Ornithine decarboxylase

Overview
NameOrnithine decarboxylase
Smed IDSMED30033621
Length (bp)1754
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ornithine decarboxylase (SMED30033621) t-SNE clustered cells

Violin plots show distribution of expression levels for Ornithine decarboxylase (SMED30033621) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ornithine decarboxylase (SMED30033621) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ornithine decarboxylase (SMED30033621) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033621

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30033621h1SMcG0011433 Contig20515newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033621h1SMcG0011433 Contig20515uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033621h1SMcG0011433 Contig42998uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033621h1SMcG0011433 Contig42998newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30033621h1SMcG0011433 dd_Smed_v4_8195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033621h1SMcG0011433 dd_Smed_v4_8195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30033621h1SMcG0011433 dd_Smed_v6_8195_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30033621h1SMcG0011433 dd_Smed_v4_8195_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: ODC1 (ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:8109])

HSP 1 Score: 250.751 bits (639), Expect = 3.390e-76
Identity = 164/450 (36.44%), Postives = 236/450 (52.44%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY-SDR-FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+  +LG I+K+ LRW K LPRV PFYAVKC     +++ LA+ G GFDCAS+ E++L                  S  +  + II+ANP K    + +A + G+Q  TFDSE EL ++ R  P AKL++R++T     A C+L  KFG        LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  ++G++  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+ SD    II+EPG ++V  A+TLA  +I K+ + + +   +                                    DE     + ++Y ++DGVYGSFN             IL  +A +K  +      DEK Y S ++GPTCD LD I    +LPEM VGDW+++ +MGAYT A+ S FNG  +P  YY +S 
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLV----------------QSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSE------DVKLK--FEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQTGSD------------------------------------DEDESSEQTFMYYVNDGVYGSFNC------------ILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSG 411          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: ODC1 (ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:8109])

HSP 1 Score: 250.751 bits (639), Expect = 3.390e-76
Identity = 164/450 (36.44%), Postives = 236/450 (52.44%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY-SDR-FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+  +LG I+K+ LRW K LPRV PFYAVKC     +++ LA+ G GFDCAS+ E++L                  S  +  + II+ANP K    + +A + G+Q  TFDSE EL ++ R  P AKL++R++T     A C+L  KFG        LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  ++G++  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+ SD    II+EPG ++V  A+TLA  +I K+ + + +   +                                    DE     + ++Y ++DGVYGSFN             IL  +A +K  +      DEK Y S ++GPTCD LD I    +LPEM VGDW+++ +MGAYT A+ S FNG  +P  YY +S 
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLV----------------QSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSE------DVKLK--FEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQTGSD------------------------------------DEDESSEQTFMYYVNDGVYGSFNC------------ILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSG 411          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 224.172 bits (570), Expect = 6.636e-66
Identity = 156/463 (33.69%), Postives = 234/463 (50.54%), Query Frame = 3
Query:  237 NREPLRNL-LAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEK-CYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
             R+ L+ L L       D    FF  +LG IV++   + K LPRVRPFYAVKC   P VL++LA LG GF CA++ EMEL           I I         A  II ANP K    + +A  +GIQ  +FD+E EL ++ +  PSAK+++ ++T    S  C L  KFGV+  +   LL+ AK+   ++ GVSFH+G+ C D  A+  ++     V ++ T+LG+   +LD+GGG+PG            +  FE++   +NSALD Y+ +     I +E G ++V  A+T+A  +I K+++          +DQ  P ++  +    +       PS        +E     K  +Y LD+GVYG FN + F          + P   ++   S E+  Y S L+GP  D  DC++    LP++ VGDWLV+ +MGAYT    S F G    +  Y +S 
Sbjct:   19 TRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELV--------QHIGIP--------ASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSC-LSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGA--------KVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEV---------LLDQ--PGREAPLPPPHIATCAASEPS-----PPAEENGSTSKTIVYHLDEGVYGIFNSVLFDN--------ICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSR 432          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 219.55 bits (558), Expect = 2.381e-64
Identity = 156/463 (33.69%), Postives = 232/463 (50.11%), Query Frame = 3
Query:  237 NREPLRNL-LAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEK-CYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
             R+ L+ L L       D    FF  +LG IV++   + K LPRVRPFYAVKC   P VL++LA LG GF CA++ EMEL           I I         A  II ANP K    + +A  +GIQ  +FD+E EL ++ +  PSAK+++ ++T    S  C L  KFGV+  +   LL+ AK+   ++ GVSFH+G+ C D  A+  ++     V ++ T+LG+   +LD+GGG+PG            +  FE++   +NSALD Y+ +     I +E G ++V  A+T+A  +I K+++          +DQ  P ++             EN S   +I             +Y LD+GVYG FN + F          + P   ++   S E+  Y S L+GP  D  DC++    LP++ VGDWLV+ +MGAYT    S F G    +  Y +S 
Sbjct:   19 TRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELV--------QHIGIP--------ASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSC-LSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGA--------KVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEV---------LLDQ--PGREE------------ENGSTSKTI-------------VYHLDEGVYGIFNSVLFDN--------ICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 219.55 bits (558), Expect = 2.381e-64
Identity = 156/463 (33.69%), Postives = 232/463 (50.11%), Query Frame = 3
Query:  237 NREPLRNL-LAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEK-CYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
             R+ L+ L L       D    FF  +LG IV++   + K LPRVRPFYAVKC   P VL++LA LG GF CA++ EMEL           I I         A  II ANP K    + +A  +GIQ  +FD+E EL ++ +  PSAK+++ ++T    S  C L  KFGV+  +   LL+ AK+   ++ GVSFH+G+ C D  A+  ++     V ++ T+LG+   +LD+GGG+PG            +  FE++   +NSALD Y+ +     I +E G ++V  A+T+A  +I K+++          +DQ  P ++             EN S   +I             +Y LD+GVYG FN + F          + P   ++   S E+  Y S L+GP  D  DC++    LP++ VGDWLV+ +MGAYT    S F G    +  Y +S 
Sbjct:   19 TRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELV--------QHIGIP--------ASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSC-LSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGA--------KVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEV---------LLDQ--PGREE------------ENGSTSKTI-------------VYHLDEGVYGIFNSVLFDN--------ICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: odc-1 (Ornithine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:P41931])

HSP 1 Score: 218.779 bits (556), Expect = 5.752e-65
Identity = 137/453 (30.24%), Postives = 230/453 (50.77%), Query Frame = 3
Query:  261 LAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNS-NNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD-RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKR-YIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            +A    + ++  +F  V+L  I+++F  W++ LP + PFYAVKC  D  ++ +LASLG GFDCAS++E                IDI     + A+ II+ANP K +  +  A    ++  TFD+  EL ++ +  P+A++++R++     +A C L  KFG +      +LLK A E   ++ G+SFHVG+ C D SA+ + +++   + ++   LG+   ++D+GGG+PG          +    FEK+   +  ALD ++ D    +I+EPG FF  G ++L   +I   ++  S                                      K+  +P D     Y+Y ++DGVYGSFN + F     +   + + + + K        ++S ++GPTCD+LD +     +P+M+VG+WL + DMGAYT A+ + FNG +KP   Y +S
Sbjct:   29 IAASKDLQENDSSFMLVDLDKIIERFQLWKRELPMIEPFYAVKCNTDLVLIRILASLGCGFDCASKDE----------------IDIVMGTGVSAERIIYANPCKTRSFIAHAMDRDVKMMTFDNPEELLKIAKLHPNAEMILRIAVSDP-TATCPLNLKFGADPIIAAPQLLKTASEEGINVVGISFHVGSGCNDASAYRNALQHAKNLCEIGEGLGFKMDIIDMGGGFPG---------AEHHNPFEKIAETIRDALDEFFPDTNKRLIAEPGRFFAAGPFSLVANIIHATEVPAS--------------------------------------KITKDPKDCADHGYMYYINDGVYGSFNCILFDHAHPIGSPLFDTDRNEK--------FMSTIWGPTCDSLDLVEDKKLMPKMNVGEWLYYPDMGAYTLAAATTFNGFSKPVPMYVMS 409          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3832239:3834124:1 gene:WBGene00018764.1 transcript:F53F10.2a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 96.2857 bits (238), Expect = 7.462e-21
Identity = 114/460 (24.78%), Postives = 186/460 (40.43%), Query Frame = 3
Query:  240 REPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLAS-LGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTF--DSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVG--NMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYY 1604
            R P+     V ++   S Q FF +++  I ++    R +LPRVRP YAV C  DP +  +L++ +   F+ ++  E+EL           +++++E S  +    ++     K   + V AG      +TF  +SE ++  +    P A++++ V               FG + + IE++L  A  L  ++ G+   +G     ED+           E  D           L +     G  SV T  +  +  +F   C  LN+ +D  +       +  G F V  A+TL T VIGKR                           ++DA    N           +  DD   ++Y  +DGVYGSF   Q M+ K L   +   N S      +E+ +   + GPT D  D         ++ VG+WLVW  MGA+T    S+    + P  YYY
Sbjct:   38 RNPIEMARHVAARC-GSYQPFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELEL-----------VSMNVEPSRAVFCSQLMTRKAIK---NAVLAGC-----STFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-----PFGCSVDEIEEILDMAHLLGANVTGIYLELGLRATLEDYITSVHDARSIFETAD--------QKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLFESNIDFSASIGRFLVTNAFTLCTNVIGKR---------------------------AMDAKFITN-----------DDFDDGVGFVYQTNDGVYGSFGCKQ-MDIKPLCKPLDVENDS------EEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEH---SVPPVYYY 416          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3831117:3834124:1 gene:WBGene00018764.1 transcript:F53F10.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 96.2857 bits (238), Expect = 7.462e-21
Identity = 114/460 (24.78%), Postives = 186/460 (40.43%), Query Frame = 3
Query:  240 REPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLAS-LGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTF--DSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVG--NMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYY 1604
            R P+     V ++   S Q FF +++  I ++    R +LPRVRP YAV C  DP +  +L++ +   F+ ++  E+EL           +++++E S  +    ++     K   + V AG      +TF  +SE ++  +    P A++++ V               FG + + IE++L  A  L  ++ G+   +G     ED+           E  D           L +     G  SV T  +  +  +F   C  LN+ +D  +       +  G F V  A+TL T VIGKR                           ++DA    N           +  DD   ++Y  +DGVYGSF   Q M+ K L   +   N S      +E+ +   + GPT D  D         ++ VG+WLVW  MGA+T    S+    + P  YYY
Sbjct:   38 RNPIEMARHVAARC-GSYQPFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELEL-----------VSMNVEPSRAVFCSQLMTRKAIK---NAVLAGC-----STFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-----PFGCSVDEIEEILDMAHLLGANVTGIYLELGLRATLEDYITSVHDARSIFETAD--------QKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLFESNIDFSASIGRFLVTNAFTLCTNVIGKR---------------------------AMDAKFITN-----------DDFDDGVGFVYQTNDGVYGSFGCKQ-MDIKPLCKPLDVENDS------EEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEH---SVPPVYYY 416          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3830562:3834120:1 gene:WBGene00018764.1 transcript:F53F10.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 96.2857 bits (238), Expect = 7.462e-21
Identity = 114/460 (24.78%), Postives = 186/460 (40.43%), Query Frame = 3
Query:  240 REPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLAS-LGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTF--DSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVG--NMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYY 1604
            R P+     V ++   S Q FF +++  I ++    R +LPRVRP YAV C  DP +  +L++ +   F+ ++  E+EL           +++++E S  +    ++     K   + V AG      +TF  +SE ++  +    P A++++ V               FG + + IE++L  A  L  ++ G+   +G     ED+           E  D           L +     G  SV T  +  +  +F   C  LN+ +D  +       +  G F V  A+TL T VIGKR                           ++DA    N           +  DD   ++Y  +DGVYGSF   Q M+ K L   +   N S      +E+ +   + GPT D  D         ++ VG+WLVW  MGA+T    S+    + P  YYY
Sbjct:   38 RNPIEMARHVAARC-GSYQPFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELEL-----------VSMNVEPSRAVFCSQLMTRKAIK---NAVLAGC-----STFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-----PFGCSVDEIEEILDMAHLLGANVTGIYLELGLRATLEDYITSVHDARSIFETAD--------QKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLFESNIDFSASIGRFLVTNAFTLCTNVIGKR---------------------------AMDAKFITN-----------DDFDDGVGFVYQTNDGVYGSFGCKQ-MDIKPLCKPLDVENDS------EEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEH---SVPPVYYY 416          
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Match: Odc1 (gene:FBgn0013307 transcript:FBtr0088863)

