKN-----IRFDDNFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNS---NDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISIYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFP-SNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQSEGEIIIAHSMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYIH---SLTNSNPTSIGKK 801          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH12.322e-6829.60protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH14.971e-6829.60protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11Y1.157e-6129.34protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y1.366e-6129.18protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y1.366e-6129.18protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.578e-4026.81FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.578e-3728.33CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
fmi-18.582e-3325.90FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-46.023e-2626.08Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-38.367e-2225.60Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft7.583e-4625.69gene:FBgn0001075 transcript:FBtr0077478[more]
stan1.277e-4426.92gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.277e-4426.92gene:FBgn0024836 transcript:FBtr0300578[more]
stan1.333e-4426.92gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.612e-4426.92gene:FBgn0024836 transcript:FBtr0339463[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.662e-7430.73protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.185e-7330.61protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.11.610e-6928.94protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.793e-6928.89protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.14.717e-6928.89protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.362e-7630.25protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh172.191e-7630.25protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.413e-7630.25protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.566e-7630.25protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh174.091e-7630.25protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh16.930e-6929.60protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh16.930e-6929.60protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh12.029e-6029.28protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11x1.890e-5928.53protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.957e-5928.53protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN1.115e-6729.60Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9BZA8|PC11Y_HUMAN7.829e-6129.49Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA3.270e-6029.47Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR3.299e-6029.47Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6X862|PC11X_GORGO5.946e-6029.61Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S0C61.167e-8028.12Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A3Q3FN096.680e-7531.13Protocadherin 1a OS=Kryptolebias marmoratus OX=370... [more]
A0A3Q2XMI21.099e-7430.76Protocadherin 1a OS=Hippocampus comes OX=109280 PE... [more]
A0A068WE581.203e-7430.06Protocadherin gamma B1 OS=Echinococcus granulosus ... [more]
A0A1L8GVL11.302e-7430.50Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a5.093e-7631.13protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a6.093e-7631.10protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b2.891e-7429.72protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
ENSAMXT00000016369.21.939e-6430.56pep primary_assembly:Astyanax_mexicanus-2.0:8:8904... [more]
ENSAMXT00000035285.11.567e-6131.22pep primary_assembly:Astyanax_mexicanus-2.0:8:8923... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.11.378e-5328.25pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh116.480e-4927.05protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.19.721e-4426.56pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.18.061e-4128.94pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000004042.18.806e-3825.24pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.490e-4927.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482373.631e-4729.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354135.255e-4226.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367079.700e-4231.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.129e-4128.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a4.033e-7531.19protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.038e-7431.19protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b3.181e-6730.05protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b1.186e-6630.05protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