HSP 1 Score: 221.861 bits (564), Expect = 2.452e-66
Identity = 148/468 (31.62%), Postives = 229/468 (48.93%), Query Frame = 3
Query:  207 VRTYSKQFNLNREPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSN-NIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD-RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYY 1604
            ++ Y ++ N+ R      +  +  +    Q     +L  + ++   W+KLLPR++PFYAVKC  DP V+ LLA LGAGFDCAS+ E++L           +  D+        + IIFANP +    + +A  + +   T D+E E+Y+L  ++P++ L++R  +  K  A+C LGDKFG +++ +   L+  AK LE  + G SFHVG+ C +  A+   ++    +      LGY+   LDIGGG+PG   V           FEK+   +N+++  ++ D R  II+EPG FFV  A TL  ++  KR+I                      + G LD VM                        Y L+DGVYGSFN + +     +    L+   S+ +         S ++GP+CD LD IS   +LP ++ GD L + +MGAYT    S FNG   P + Y+
Sbjct:    8 IQFYERELNIRR------VIEECDLQRLDQALNICDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLV----------LGFDVSP------ERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEAK-EAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDV----------KFEKIAESVNTSVQRHFPDERVHIIAEPGRFFVAAACTLVCKIHAKREIRN--------------------EAGKLDTVM------------------------YYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHL-------KSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391          
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Match: Odc2 (gene:FBgn0013308 transcript:FBtr0088864)

HSP 1 Score: 194.126 bits (492), Expect = 8.113e-56
Identity = 136/472 (28.81%), Postives = 220/472 (46.61%), Query Frame = 3
Query:  207 VRTYSKQFNLNREPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVN-SNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD-RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKL----YGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYY 1604
            ++ Y ++ N+ +      +  Q+ +    Q     +L  + ++   W KL+PR+ P YAVKC  DP V++ LA LG GFDCAS+ E++L +                   +  + IIFA+P +    + +A    +   T D+E E+Y+L++++P + L++R  +  K  A C LGDK+G +   +   L+  AK L   + G SFHVG+ C +  A+   +E    +  +   +G+   LLD+GGG+PG+            E FE++   +N++++  + D R  IISEPG FFV  AYTL  +V  KR++                      K G LD +M                        Y L+DG++G+F  + +            P         DE   + KL    +GP+CD +D IS    LP ++ GD L + +MGAYT    S FNG   P + ++
Sbjct:    8 IQYYDEELNIRK------VIEQADLEHLDQALNICDLSSLERKLRLWHKLMPRIEPHYAVKCNDDPVVVKFLADLGTGFDCASKNELKLVL----------------GLGVSPERIIFAHPCRPASHLRYAKEQQVVNGTVDNEYEIYKLRKHYPDSNLIVRFKSEAK-KALCPLGDKYGCDAEADAAALMLLAKALGLKVTGTSFHVGSGCSEVEAYDRAIEKAENIFKVGEMIGHKMELLDVGGGFPGIDD----------EMFEEIAQSVNTSVELRFPDKRIRIISEPGRFFVEAAYTLICKVHAKREVRS--------------------KDGKLDTMM------------------------YYLNDGIFGAFAGMFYY-----------PEEVAPELYLDEAESLPKLKSVIWGPSCDAMDKISDLL-LPNLNPGDLLGFRNMGAYTMPIASPFNGFDVPETRFF 390          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 264.618 bits (675), Expect = 1.168e-81
Identity = 166/450 (36.89%), Postives = 243/450 (54.00%), Query Frame = 3
Query:  270 QSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +S + D +  F+  +LG ++K+ LRW ++LPR+ PFYAVKC     V+  LASLGAGFDCAS+ E+++          S+ +D           II+ANP K    + +A ++G+Q  TFDSE EL ++ R   +AKL++R++T     A C+L  KFG    +   LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  +LGYN +LLDIGGG+PG        + KL+  FE++   +N ALD Y+       II+EPG ++V  AYTLA  +I K+ I + + + +   ++   S DRT+                                +Y ++DGVYGSFN + +     L      P         DE+ Y   ++GPTCD LD I    +LP+M VGDWL++ +MGAYT A+ S FNG  KP+ YY +S 
Sbjct:   30 ESSLSDDKDAFYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQIV--------QSVGVD--------PSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPGSE------DTKLK--FEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVIMKEQSASD---EEEDVSNDRTL--------------------------------MYYVNDGVYGSFNCILYDHAHVLPTLHKKPK-------PDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 264.618 bits (675), Expect = 1.168e-81
Identity = 166/450 (36.89%), Postives = 243/450 (54.00%), Query Frame = 3
Query:  270 QSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +S + D +  F+  +LG ++K+ LRW ++LPR+ PFYAVKC     V+  LASLGAGFDCAS+ E+++          S+ +D           II+ANP K    + +A ++G+Q  TFDSE EL ++ R   +AKL++R++T     A C+L  KFG    +   LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  +LGYN +LLDIGGG+PG        + KL+  FE++   +N ALD Y+       II+EPG ++V  AYTLA  +I K+ I + + + +   ++   S DRT+                                +Y ++DGVYGSFN + +     L      P         DE+ Y   ++GPTCD LD I    +LP+M VGDWL++ +MGAYT A+ S FNG  KP+ YY +S 
Sbjct:   30 ESSLSDDKDAFYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQIV--------QSVGVD--------PSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPGSE------DTKLK--FEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVIMKEQSASD---EEEDVSNDRTL--------------------------------MYYVNDGVYGSFNCILYDHAHVLPTLHKKPK-------PDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 264.618 bits (675), Expect = 1.168e-81
Identity = 166/450 (36.89%), Postives = 243/450 (54.00%), Query Frame = 3
Query:  270 QSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +S + D +  F+  +LG ++K+ LRW ++LPR+ PFYAVKC     V+  LASLGAGFDCAS+ E+++          S+ +D           II+ANP K    + +A ++G+Q  TFDSE EL ++ R   +AKL++R++T     A C+L  KFG    +   LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  +LGYN +LLDIGGG+PG        + KL+  FE++   +N ALD Y+       II+EPG ++V  AYTLA  +I K+ I + + + +   ++   S DRT+                                +Y ++DGVYGSFN + +     L      P         DE+ Y   ++GPTCD LD I    +LP+M VGDWL++ +MGAYT A+ S FNG  KP+ YY +S 
Sbjct:   30 ESSLSDDKDAFYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQIV--------QSVGVD--------PSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPGSE------DTKLK--FEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVIMKEQSASD---EEEDVSNDRTL--------------------------------MYYVNDGVYGSFNCILYDHAHVLPTLHKKPK-------PDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 186.422 bits (472), Expect = 2.201e-52
Identity = 134/451 (29.71%), Postives = 205/451 (45.45%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDR--FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +  Q +  +  F   +LG +++Q + W+  +P VRPFY V C   P V+ELL++LG GF CA++ E  L +                S+ +  +NII +   K    +  A   GI     ++E EL ++ R  P AKLL++VST  +     +     G +      LL+ AKEL   +AGV+F V   C+D  A+   +     + D+  +LG++  +LDIGGG+ G     ++F++K           +   L+ Y+      +II+EPG FFV   +TLA  VIGK+                                      NLH+         D   ++Y ++DGVYGSF    F         I  P+    +   DE  + S L+GP+CD LD +     LPE+ VGDWLV+ +MGA      + F+   +P  YY IS 
Sbjct:   29 IYEQNLAEKNAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLVL----------------SHDVPPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVSTEAQIE---EASVTIGCSLKGCRHLLELAKELNVSVAGVTFQVPASCKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSG-----SEFQLKQVHSV------IRPLLEAYFPSESGVSIIAEPGNFFVFSCFTLAVNVIGKKAAYR----------------------------------NLHTSTHDKLTSSDAPEFVYYMNDGVYGSFMGRLFGNI------ISTPSVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTIST 409          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 186.422 bits (472), Expect = 2.201e-52
Identity = 134/451 (29.71%), Postives = 205/451 (45.45%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDR--FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +  Q +  +  F   +LG +++Q + W+  +P VRPFY V C   P V+ELL++LG GF CA++ E  L +                S+ +  +NII +   K    +  A   GI     ++E EL ++ R  P AKLL++VST  +     +     G +      LL+ AKEL   +AGV+F V   C+D  A+   +     + D+  +LG++  +LDIGGG+ G     ++F++K           +   L+ Y+      +II+EPG FFV   +TLA  VIGK+                                      NLH+         D   ++Y ++DGVYGSF    F         I  P+    +   DE  + S L+GP+CD LD +     LPE+ VGDWLV+ +MGA      + F+   +P  YY IS 
Sbjct:   29 IYEQNLAEKNAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLVL----------------SHDVPPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVSTEAQIE---EASVTIGCSLKGCRHLLELAKELNVSVAGVTFQVPASCKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSG-----SEFQLKQVHSV------IRPLLEAYFPSESGVSIIAEPGNFFVFSCFTLAVNVIGKKAAYR----------------------------------NLHTSTHDKLTSSDAPEFVYYMNDGVYGSFMGRLFGNI------ISTPSVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTIST 409          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 259.61 bits (662), Expect = 6.515e-80
Identity = 168/444 (37.84%), Postives = 237/444 (53.38%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            D +  F+  +LG IVK+ +RW K LPRV PFYAVKC     +++ L+ LGAGFDCAS+ E++L          SI +  E         II+ANP K    + +A S G++K TFDSE EL ++ R  P+AKL++R++T     A C+L  KFG        LL++AKEL  DI GVSFHVG+ C D   +   V     V D+  +LG+N  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+      TII+EPG ++V  A+TLA  +I K+ +   +   +   D+   + D+T+                                +Y ++DGVYGSFN + F       +    P         DE  Y S ++GPTCD LD I    +LPE+ VGDW+++ +MGAYT A+ S FNG  +P  YY +S
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLV--------QSIGVSSE--------RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSE------DVKLK--FEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVMVNEQSGSD---DEEDAANDKTL--------------------------------MYYVNDGVYGSFNCILFDHAHVKPVLTKKPKP-------DESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMS 411          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 259.996 bits (663), Expect = 8.703e-80
Identity = 168/444 (37.84%), Postives = 237/444 (53.38%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            D +  F+  +LG IVK+ +RW K LPRV PFYAVKC     +++ L+ LGAGFDCAS+ E++L          SI +  E         II+ANP K    + +A S G++K TFDSE EL ++ R  P+AKL++R++T     A C+L  KFG        LL++AKEL  DI GVSFHVG+ C D   +   V     V D+  +LG+N  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+      TII+EPG ++V  A+TLA  +I K+ +   +   +   D+   + D+T+                                +Y ++DGVYGSFN + F       +    P         DE  Y S ++GPTCD LD I    +LPE+ VGDW+++ +MGAYT A+ S FNG  +P  YY +S
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLV--------QSIGVSSE--------RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSE------DVKLK--FEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVMVNEQSGSD---DEEDAANDKTL--------------------------------MYYVNDGVYGSFNCILFDHAHVKPVLTKKPKP-------DESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMS 411          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 259.61 bits (662), Expect = 1.580e-79
Identity = 168/444 (37.84%), Postives = 237/444 (53.38%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            D +  F+  +LG IVK+ +RW K LPRV PFYAVKC     +++ L+ LGAGFDCAS+ E++L          SI +  E         II+ANP K    + +A S G++K TFDSE EL ++ R  P+AKL++R++T     A C+L  KFG        LL++AKEL  DI GVSFHVG+ C D   +   V     V D+  +LG+N  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+      TII+EPG ++V  A+TLA  +I K+ +   +   +   D+   + D+T+                                +Y ++DGVYGSFN + F       +    P         DE  Y S ++GPTCD LD I    +LPE+ VGDW+++ +MGAYT A+ S FNG  +P  YY +S
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLV--------QSIGVSSE--------RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSE------DVKLK--FEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVMVNEQSGSD---DEEDAANDKTL--------------------------------MYYVNDGVYGSFNCILFDHAHVKPVLTKKPKP-------DESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMS 411          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: slc20a2 (solute carrier family 20 (phosphate transporter), member 2 [Source:Xenbase;Acc:XB-GENE-1015057])

HSP 1 Score: 243.817 bits (621), Expect = 1.171e-73
Identity = 168/460 (36.52%), Postives = 246/460 (53.48%), Query Frame = 3
Query:  234 LNREPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            + R+ +  ++   SQ  D +  FF  +LG +VK+ LR+ K LPRV+PFYAVKC     V+++LA LGAGFDCAS+ E+EL              DI     +  + II+ANP K    + FA   G+Q  TFD+E EL ++ R  P+A++++R++T    S+  +L  KFG    +  +LL+ AK L  D+ GVSFHVG+ C D  A+   +     V ++ ++ GYN  LLDIGGG+PG      D +++    FE+M   +N ALD Y+ +     II+EPG ++V  A++LA  +I K+++          ++ S          GS D    EN  N              K  +Y ++DGVYGSFN L F       I    P+        D+  Y S L+GPTCD LD I+    LPE  VGDWL++ +MGAYT A+ S+FNG  +   +Y +
Sbjct:   18 MARDLMEEIINEVSQTED-RDAFFVADLGDVVKKHLRFLKALPRVKPFYAVKCNSSRGVVKILAELGAGFDCASKTEIELV------------QDI----GVTPERIIYANPCKQISQIKFAAKTGVQMMTFDNEVELSKVSRNHPNARMVLRIATDDSKSS-ARLSVKFGAPLKSCRRLLEMAKNLSVDVIGVSFHVGSGCTDSKAYTQAIADARLVFEMASEFGYNMWLLDIGGGFPGTE----DSKIR----FEEMAGVINPALDLYFPEGSDVQIIAEPGRYYVTSAFSLAVNIIAKKEV---------LMEHS----------GSDDE---ENGPN--------------KNIMYYVNDGVYGSFNCLVFDHAHPKPILHKKPS-------PDQPLYTSSLWGPTCDGLDQIAENLLLPEHHVGDWLLFENMGAYTIAASSNFNGFQQSPVHYAM 408          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:Xenbase;Acc:XB-GENE-979047])

HSP 1 Score: 218.779 bits (556), Expect = 1.116e-64
Identity = 138/443 (31.15%), Postives = 225/443 (50.79%), Query Frame = 3
Query:  291 QQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            Q  F+  +LG I ++  R+ K LPRV+PFYAVKC    +VL++LA+LG GFDCAS  E                ID+     + A +I++ANP K    + +A ++G+ K TFD E EL+++  + P A++++R++T  +  A C L  K+G      E LLK AK L   + GVSFH G+ C++  ++   +E   +V ++  KLGY   LLDIGGG+ G S        + +  FE+    +  +L+ Y+ +     IISEPG ++V  A+T+A  +I K+++ E + +                                             +++ YIL+DGVYG+F         F L+        +   + D+K + S L+GPTC  +D +     LPE++ GDW+++ +MGAY+ +  + FNG  +P  Y+ + +
Sbjct:   30 QDAFYVADLGDIKQKHWRFMKELPRVKPFYAVKCNSTNEVLQMLATLGTGFDCASMGE----------------IDMVLRMGVPAADIVYANPCKQVSHIKYAAAHGVCKMTFDCEAELFKIAAFHPKAEMILRIATDDR-DAWCALSSKYGALVEQCEDLLKTAKNLNIQVIGVSFHTGSGCKNTHSFCKAIEDARKVFEIGKKLGYQMRLLDIGGGFSGNS--------EFRPTFEEFADVIRQSLNQYFPNNKEVEIISEPGRYYVESAFTVALNIITKKEVYEKDGNSR-------------------------------------------RKFSYILNDGVYGTF-------LDFYLVKEKQKLKPLLGKVCDQKLFPSNLWGPTCTNVDKLVNEFYLPELETGDWVIFPNMGAYSISMSTTFNGFPQPKVYFVLKS 397          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Odc1 (ornithine decarboxylase, structural 1 [Source:MGI Symbol;Acc:MGI:97402])

HSP 1 Score: 260.766 bits (665), Expect = 3.297e-80
Identity = 169/449 (37.64%), Postives = 239/449 (53.23%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY-SDR-FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            D +  F+  +LG I+K+ LRW K LPRV PFYAVKC     ++  LA++G GFDCAS+ E++L                     + A+ +I+ANP K    + +A S G+Q  TFDSE EL ++ R  P AKL++R++T     A C+L  KFG        LL++AKEL  D+ GVSFHVG+ C D   +   V     V D+ T++G++  LLDIGGG+PG        + KL+  FE++   +N ALD Y+ SD    II+EPG ++V  A+TLA  +I K+ + + +           P  D                         DE   + + ++Y ++DGVYGSFN             IL  +A +K  +      DEK Y S ++GPTCD LD I    NLPEM VGDW+++ +MGAYT A+ S FNG  +PN YY +S
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLV----------------QGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSE------DTKLK--FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQ-----------PGSD-------------------------DEDESNEQTFMYYVNDGVYGSFNC------------ILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMS 410          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Ldc1 (leucine decarboxylase 1 [Source:MGI Symbol;Acc:MGI:2685699])