ENSORLT00000005228.23.811e-6129.94pep primary_assembly:ASM223467v1:10:15165018:15172... [more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059440.10.000e+099.90SMESG000059440.1[more]
SMESG000059440.10.000e+096.48SMESG000059440.1[more]
SMESG000059440.10.000e+096.40SMESG000059440.1[more]
SMESG000009208.18.092e-14437.96SMESG000009208.1[more]
SMESG000066775.11.397e-14236.59SMESG000066775.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033622 ID=SMED30033622|Name=Protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3448bp
CAACTATTGGTGAACTGCTGAACGAAATGGACCAATGAAATTTGATATAA
ATTTAAACGTAATTTATGAAAAAATTGCTAAATCAATCATCTGACTGTAA
GAAATAATTTGTAAATTCTATTTGGATTAATGTTCAAAATGTTTTGGCAG
CTATTTTTTTTGTATACAGTTGTGAAATCTGAGTTTTCTGTGAAGTTGTA
CTTATCTGTTGAGGAAAATCAAAAACCGAACAGTCCGATTGGGAATTTGA
TTAAATTAATTCAAAATCAAACGAAATCAACGGAAATTCTAAAAACGAAG
TCGTTTCAATTAGAATCGGAAAAGTCTAATACTTATGGTCGCCATTTAAT
TAGTGTTGACCAGAAAAAAGGTGACATTTGGGTCACGTCTGCTATAGACA
GGGAAGAAATTTGCCAACCAATAAGCAAATGCTTGACAGGCGCTTTTTTG
AACTATATTATTTTTGCTGATCACCAAATTTTCGAATTGCAAATCGAAAT
CATCGATATCAATGATAACTTTCCTTCTTTTCAACCTGATGAAAAAACGA
TTAAAATTCCGGAAAACGTTGCAAGATCATCCGAGTTCTCTTTACCAGTA
GCAAAAGACAGAGACAGTGAAAAGTATGGAGTTAAAAAGTATTATTTAAA
ATCTATCAGCTCATCAATTTATGAAAACTATTTCGAGTTAATTGATCATG
GAAATAATATCAATCCTTATTTGAGAGTAATTGGTGATCTAGATCGAGAA
AACATTAAAAGCTTTGAATTCCATCTTTACGCGAGTGATGGCGGTGGAAA
TCAAGGCAAATGTCGAATCATTGTTGAAATAACCGACGTTAATGACAACA
CTCCCCAATGGGTTGGACTTCCTTATCGAAAAGAAATTTCTGAATGTACT
ACTGAAGCTAAAGTTCTTCAATTAAATGCTCAAGACAAAGACGATCCACA
AACTATTGGAGGACAAATACGATTCAAAATTAGTGAGAATTCCCAGAACT
ACGAAATGATAGTAAGAATATTCTACATTACCGAAAGTATTCTTTATCTG
AATATTGGAGCCTTAAAATCATTCAAGGAAAACAAAGCCTCAATTGTTGT
AATTGCAGCAGATGGAGAAGGCAGAAGTAATGAGACCACCATTGAATTGG
AGATTAAAGATTGCAATGATCATCGGCCGGTAATTAAAGTGCATTCTTCG
AGTTTAAAAATAAAAGAAAATGAAAAGTCAAAGATATTGGTGACAAGAAT
AACGGTAACGGACGAGGATCAAGGGATTAATAGTGAATTTAGTTGTTCAC
TGAATGACACAAATTTTGTTAGTTTGGACTCCATGTACACATCACCGCTG
GAGAATGGAGGCCAGAAAAAGATTTTCCAATTGAACAGTATTCCGGGATT
GTATTTCGATCGTGAAAAAGCCTCTCGATATTCTGTGGAGGTGATCTGCA
ATGACAATGGTACACCAACAATGAGTTCAAGTGAAATCATAACCATTTTT
ATATCAGACGAAAACGATAATCCGCCGCATTTTGAAACTGAATTCAAAAC
CTTTTCCATATCTGAAGATGCAAAGATCGGACATGAAATCGGAATCGTCA
TTGCTAAAGATAGCGATTCGAGTCCAAATAATATAATAACTTATTCGATT
ATTGGGGATTATGAAGTGAAAGAAACTTTCGGTATTAATCACAACGGGCA
AATTCATTTGAACAAGATACTGGATCGAGAAGTGAAAGATCGATATGAAT
TCACAGTCGAAGCAAAAGACAATGGCGAGCCGAATTTGAATGATTCTTGC
AAAATACGAATTATTGTGCTTGACGTCAATGATAACATACCGGAAATCAG
CACATCGTATTCGTTTAAAATTGTTGAAAGCTGGGAGAGAGAACACAAAC
ATTTCTATATTGGAAAACTGAACGCTTCCGATCGAGACATTGGCCAAAAT
GGGACATTCAGATTTCGCGTCAGGTCTAGATCAACGCCAATTGATATTCA
AGTATATAATGAGGGGAAAATCATATATTTTGGCAATATAGATCGCGAAA
AGGTTGACAAAATTGATGTGTTAGTTGATGTCATTGATAATGGAAACCCA
CCTCGGACAGCGACAACCACAGTCCATATTGAAGTGTTGGATGTGAATGA
CAACCGGCCGAAATTCACATATCCATTACTTAATGCACATAATTATCTCA
ATATTACCGACGATATGGCTGCTGGCTCCATTGTTGGTGAAGTTAAAGCT
ACTGATGAGGACTTTGGGCTGAATGGATCAATTATCTACAACTTGACTAA
CCAGAATCACACTAAGGACTTATTTTCCATTCAAAGTGATGGTCAGATTA
TTTTGAAAAAAAAATTGGACACCAAAATTAAAAATCCTGATCGTCTGGTT
GTCGAAGCTCGTGATCAAGGTACACCTTCATTATCGGCAACGACAACTTT
GTATATTCGGTATTTTAAACCAAGGGATTCCTTTGATAGAAGCAATGAAA
ACAGCATGAATTCTAAATACATTAACCCTAAAGATTATCCCAGAACCGTC
AACAAATCTAACGGATTGCCAAATAATGCTATAATTTTGGTACTCCTAGT
TGTTTCTATCATGATGATCGTAATCGTTGTTGGGGGAATAACAATTTACA
TTTACTGCCGCGGAAAAGGATTATCAAGACTAGGTGATAACAATAAACAT
TTGTCAACCAATCGAGATTCAAACAATGTGATTTATCAAAAGGGTTGTTC
TAAAAGCGTCCCAAAAGCTGAAAATCAAATTAATGATACTTACAATCCGG
TGGCCATTGGAACGTTCCAACCATACTACACAAATTTGATGCTGTTAAAA
AATAACTGCTTTCCTCCAATAGACAACTCATATCAGATCAGTCAGACAAT
GCTCACAGACAATTACTTTTCATTCCAGCCGAAATCCAACACTCCAACTC
CCGACAAAGAAAATCAAGAGTTTTCGGCTTTCAATTCCATGGAATCTTGG
AATCCGTCTAAGCATCAAACGTCTAACTTAACTATGCAAGCCCGTAAAAA
GACTTTCAGTGAAAACAGTGATAATTTCTACGAGACTGAACCAGATCATA
AATATGCGTTTATCCATCCGTCGAGCATCACTAATCTTGACATGAACCAT
GAGCTGAACAACATCGGCCATTTCACGACTCCTAGCCAGAGCCGGCGAAA
TGACTTCATTCAGTCAAGATCTGATTCGAATCAAAAGGTGAAAATAAATT
TGGTCAATTCAAGTTTTGTCTAGTAATAAAAGAACATTATTAATTAATTT
TATCATGTTCTCACTTATTTTTTGAATTTAGCGTGTAAAGATGTCGTTGT
CCGATGTAAATAATTGCATTTTTTATTTTTATTTTTTATGTGGTCGATCT
AATATTGCTAATATATTTTTAGAGGATTCTGTCCATTGAAATGGGCAC
back to top

protein sequence of SMED30033622-orf-1

>SMED30033622-orf-1 ID=SMED30033622-orf-1|Name=SMED30033622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1048bp
MFKMFWQLFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKS
TEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPISK
CLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARS
SEFSLPVAKDRDSEKYGVKKYYLKSISSSIYENYFELIDHGNNINPYLRV
IGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYR
KEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYI
TESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRP
VIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLD
SMYTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSS
SEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPN
NIITYSIIGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGE
PNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNAS
DRDIGQNGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDKIDVLVD
VIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGS
IVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKI
KNPDRLVVEARDQGTPSLSATTTLYIRYFKPRDSFDRSNENSMNSKYINP
KDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGITIYIYCRGKGLSR
LGDNNKHLSTNRDSNNVIYQKGCSKSVPKAENQINDTYNPVAIGTFQPYY
TNLMLLKNNCFPPIDNSYQISQTMLTDNYFSFQPKSNTPTPDKENQEFSA
FNSMESWNPSKHQTSNLTMQARKKTFSENSDNFYETEPDHKYAFIHPSSI
TNLDMNHELNNIGHFTTPSQSRRNDFIQSRSDSNQKVKINLVNSSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 223..242
score: 39.8
coord: 72..91
score: 30.63
coord: 134..163
score: 24.42
coord: 211..223
score: 32.87
coord: 661..678
score: 46.21
coord: 521..547
score: 30.35
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 490..571
e-value: 3.8E-24
score: 96.2
coord: 374..466
e-value: 2.2E-14
score: 63.8
coord: 705..781
e-value: 1.3E-5
score: 34.6
coord: 265..350
e-value: 4.5E-7
score: 39.5
coord: 597..677
e-value: 1.6E-15
score: 67.5
coord: 156..242
e-value: 4.3E-11
score: 52.9
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 695..776
e-value: 6.7E-12
score: 45.7
coord: 474..564
e-value: 8.0E-19
score: 67.9
coord: 591..670
e-value: 7.0E-7
score: 29.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 675..787
e-value: 2.9E-21
score: 78.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 242..346
e-value: 2.1E-10
score: 43.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 23..127
e-value: 8.1E-13
score: 50.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 571..674
e-value: 1.7E-20
score: 75.6
coord: 347..463
e-value: 1.5E-18
score: 69.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 464..570
e-value: 3.3E-31
score: 110.1
coord: 128..241
e-value: 3.2E-18
score: 68.2
NoneNo IPR availablePANTHERPTHR24026FAMILY NOT NAMEDcoord: 637..787
coord: 59..290
coord: 422..617
coord: 517..678
coord: 280..519
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 245..352
score: 14.057
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 684..806
score: 17.017
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 135..244
score: 16.031
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 469..573
score: 25.457
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 353..468
score: 17.477
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 573..679
score: 20.437
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 19..134
score: 10.068
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 24..130
e-value: 0.00445101
score: 35.7522
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 248..348
e-value: 1.06624E-4
score: 40.3746
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 358..464
e-value: 6.45183E-15
score: 69.2645
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 689..777
e-value: 7.30832E-18
score: 77.7389
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 576..675
e-value: 1.87192E-18
score: 79.2797
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 474..569
e-value: 1.67648E-30
score: 113.562
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 140..240
e-value: 2.71293E-15
score: 70.4201
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.631
NoneNo IPR availableTMHMMTMhelixcoord: 818..840
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 25..102
e-value: 2.9E-7
score: 30.2
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 667..677
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 122..132
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 232..242
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 456..466
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 561..686
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 122..242
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 456..579
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 346..468
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 667..784
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 238..352