HSP 1 Score: 206.068 bits (523), Expect = 7.738e-60
Identity = 147/447 (32.89%), Postives = 213/447 (47.65%), Query Frame = 3
Query:  279 IIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDR--FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCI-SPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            I   Q  F   +L  +V +   + + LPRV+PFYAVKC  +P VL +LA+LG GFDCASQ E+E            + + +  S       IIFANP K    + FA   G+Q  TFD+E EL +L RY P A+L++R+ T    S    L  KFG +      LL+ A+EL   + G SFHVG+ C    ++   +  C  V ++  K G++ +LLD+GGG+PG+           +  FE++   +N+AL  Y+ +     +I+EPG F+     T A  +I                          VK  SLD                       ++  Y L++G YG F +  F+      I I+     +K F S+   +   LYGPTCD  D + S    LPE+DVGDWL++ DMGAY+++  S FNG      Y  +S
Sbjct:   45 ISGRQDAFMVADLDVLVSRHRTFLQALPRVQPFYAVKCNSNPWVLLVLAALGTGFDCASQGELE----------QVLGLGVAPS------RIIFANPCKAVSHIQFAARCGVQLLTFDNEEELIKLARYHPRARLVLRIQTLDSQST-FPLHTKFGAHLEACGHLLQVARELGLAVVGASFHVGSDCHTPESYRQAIADCHRVFEMGCKAGHHMSLLDLGGGFPGVKGS--------EAKFEEVARVINTALAQYFPEETGIEVIAEPGRFYAGSVCTAAVNII--------------------------VKKSSLDP-------------------GGHRKLAYYLNEGHYGVFRL--FLRDPVPRIPIV-----VKEFPSEPPLFPCTLYGPTCDAYDRLFSTEVQLPELDVGDWLIFPDMGAYSSSMSSTFNGFPIATVYDAMS 414          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin2 (antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:2442093])

HSP 1 Score: 205.682 bits (522), Expect = 2.740e-59
Identity = 144/463 (31.10%), Postives = 227/463 (49.03%), Query Frame = 3
Query:  237 NREPLRNLLAVQSQIIDSQ-QTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASI-KNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
             R+ L  L    SQ    +   FF  +LG +V++   + K LPRVRPFYAV C     VL++LA LG GF CA++ EMEL           I +         A  II ANP K    + +A  +G++  +FD+E EL ++ +  PSAK+++ ++T+   S    L  +FG +  +   LL+ AK+   ++ GVSFH+G+ C D  A+  ++     V  +  +LG+   +LD+GGG+PGL           +  FE+M   +NSALD Y+ +     I++E G ++V  A+T+A  ++ KR++          +DQ+     R  + G+                         K  +Y LD+GVYG FN + F            P  ++ K   +D+  Y S L+GP  +  DC++    LP++ VGDWLV+ +MGAYT  ++S   G       Y +S 
Sbjct:   19 TRDLLEELTLGASQATSGKVAAFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELV--------QHIGVP--------ASKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLN-HLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPGLEGA--------KVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKREV----------LDQA----SREEQTGAAP-----------------------KSIVYYLDEGVYGVFNSVLFDN--------TCPTPALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAMSR 411          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin2 (antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:2442093])

HSP 1 Score: 205.682 bits (522), Expect = 2.740e-59
Identity = 144/463 (31.10%), Postives = 227/463 (49.03%), Query Frame = 3
Query:  237 NREPLRNLLAVQSQIIDSQ-QTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASI-KNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
             R+ L  L    SQ    +   FF  +LG +V++   + K LPRVRPFYAV C     VL++LA LG GF CA++ EMEL           I +         A  II ANP K    + +A  +G++  +FD+E EL ++ +  PSAK+++ ++T+   S    L  +FG +  +   LL+ AK+   ++ GVSFH+G+ C D  A+  ++     V  +  +LG+   +LD+GGG+PGL           +  FE+M   +NSALD Y+ +     I++E G ++V  A+T+A  ++ KR++          +DQ+     R  + G+                         K  +Y LD+GVYG FN + F            P  ++ K   +D+  Y S L+GP  +  DC++    LP++ VGDWLV+ +MGAYT  ++S   G       Y +S 
Sbjct:   19 TRDLLEELTLGASQATSGKVAAFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELV--------QHIGVP--------ASKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLN-HLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPGLEGA--------KVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKREV----------LDQA----SREEQTGAAP-----------------------KSIVYYLDEGVYGVFNSVLFDN--------TCPTPALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAMSR 411          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin1 (antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:1859169])

HSP 1 Score: 203.756 bits (517), Expect = 1.108e-58
Identity = 143/451 (31.71%), Postives = 222/451 (49.22%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASI-KNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            V    +  +  FF  +LG IVK+  +W+ ++ +++PFY VKC   P VLE+LA+LG GF C+S+ EM L                     +  +NIIF +P K    + +A   G+   T D+E EL ++ R  P+AK+L+ ++T      +     KFG    N   LL+ AKEL+  I GV FHV + C+++  +   +     V D+  + G+   +LDIGGG+ G        E++L+E    +   ++  LD Y+ +     IISEPG+++V  A+TLA  +I K+ +E  ++S                K GS                  DEP      ++Y ++DGVYGS        F   L   LN    + K +  DE  + S L+GP+CD LD I  +  LPE++VGDWL++ +MGA +    S FN   +P  Y+ +S
Sbjct:   29 VYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALV----------------QELGVSPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGE-DGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGT-------EIQLEE----VNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS------------GVEKNGS------------------DEPA-----FVYYMNDGVYGS--------FASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMS 408          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P00860|DCOR_MOUSE (Ornithine decarboxylase OS=Mus musculus OX=10090 GN=Odc1 PE=1 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 2.306e-79
Identity = 169/449 (37.64%), Postives = 239/449 (53.23%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY-SDR-FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            D +  F+  +LG I+K+ LRW K LPRV PFYAVKC     ++  LA++G GFDCAS+ E++L                     + A+ +I+ANP K    + +A S G+Q  TFDSE EL ++ R  P AKL++R++T     A C+L  KFG        LL++AKEL  D+ GVSFHVG+ C D   +   V     V D+ T++G++  LLDIGGG+PG        + KL+  FE++   +N ALD Y+ SD    II+EPG ++V  A+TLA  +I K+ + + +           P  D                         DE   + + ++Y ++DGVYGSFN             IL  +A +K  +      DEK Y S ++GPTCD LD I    NLPEM VGDW+++ +MGAYT A+ S FNG  +PN YY +S
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLV----------------QGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSE------DTKLK--FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQ-----------PGSD-------------------------DEDESNEQTFMYYVNDGVYGSFNC------------ILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMS 410          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27118|DCOR_CHICK (Ornithine decarboxylase (Fragment) OS=Gallus gallus OX=9031 GN=ODC1 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 3.451e-78
Identity = 173/450 (38.44%), Postives = 242/450 (53.78%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+  +LG IVK+ +RW K LPRV PFYAVKC     V++ LA LGAGFDCAS+ E++L          SI +  E         II+ANP K    +  A + G++  TFDSE EL ++ R  P AKLL+R++T     A C+L  KFG        LL++AKEL+  I GVSFHVG+ C D   +   +     V D+  +LG+N  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+      TII+EPG ++V  A+TLA  +I K+                I S+++T   GS D                ++ V+D K  +Y ++DGVYGSFN             IL  +A +K  +      D+ CY   ++GPTCD LD I    N+PE+ VGDW+++ +MGAYT A+ S FNG  +P  +Y +S 
Sbjct:   25 DDKDAFYVADLGDIVKKHMRWHKALPRVTPFYAVKCNDSEAVVKTLAVLGAGFDCASKTEIQLV--------QSIGVPPE--------RIIYANPCKQLSQIKHAANSGVRMMTFDSEVELMKIARPHPKAKLLLRITTDDS-KAVCRLSVKFGATLKTSRLLLERAKELDLAIVGVSFHVGSGCTDPETFVQAISDARCVFDMGAELGFNMYLLDIGGGFPGSE------DVKLK--FEEITSVINPALDKYFPLDSEVTIIAEPGRYYVASAFTLAVNIIAKK----------------IVSKEQT---GSDD----------------EDDVND-KTLMYYVNDGVYGSFNC------------ILYDHAHVKPVLQKRPKPDDGCYSCSIWGPTCDGLDRIVERCNMPELQVGDWILFENMGAYTVAAASTFNGFQRPTIHYVMSR 401          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27119|DCOR_MUSPA (Ornithine decarboxylase OS=Mus pahari OX=10093 GN=Odc1 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 4.762e-78
Identity = 169/450 (37.56%), Postives = 237/450 (52.67%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY-SDR-FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+  +LG I+K+ LRW K LPRV PFYAVKC     ++  LA+ G GFDCAS+ E++L                     +  + II+ANP K    + +A S G+Q  TFDSE EL ++ R  P AKL++R++T     A C+L  KFG        LL++AKEL  D+ GVSFHVG+ C D   +   V     V D+ T++G++  LLDIGGG+PG        + KL+  FE++   +N ALD Y+ SD    II+EPG ++V  A+TLA  +I K+ + + +           P  D                         DE   + + ++Y ++DGVYGSFN             IL  +A +K  +      DEK Y S ++GPTCD LD I    NLPEM VGDW+++ +MGAYT A+ S FNG  +PN YY +S 
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAATGTGFDCASKTEIQLV----------------QGLGVPPERIIYANPCKQVSQIKYAASSGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEVGFSMYLLDIGGGFPGSE------DTKLK--FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQ-----------PGSD-------------------------DEDESNEQTFMYYVNDGVYGSFNC------------ILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSR 411          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27117|DCOR_BOVIN (Ornithine decarboxylase OS=Bos taurus OX=9913 GN=ODC1 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 6.471e-78
Identity = 169/450 (37.56%), Postives = 239/450 (53.11%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY-SDR-FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFIS-----DEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+  +LG I+K+ LRW K LPRV PFYAVKC     +++ LA++G GFDCAS+ E++L                  S  +  + II+ANP K    + +A + G+Q  TFDSE EL ++ R  P AKL++R++T     A C+L  KFG        LL++AKEL+ D+ GVSFHVG+ C D   +   +     V D+  ++G+N  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+ SD    II+EPG ++V  A+TLA  +I K+ + + +       D    S DRT                                ++Y ++DGVYGSFN             IL  +A +K  +      DEK Y S ++GPTCD LD I    NLPEM VGDW+++ +MGAYT A+ S FNG  +P  YY +S 
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLV----------------QSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPGSE------DVKLK--FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQTGS----DDEEESTDRT--------------------------------FMYYVNDGVYGSFNC------------ILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSG 411          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27120|DCOR1_XENLA (Ornithine decarboxylase 1 OS=Xenopus laevis OX=8355 GN=odc1-a PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 2.388e-77
Identity = 166/444 (37.39%), Postives = 235/444 (52.93%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYIS 1610
            D +  F+  + G IVK+ +RW K LPRV PFYAVKC     +++ L+ LGAGFDCAS+ E++L          SI +  E         II+ANP K    + +A S G++K TFDSE EL ++ R  P+AKL++R++T     A C+L  KFG        LL++AKEL  DI GVSFHVG+ C D   +   V     V D+  +LG+N  LLDIGGG+PG        +VKL+  FE++   +N ALD Y+       II+EPG ++V  ++TLA  +I K+ +   +   +   D+   + D+T+                                +Y ++DGVYGSFN + F       +    P         DEK Y S ++GPTCD LD I     LPE+ VGDW+++ +MGAYT A+ S FNG  +P  YY +S
Sbjct:   35 DDKDAFYVADFGDIVKKHVRWFKALPRVTPFYAVKCNDGKAIVKTLSILGAGFDCASKTEIQLV--------QSIGVSPE--------RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSE------DVKLK--FEEITSVINPALDKYFPADSGVKIIAEPGRYYVASSFTLAVNIIAKKVMVNEQSGSD---DEEDAANDKTL--------------------------------MYYVNDGVYGSFNCILFDHAHVKPVLTKKPK-------PDEKFYSSSIWGPTCDGLDRIVERFELPELQVGDWMLFENMGAYTVAAASTFNGFQRPTLYYVMS 411          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A3S1BU50 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_003480 PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 4.540e-83
Identity = 166/447 (37.14%), Postives = 248/447 (55.48%), Query Frame = 3
Query:  288 SQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSV-ITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCY--VSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            S   FF  ++G I+K+ ++WR++LPRV PFYAVKC  D  V++ L +LG GFDCAS+ E+   + +                 +    II+ANP K K  + +A  +G+   TFD+E EL ++K  +P A+L++R+    +   +CQLG+KFG + +N  KLL KA+EL  ++ G+SFHVG+  E+  A+   V    +V DL   +G+N TLLD+GGG+PG  S  IT         FE++ I LN ALD Y+  S    II+EPG ++V  A+TL   +I KR +   +            S+D    +GS D        N  ++ + DEP      ++Y L+DGVYGSFN L +             +A ++  + ++  Y   S ++GPTCD LDCI     LPEM+VG W+ +++MGAYT  + S FNGI +PN  Y  ++
Sbjct:   39 SDDAFFICDVGDIIKKDIKWREMLPRVSPFYAVKCNTDETVIKTLVTLGLGFDCASKGEIAQVMKH----------------GVSPSRIIYANPCKQKSFVKYAAKHGVDLMTFDNEAELIKIKDVYPEARLVLRILPTTQVQVRCQLGNKFGCHPDNALKLLMKAQELNLNVMGISFHVGSGVEEAKAFSCAVHQARDVWDLALDMGFNMTLLDVGGGFPGQKSAPIT---------FEEIAIVLNDALDYYFPKSSGVEIIAEPGRYYVASAFTLTCNIIAKRTVARDK------------SEDDAFIVGSPDG------HNKQNLSLNDEP-----SHMYYLNDGVYGSFNSLMY------------DHAKVEPCVFNDSLYSFTSSVWGPTCDGLDCIMQECRLPEMEVGQWMYFLEMGAYTLCAGSTFNGIPRPNCLYVCAS 425          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A1Y1WDB3 (Ornithine decarboxylase OS=Linderina pennispora OX=61395 GN=DL89DRAFT_245041 PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 3.546e-82
Identity = 160/444 (36.04%), Postives = 241/444 (54.28%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKC---YVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYY 1601
            D++  FF  +LG + +QF RW + LPRV+PF+AVKC PDP V++LL  LGAGFDCAS+ E++  +    +                  NI++A+P K    + FA +  +   TFD+  ELY+L++ +P AK ++R+ T    S  CQLG KFG   +  ++LL  AK+L  ++ GVSFHVG+ C+   A+ D V    +V D    LG+N  LLDIGGG+PG               FE +   L +A+D Y++D     II+EPG +FV  A+TLA  ++ +RQ+          ++ + P+ D             ENP+                 ++Y ++DGVYGSFN + F + +  +  +L  N+   N  +D +    + S ++GPTCD++DCI P+  LPE+ +GDWLV+  MGAYTN + S FNG    +  Y
Sbjct:   21 DAEDAFFVADLGEVARQFYRWVRHLPRVQPFFAVKCNPDPLVIKLLHRLGAGFDCASKAEIQQVLGEGAQ----------------PSNIVYAHPCKPASHLRFAKANDVAMMTFDNADELYKLQQQYPGAKAILRILTDDSHSL-CQLGLKFGAALDTTQRLLATAKQLGINVVGVSFHVGSGCQSEHAFSDAVMRARQVFDQAAALGFNLELLDIGGGFPGRGDASG-------LAFEDVARVLTAAIDKYFADMPSLRIIAEPGRYFVASAFTLAVNIVARRQVG--------VLNNTAPTGD-------------ENPA-----------------FMYYVNDGVYGSFNCIMF-DHQHPVPRVLTANSQFINAPADAQLGMMFESSVWGPTCDSIDCIMPSGMLPELQIGDWLVFDGMGAYTNCAASRFNGFRLSDMVY 401          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: B5LVY4 (Ornithine decarboxylase OS=Saccoglossus kowalevskii OX=10224 GN=odc PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.037e-80
Identity = 174/449 (38.75%), Postives = 241/449 (53.67%), Query Frame = 3
Query:  261 LAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYY 1601
            +AV   + +    FF ++ G IV +F +W  LLPRV PFYAVKC  +P VL LLA+LG GFDCAS+ E++                  T   +    I++ANP K    + FA    +   TFD+E EL ++++ +P A+L++R+ T    +A+CQLG K+G +  +   LL+ AKEL  ++ GVSFHVG+ C D SA+ D ++    V D  + LG++  LLDIGGGYPG SS            FE+M   +N ALD ++ +     IISEPG +FV  A+TL   VI KR +      Q F++             GS D V     +N  +    DEP      Y+Y  +DGVYGSFN L F          + P+   K  + + K + S L+GP+CD LD I     LPE+ VGDW+V+ DMGAYT  + S FNG  KP  YY
Sbjct:   30 IAVIHDLEEKDDAFFVMDFGDIVNKFEKWEALLPRVHPFYAVKCNENPAVLRLLAALGTGFDCASKSEIKEI----------------TDMGVSPSRIVYANPCKPNSHLKFAAQRKVSLMTFDNEMELQKIRKIYPDAELVLRILTDDS-TAQCQLGLKYGCHPQHAPSLLRVAKELGLNVVGVSFHVGSGCRDASAFSDAIQSSRMVFDYGSALGFDFQLLDIGGGYPGQSSAAI--------SFEEMAGCINQALDVHFPEGCGVRIISEPGRYFVASAFTLTLNVIAKRAVARD--IQTFHVP------------GSEDLV-----ANTVAPSQCDEPA-----YMYYCNDGVYGSFNCLLFDH------ATVQPSLLKKMLLGEPK-FASSLWGPSCDGLDRIMENCLLPELHVGDWIVFEDMGAYTMCAASTFNGFPKPICYY 422          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A507DK56 (Uncharacterized protein OS=Synchytrium endobioticum OX=286115 GN=SeLEV6574_g00201 PE=3 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 6.780e-80
Identity = 163/455 (35.82%), Postives = 248/455 (54.51%), Query Frame = 3
Query:  273 SQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPG-LSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRF--TIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNF-------ISDE--KCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYY 1601
            + + D++  FF  +LG I +Q+ +WR +L RV PFYAVKC PDP +++ L SLGA FDCAS+ E++  ++        + +D           II+ANP K    + +A + G+   TFD+  EL ++K   P+AK+++R+ T    S  C+LG KFG +   +  LL   + L  D+ GVSFHVG+ C    A+ D V     V DL    G+N TLLDIGGG+PG ++S +T         F ++   L  ALDTY+       II+EPG +FV  A TLA  VI +R +  +  S    +D ++P+ DR         ++ +   N +++      VD+   ++Y ++DGVYGSFN L F         I+ P   +++        + DE  + Y   ++GPTCD++DCIS  + LP++++GDWL + +MGAYT  + S FNG  K    Y
Sbjct:  156 ADVDDAENAFFVADLGDIARQYYQWRSMLSRVEPFYAVKCNPDPTIVKTLVSLGASFDCASKAEIQTVLD--------MGVD--------PSRIIYANPCKQTSFIRWAAARGVTMMTFDNADELLKIKGVHPNAKVVLRILTDDSHSV-CKLGTKFGASQAVVPSLLTTCRNLGADLVGVSFHVGSGCGSARAFSDAVALARSVFDLAEDFGFNLTLLDIGGGFPGRVTSGVT---------FAEIAAVLRPALDTYFPADMGVRIIAEPGRYFVSAACTLAVNVIARRVVHSTVIS-PLAVDSAVPNADR---------MLVDENVNPNAV------VDETPSFMYYVNDGVYGSFNCLMFDH------AIVTPRLLLRDGAYVYGTDLKDEVYRKYSCSIWGPTCDSIDCISKDAFLPQLNIGDWLCFENMGAYTMCAASTFNGFAKSKILY 562          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A433Q4L0 (Pyridoxal-dependent decarboxylase OS=Jimgerdemannia flammicorona OX=994334 GN=BC938DRAFT_473172 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 8.004e-80
Identity = 168/463 (36.29%), Postives = 254/463 (54.86%), Query Frame = 3
Query:  240 REPLRNLLA---VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFI------SDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYY 1601
            RE +R+ L     +    D +  FF  +LG I +Q  RW +LLPR+ PF+AVKC PDP +  LLASLG GFDCAS+ E++  +        S+ +D           +I+ANP K    + +A  +G++K TFD+  EL ++KR++P A+L++R+      S  C+LG KFG + ++ E LL+ AKEL+ ++ GVSFHVG+ C D  A+ D V+    V D   ++GY  TLLD+GGG+PG +       V+    FEK+   L  A+D  +     +I+EPG ++V  A+TLAT VI +R +                 +DR  K G+   +    P+            DD   Y+Y ++DG+YGSFN + F         +++P   +K+ +       DE  +   ++GPTCD++DCI   +NLP++DVGDW+ + +MGAYT  + S FNG  K N  Y
Sbjct:   45 REIIRDRLVSIDTEEPEADEENAFFVADLGEIYRQQQRWVRLLPRIEPFFAVKCNPDPIISRLLASLGTGFDCASKAEIQQTL--------SLGVD--------PSRVIYANPCKQGSFIRYAAQHGVKKMTFDNLEELQKIKRFFPDAELVLRILADDSKSI-CKLGLKFGASLDSTEHLLRSAKELDLNVIGVSFHVGSGCFDEQAFSDAVQRARNVFDQAAEIGYEFTLLDVGGGFPGAN-------VQDGITFEKVAAILGPAVDRLFPAHVRVIAEPGRYYVASAFTLATNVIARRTV----------------MRDREGKGGNEGGIA-GMPTG-----------DDHLSYMYYINDGMYGSFNCVMFDH------QLVHPQVLLKSGVFSYGERFDEPEFGCSVWGPTCDSIDCIVRNANLPQLDVGDWVYFENMGAYTVCAASQFNGFRKSNIVY 449          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: odc1 (ornithine decarboxylase 1 [Source:NCBI gene;Acc:103026254])

HSP 1 Score: 262.307 bits (669), Expect = 7.772e-81
Identity = 169/452 (37.39%), Postives = 242/452 (53.54%), Query Frame = 3
Query:  270 QSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQI--EESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +S + D +  F+  +LG ++K+ LRW ++LPRV PFYAVKC     V++ LASLGAGFDCAS+ E+++          S+ +D           II+ANP K    + +A ++G+Q  TFDSE EL ++ R   +AKL++R++T     A C+L  KFG    +   LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  +LGYN TLLDIGGG+PG        + KL+  FE +   +N ALD Y+       II+EPG ++V  AYTLA  +I K+ I  E+S   +E                                    DE   D +R +Y ++DGVYGSFN + +     + +    P         DE  Y   ++GPTCD LD I    +LP+M VGDWL++ +MGAYT A+ S FNG  KP+ +Y +S 
Sbjct:   30 ESSLSDDKDAFYVADLGDVLKKHLRWARVLPRVTPFYAVKCNDSRTVVKTLASLGAGFDCASKTEIQIV--------QSLGVD--------PSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHDNAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARCVFDMGAELGYNMTLLDIGGGFPGSD------DSKLK--FEDITAVINPALDKYFPADSGVKIIAEPGRYYVASAYTLAVNIIAKKVIMKEQSGSDEE------------------------------------DEGTSD-RRLMYYVNDGVYGSFNCILYDHAHVMPVLHKKPK-------PDECMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIHYIMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: ENSAMXT00000043561.1 (antizyme inhibitor 1-like [Source:NCBI gene;Acc:111189228])

HSP 1 Score: 194.897 bits (494), Expect = 6.415e-56
Identity = 139/451 (30.82%), Postives = 217/451 (48.12%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYS--DRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +  Q +  +  F   NLG +++Q + W+ +LP VRPFY VK    P V+E+LA+LG GF C+++ E+ L +N                + +  +NII +   K    +  A   GI     D+E EL ++ R  P+AKLL+++ST  +     +    FG +  +   LL+ +KEL  D+ GV F V   C D   +   +     V D+  ++G+N  +LDIGGG+ G     ++F++K      ++   +   L+ Y+       +I+EPGTF+V  ++TL   VIGK+    S +         + ++D T             PS        DEP      ++Y L+DGVYGSF        K L   I +P     +  +DE  + S L+GP+CD LD +     LPE+ VGDWL++ +MGA      +  N   KP  YY IS 
Sbjct:   29 IYEQALAEKNAFVVANLGALMQQHVLWQSMLPMVRPFYPVKYNSSPAVIEVLAALGVGFVCSNKAEISLVLN----------------HDVPPENIILSGVCKQLSHIKHATKNGINYLVCDNEAELCKIARAHPNAKLLLQLSTEAQTE---EASMAFGCSLKSCRHLLETSKELGVDVVGVMFQVPASCRDPQVYTHALSDARCVFDMGAEIGFNMEILDIGGGFSG-----SEFQLK------QIHAAIRPLLEAYFPVMSGVRVIAEPGTFYVSSSFTLVVNVIGKKVAAGSLH---------VETKDLT-------------PS--------DEP-----EFLYYLNDGVYGSF------MGKLLGNTIPSPKVHKMSLAADEPMFPSSLWGPSCDALDQVVEHCLLPELTVGDWLIFNNMGASGQEESAAINNSDKPPVYYTIST 408          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 195.282 bits (495), Expect = 8.783e-56
Identity = 139/451 (30.82%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYS--DRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +  Q +  +  F   NLG +++Q + W+ +LP VRPFY VK    P V+E+LA+LG GF C+++ E+ L +N                + +  +NII +   K    +  A   GI     D+E EL ++ R  P+AKLL+++ST  +          FG +  +   LL+ +KEL  D+ GV F V   C D   +   +     V D+  ++G+N  +LDIGGG+ G     ++F++K      ++   +   L+ Y+       +I+EPGTF+V  ++TL   VIGK+    S +         + ++D T             PS        DEP      ++Y L+DGVYGSF        K L   I +P     +  +DE  + S L+GP+CD LD +     LPE+ VGDWL++ +MGA      +  N   KP  YY IS 
Sbjct:   29 IYEQALAEKNAFVVANLGALMQQHVLWQSMLPMVRPFYPVKYNSSPAVIEVLAALGVGFVCSNKAEISLVLN----------------HDVPPENIILSGVCKQLSHIKHATKNGINYLVCDNEAELCKIARAHPNAKLLLQLSTEAQTEEASM---AFGCSLKSCRHLLETSKELGVDVVGVMFQVPASCRDPQVYTHALSDARCVFDMGAEIGFNMEILDIGGGFSG-----SEFQLK------QIHAAIRPLLEAYFPVMSGVRVIAEPGTFYVSSSFTLVVNVIGKKVAAGSLH---------VETKDLT-------------PS--------DEP-----EFLYYLNDGVYGSF------MGKLLGNTIPSPKVHKMSLAADEPMFPSSLWGPSCDALDQVVEHCLLPELTVGDWLIFNNMGASGQEESAAINNSDKPPVYYTIST 408          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: azin1 (Astyanax mexicanus antizyme inhibitor 1 (azin1), mRNA. [Source:RefSeq mRNA;Acc:NM_001292031])

HSP 1 Score: 178.333 bits (451), Expect = 2.146e-49
Identity = 135/456 (29.61%), Postives = 215/456 (47.15%), Query Frame = 3
Query:  276 QIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVD--------MGAYTNASRSDFNGITKPNSYYYISN 1613
            Q +  +  FF  +LG I+ Q +RW+  + +VRPFY +KC   P V+E+LA+LG GF C+S+ E+EL                  S  +++ +II     K    + +A   G+Q    DSE EL ++ R    AKLL++V+T      + +    FG+   +   +L+ AKEL   +AGV FH+ + C +  A+   V     V D+  +LG+   +LDIGGG+ G            +   EK+   L   LD Y+  S   ++I+EPG ++V  A++LA  +I K                         KI S DA   ++P +   +   DEP      + Y ++DGV+GSF       +K L   +  P+   +  + +E  + S L+GP+ D LD +  +  LPE+ VGDWLV+          MGA+ +  R   + +     +Y I N
Sbjct:   32 QTLAQKNAFFVADLGAIIWQQIRWKSRMEQVRPFYVLKCNSSPVVIEILAALGTGFICSSKHELELV----------------KSFGVLSQDIILGGMCKQLSLIKYAAKLGVQLLVCDSEAELRKIARCHSKAKLLLQVTT-GGCCEREETSMPFGLTLKDCRHMLECAKELSLHVAGVKFHIPSCCAEPQAFTHAVSDARCVFDMGEELGFVMNILDIGGGFDGT-----------EAQLEKVNRALKPMLDVYFPPSTGVSVIAEPGAYYVSAAFSLAVSIISK-------------------------KIVSRDA--GQHPDD--ELSGNDEP-----EFQYYMNDGVFGSF------AYKLLDESVPVPSLHKEKSL-EEPLFSSSLWGPSSDGLDQVVESCLLPELSVGDWLVFSHSGANSLGAMGAHADGHRPPVHYVISAGDWYEIQN 418          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 255.758 bits (652), Expect = 4.768e-80
Identity = 161/442 (36.43%), Postives = 242/442 (54.75%), Query Frame = 3
Query:  291 QQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSF-NVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            ++ F+ V+LG IV++ LRW   LPRVRPFYAVKC     ++ +LA+LGAGFDCAS+EE+ L          SI +         AD II+ANP K    + +A  YG+   TFDS+ EL+++ R  P+A+L++R+ T    S   ++ +KFGV+  +  +LL+ A  L   + GVSFHVG++C +  A+  ++     V ++   LG   TLLDIGGG+PG       +   ++ +F+++   +NSALDT++       IISEPG ++V  A+TLAT VIGK+ + +       Y  QS    D    +G                    EPV     Y+Y ++DG++GSF +V+  +E             ++K    +E    S L+GP+CD  DC+     LPEM V DWL++ +MGAYT A  ++FNG  +P  +Y I
Sbjct:    2 KEAFYVVDLGDIVRKHLRWLSTLPRVRPFYAVKCNSTQTIVHILATLGAGFDCASKEEIALV--------QSIGVS--------ADRIIYANPCKQASHLRYAAKYGVDLMTFDSDAELHKIARINPNARLVLRILTNDSRSVY-RMSNKFGVSPESSRELLETAFGLGLLVVGVSFHVGSICNEPEAFAQSIADARRVFNIAADLGVKLTLLDIGGGFPG-------YNEHVRNNFDEIAAVVNSALDTHFPAGCGVNIISEPGRYYVMSAFTLATNVIGKKTVWK-------YSAQS----DDNDSVG--------------------EPV-----YMYYMNDGIHGSFQHVIHDIEEVV--------TEALKPVGPEEPVLESSLWGPSCDGYDCVVKRMPLPEMHVDDWLLFRNMGAYTLAMSTEFNGFRRPMLHYVI 375          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 254.988 bits (650), Expect = 8.241e-79
Identity = 157/452 (34.73%), Postives = 236/452 (52.21%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASI-KNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +Q    D +  F+ V+LG IV++ LRW   LPRVRPFYA+KC     ++  LA+LGAGFDCAS+ E+ L                  S  + AD II+ANP K    + +A  +G+   TFD++ EL++  R  P+AK+++R+ T    S  C+   KFG +      LL+ A+ L  D+ GVSFHVG+ C+D   +  ++     + ++  ++G+N  LLDIGGG+PG     +D   KL   F+++   +N ALD Y+       II+EPG ++V  A+TLA  +I K+   ++                                    S    +EPV     ++Y ++DGVYGSFN + F   +        P+  + K+   +E  + S L+GPTCD LD +     LPE+ VGDWL++ +MGAYT A+ S+FNG  KP  +Y I N
Sbjct:   28 IQEMRTDEKDAFYVVDLGDIVRKHLRWLGTLPRVRPFYAIKCNSTQTIVHTLATLGAGFDCASKAEIALV----------------QSLGVSADRIIYANPCKQASHVRYAAEHGVNLMTFDNDAELHKAARINPNAKMVLRIVTDDSKSI-CRFSMKFGASLKASRHLLETARNLGVDVVGVSFHVGSGCQDAQTYAQSIADARVLFNIAAEMGFNMNLLDIGGGFPG-----SDTNAKLT--FDEIAAVVNPALDLYFPKGCGVNIIAEPGRYYVTSAFTLAVNIIAKKTFSKA------------------------------------SANGGEEPV-----HMYYVNDGVYGSFNCILFDHVQ--------PDPIVYKHVEPEEPVFESSLWGPTCDGLDRVVERMQLPELHVGDWLLFRNMGAYTMAAASNFNGFPKPPLHYVIRN 406          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 251.521 bits (641), Expect = 6.231e-78
Identity = 162/447 (36.24%), Postives = 239/447 (53.47%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENP--SNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+ V+LG IV++ LRW   LPRVRPFYAVKC     +++ LA+LG GFDCAS+ E+ L                  S  + AD II+ANP K    + +A  +G+   TFD++ EL+++ R  P+A+L++R++T    S   ++  KFG +  +  +LL+ A+ L   + GVSFHVG+ C+D  A+ + +    +V +   +LG + TLLDIGGG+PG +      E K+   FE++   +NSALDT++       IISEPG ++V  A TLAT VI K+                                 F NP    L S     +PV     ++Y ++DG +GSFN + F E KF       P  ++K    +E  + S ++GPTCD LDC+   + L E+ VGDWL++ +MGAYT    S FNG   PN +Y I +
Sbjct:   37 DEKDAFYVVDLGDIVRKHLRWLGALPRVRPFYAVKCNNTQTIVQTLATLGTGFDCASKAEIALV----------------QSLGVSADRIIYANPCKQASHVRYAAEHGVDLMTFDNDAELHKIARVNPNARLVLRIATDDSKSVY-KMSRKFGASVESSHQLLETAQGLGLLVVGVSFHVGSCCQDGVAYTEAIANARQVFNNAAELGLSLTLLDIGGGFPGHNG-----ESKIT--FEEIAAVVNSALDTHFPAGCGVNIISEPGRYYVMSALTLATNVIAKKT--------------------------------FVNPLADVLTSATGEGQPV-----HMYYINDGNFGSFNFVFFKE-KF------TPPVALKRVDPEEPVFESSVWGPTCDGLDCVMERTQLLELHVGDWLLFRNMGAYTLTLSSGFNGFPLPNIHYMIGD 415          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 242.276 bits (617), Expect = 3.855e-74
Identity = 153/445 (34.38%), Postives = 229/445 (51.46%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDR--FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            D +  F+  +LG +V++  RW + LP V PFYAVKC  +  VL  LA++GAGFDCAS+ EM L +                   + A+ II+ANP K    + +A  +G+   TFD+E EL ++ R  P A+L++R+       A C+L  KFG +  +   LL++A++L  D+ GVSFHVG+ C +   +   +     V D+    GY  +LLDIGGG+PG            +  FE++   LN AL+ Y+       +I+EPG F+V  A+ LA  +I K+ + ++       +D    S+D                         D+P      Y+Y ++DGVYGSFN + F     L      P A  K  + DE  + + ++GPTCD LDC+     LPE+ +GDWL++  MGAYT A+ S FNG  KP  +Y +S+
Sbjct:   36 DEKNAFYVADLGDVVQKHARWLEHLPLVSPFYAVKCNDELPVLRALAAMGAGFDCASKNEMALVLG----------------LGVPAERIIYANPCKQVSHIKYAARHGVHTMTFDNEAELEKVARNHPHARLVLRIMADDS-KAVCRLSVKFGASLKSCRHLLERARQLGVDVIGVSFHVGSGCMEAETFALAIADARCVFDMAVDFGYCLSLLDIGGGFPGSPDA--------KVTFEEIAGVLNGALERYFPAESGVRVIAEPGRFYVASAFMLAVGIIAKKAVVQNS------LDNEEASRD-------------------------DQPA-----YMYYVNDGVYGSFNCILFDHANVL------PLAHRKVDL-DEPLFETSVWGPTCDGLDCVLECVQLPELHLGDWLIFQHMGAYTLAAASTFNGFQKPVVHYVMSS 412          
BLAST of Ornithine decarboxylase vs. Ensembl Yeast
Match: SPE1 (Ornithine decarboxylase; catalyzes the first step in polyamine biosynthesis; degraded in a proteasome-dependent manner in the presence of excess polyamines; deletion decreases lifespan, and increases necrotic cell death and ROS generation [Source:SGD;Acc:S000001667])

HSP 1 Score: 205.297 bits (521), Expect = 3.491e-60
Identity = 148/448 (33.04%), Postives = 227/448 (50.67%), Query Frame = 3
Query:  291 QQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMD-LITKLGYNP-TLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFE----NPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLP-EMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            + +FF  +LG + + F  W K LPR++PFYAVKC PD KVL LLA LG  FDCAS+                + ID   S  I  D I++ANP K    + +A S  + K+TFD+  EL+++K++ P ++LL+R++T    +A+C+L  K+G    N++ LLK  KEL  ++AGVSFHVG+   DF++    V     V D    + G  P  +LD+GGG+               E F++    L  AL+ ++       II+EPG +FV  A+TLA+ VI KR++ E+E     Y +  +         G+++ ++F+    +P  L+    L+   DDF+    +LD                           SI N    E  Y   ++GPTCD LDCI+    +  ++ VGDW  +  +GAYT+++ + FNG  +     YI
Sbjct:   84 ENSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPDTKVLSLLAELGVNFDCASK----------------VEIDRVLSMNISPDRIVYANPCKVASFIRYAASKNVMKSTFDNVEELHKIKKFHPESQLLLRIATDDS-TAQCRLSTKYGCEMENVDVLLKAIKELGLNLAGVSFHVGSGASDFTSLYKAVRDARTVFDKAANEYGLPPLKILDVGGGFQF-------------ESFKESTAVLRLALEEFFPVGCGVDIIAEPGRYFVATAFTLASHVIAKRKLSENE--AMIYTNDGV--------YGNMNCILFDHQEPHPRTLY--HNLEFHYDDFESTTAVLD---------------------------SI-NKTRSEYPYKVSIWGPTCDGLDCIAKEYYMKHDVIVGDWFYFPALGAYTSSAATQFNGFEQTADIVYI 461          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO44188 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWL7])

HSP 1 Score: 234.187 bits (596), Expect = 3.656e-71
Identity = 157/438 (35.84%), Postives = 237/438 (54.11%), Query Frame = 3
Query:  297 TFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPG-LSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYY 1601
             F+ V+L  +V +  +W +LLPRV PFYA+KC  DP VL+LLA LG GFDCAS+ E++  +             +  S K     I++ANP K    + +A  + +  TTFD+E EL+++K+ +P A+L++R+ T    S  CQLG KFG        LLK A++L  ++ GVSFHVG+ C D SA+   V     V +L  + G+N TLLDIGGG+PG  ++ IT         FE++C  +N  L+ ++  S    II+EPG ++   ++TLA  V  +R+++ S          S+ ++D T           EN  N              + ++Y ++DGVYGSFN L F       I +           S +  Y + ++GPTCD++DCI+    LP+++VG+WL +  MGAYT ++ S FNG  KP  +Y
Sbjct:   39 AFYIVDLADVVLKHKKWVQLLPRVEPFYAMKCNNDPAVLKLLAGLGLGFDCASKGEIQTILG------------LGVSPK----KIVYANPCKQASHIKYASQHDVAMTTFDNEMELHKIKKLYPDAQLILRIRTDDSKSL-CQLGIKFGAPLKQCRHLLKVAQDLGLNVVGVSFHVGSGCFDASAYATAVIAARSVFNLAVQFGFNCTLLDIGGGFPGDPNAAIT---------FEEICTTINPLLEEHFPPSSGVRIIAEPGRYYSSSSFTLAVNVYSRREVQSS----------SVLAEDVTAP---------ENNGN--------------QGFMYYVNDGVYGSFNCLIFDHATVEAIPVKES--------SGQPLYQTSIWGPTCDSMDCITKNMMLPKVEVGEWLFFKYMGAYTQSAASTFNGFKKPTKFY 409          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO26406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC36])

HSP 1 Score: 167.548 bits (423), Expect = 5.091e-48
Identity = 101/232 (43.53%), Postives = 135/232 (58.19%), Query Frame = 3
Query:  285 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFE 980
            D +  F+  +LG IVK+ +RW K LPRV PFYAVKC     +++ L+ LGAGFDCAS+ E++L          SI +  E         II+ANP K    + +A S G++K TFDSE EL ++ R  P+AKL++R++T     A C+L  KFG        LL++AKEL  DI GVSFHVG+ C D   +   V     V D+  +LG+N  LLDIGGG+PG   V   FE
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLV--------QSIGVSSE--------RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSEDVKLKFE 249          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO28248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T706])

HSP 1 Score: 102.064 bits (253), Expect = 2.455e-25
Identity = 65/200 (32.50%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1020 LNSALDTYYS--DRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +N ALD Y+      TII+EPG ++V  A+TLA  +I K+ +   +   +   D+   + D+T+                                +Y ++DGVYGSFN + F       +    P         DE  Y S ++GPTCD LD I    +LPE+ VGDW+++ +MGAYT A+ S FNG  +P  YY +S 
Sbjct:    6 INPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVMVNEQSGSD---DEEDAANDKTL--------------------------------MYYVNDGVYGSFNCILFDHAHVKPVLTKKPKP-------DESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMSR 163          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: odc1 (ornithine decarboxylase 1 [Source:NCBI gene;Acc:101170722])

HSP 1 Score: 253.832 bits (647), Expect = 1.271e-77
Identity = 166/450 (36.89%), Postives = 233/450 (51.78%), Query Frame = 3
Query:  270 QSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISN 1613
            +S + D +  F+  +LG ++K+ LRW + LPRV PFYAVKC     V+  LASLG GFDCAS+ E++L                  S  +  + II+ANP K    M +A ++G++  TFDSE EL ++ RY  +AKL++R++T     A C+L  KFG        LL++AKEL  D+ GVSFHVG+ C D   +   +     V D+  +LG+   LLDIGGG+PG      D E+     FE++   +N ALD Y+       II+EPG F+V  AYTL   +I K+ I          ID+  P                           +DE  +D K  +Y ++DGVYGSFN + +       +    P         DE  Y   ++GPTCD LD I     LP+M VGDWLV+ +MGAYT A+ S FNG  +P+ +Y +S 
Sbjct:   29 ESSLTDDRDAFYVCDLGDVLKKHLRWTRALPRVTPFYAVKCNDSRAVVMTLASLGTGFDCASKTEIQLV----------------QSLGVHPNRIIYANPCKQVSQMKYASAHGVEMMTFDSEVELMKVARYHDNAKLVLRIATDDS-KAVCRLSVKFGAPIKACRGLLERAKELGLDVVGVSFHVGSGCTDAGTFVKAIADARCVFDMGEELGFQMDLLDIGGGFPGSE----DTELS----FEEITATINPALDKYFPVDSGVRIIAEPGRFYVASAYTLVVNIIAKKVI----------IDEEAP---------------------------IDE--EDNKTLMYYVNDGVYGSFNCILYDHAHCYPVLHKKPK-------PDETMYSCSIWGPTCDGLDRIVEQCCLPDMQVGDWLVFKNMGAYTVAASSTFNGFQRPDIHYVMSR 407          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: azin1b (antizyme inhibitor 1 [Source:NCBI gene;Acc:101162142])

HSP 1 Score: 180.644 bits (457), Expect = 2.022e-50
Identity = 135/476 (28.36%), Postives = 223/476 (46.85%), Query Frame = 3
Query:  276 QIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFS-AWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSD--RFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSY--YYISNXXXXXXXXXXXXVRNDVLKRFHAIQ 1688
            Q +  +  F   +LG +++Q   W+ ++PRV P+Y VKC   P V+E+LASLG GF CA++ E+ L +                 + +  +NII ++ FK    + +A    IQ    ++E EL ++ R  PSAKLL++++T  + +        FG +  N   LL+KAK+L  D+ G +FH+ + CED   A+   +     V D+   LG+N  +LDIGGG+ G     ++F++K  E        +N+ LD Y+       ++++PG F+V  A++LA  +IGK+   +S          +  SQ                               +   ++Y +++GVYG F+       K L   I  P+     F +DE  Y S L+GP+ D LD +     LPE+ V DWL++ +MG        D N ++    +  YYI +           +  N+ +K F  +Q
Sbjct:   32 QTVMEKSAFVVGDLGALMQQHACWQSVVPRVLPYYPVKCNSSPVVIEVLASLGLGFVCANKAEVGLVLE----------------HGVPPENIILSSGFKQLAHIKYAAKNNIQHLVCENEAELSKIARLHPSAKLLLQLTTESQAAENSM---AFGFSLKNCRHLLEKAKDLGIDVVGAAFHIPSSCEDLQPAYTHALSDARCVFDMGLDLGFNMHILDIGGGFTG-----SEFQLKQVES------AINTLLDAYFPQLSGVQVLAQPGNFYVASAFSLAVNIIGKKIKTQS---------WNCLSQGEK---------------------------KEGTEFLYYMNEGVYGPFS------HKLLGHPIAAPSLHKHAFCADEAVYPSSLWGPSLDQLDQVVEHCLLPELSVADWLIFSNMG---TCGLEDLNCLSSSIDFPVYYIISTSDWYKMEEAGVALNNPVKNFSMLQ 432          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: azin1a (antizyme inhibitor 1 [Source:NCBI gene;Acc:101166413])

HSP 1 Score: 175.252 bits (443), Expect = 2.873e-48
Identity = 124/430 (28.84%), Postives = 205/430 (47.67%), Query Frame = 3
Query:  267 VQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYT 1550
            +  Q +  +  FF  +LG +++Q +RWR  +P +RP+YAV+C   P V+ELLASLG+GF C+++ ++EL +                S+ +  ++II++   K    + +A + GI     D+E EL ++ R  P AKLL++VST    + +      FG +  +   LL++AKEL   + GV  ++ + CED   +   +     + DL  ++G+N  +LDIGGG+ G            +   + +   + S +D Y+  S   ++I+EPG+FFV  A+TLA  VI K+ +      QE                                         +     Y+L++GVYGSF+       K     I  P+   K  + D   + S L+GP+ D LD +     LPE+ +GDWLV+   GA++
Sbjct:   29 IDEQTVSEKNAFFVADLGAVMRQHVRWRTRMPLIRPYYAVRCNSSPAVIELLASLGSGFTCSNKSDLELVL----------------SHGVSPEDIIYSGVCKQVSHIKYAATNGIDLLVCDNEAELRKISRCHPGAKLLLQVSTEAS-NPEEGTSVTFGCSLKDSRCLLQRAKELGVQVVGVRSNISSSCEDDQVYLRAISDARCIYDLGAEMGFNVNILDIGGGFNG-----------AEAQLDLIHSAVMSVVDLYFPSSSGVSLIAEPGSFFVSSAFTLAVSVISKKVVARDAKDQEREEPSPD----------------------------------EEPEIQYVLNEGVYGSFSS------KLSETPIGAPSVHKKTLV-DAPLFSSSLWGPSGDDLDQVVEHCLLPELHIGDWLVFKHAGAFS 389          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000041045.1 (SMESG000041045.1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 513/513 (100.00%), Postives = 513/513 (100.00%), Query Frame = 3
Query:  150 MQRSLCHIEKIFVGFSKNGVRTYSKQFNLNREPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISNXXXXXXXXXXXXVRNDVLKRFHAIQ 1688
            MQRSLCHIEKIFVGFSKNGVRTYSKQFNLNREPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIEKLLKKAKELEFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISNEDKEIIDSIKKIVRNDVLKRFHAIQ
Sbjct:    1 MQRSLCHIEKIFVGFSKNGVRTYSKQFNLNREPLRNLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIEKLLKKAKELEFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISNEDKEIIDSIKKIVRNDVLKRFHAIQ 513          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000015241.1 (SMESG000015241.1)

HSP 1 Score: 388.652 bits (997), Expect = 4.251e-129
Identity = 200/471 (42.46%), Postives = 303/471 (64.33%), Query Frame = 3
Query:  255 NLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEES------------EYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDF------KRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            NL  ++ +I++    F+++NLG I  QF+RW+ LLPRV+PF+AVKCQPDPKV+ LL  LGAGFDCAS++E++  I+          +  +T+    A +IIFANPFKFK+D+++A S G+   TFD+E EL +L + WPS +L++R+ST++ ++A C LG+KFG +++ +  LL++A EL  ++ G+SFHVG+ C +  A+P+TV YC++VM+L  K+G+NPT+LDIGGG+PGLSS+  D   ++Q  FE+MC +LN  LDTY+   D + II+EPG +FV+GAYTL T+VIG R ++ +            + + E Y +    SQ      GS+   + ++ S++  I   D   +        K Y Y+++DGVY SFN + F   K +  GI       +    + + YVS +YGPTCD  DCI     LP+M++G+W+VW +MGAYT A+ S FNGI    ++Y++
Sbjct:   27 NLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGILGAGFDCASKQEIKSVIDT---------MSFDTTQA--ATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQ--FEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQ------GSMPEYLLDSMSDVSEISSSDSRKNSKPKVYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 478          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004848.1 (SMESG000004848.1)

HSP 1 Score: 388.267 bits (996), Expect = 4.998e-129
Identity = 200/471 (42.46%), Postives = 303/471 (64.33%), Query Frame = 3
Query:  255 NLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEES------------EYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDF------KRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            NL  ++ +I++    F+++NLG I  QF+RW+ LLPRV+PF+AVKCQPDPKV+ LL  LGAGFDCAS++E++  I+          +  +T+    A +IIFANPFKFK+D+++A S G+   TFD+E EL +L + WPS +L++R+ST++ ++A C LG+KFG +++ +  LL++A EL  ++ G+SFHVG+ C +  A+P+TV YC++VM+L  K+G+NPT+LDIGGG+PGLSS+  D   ++Q  FE+MC +LN  LDTY+   D + II+EPG +FV+GAYTL T+VIG R ++ +            + + E Y +    SQ      GS+   + ++ S++  I   D   +        K Y Y+++DGVY SFN + F   K +  GI       +    + + YVS +YGPTCD  DCI     LP+M++G+W+VW +MGAYT A+ S FNGI    ++Y++
Sbjct:   27 NLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGILGAGFDCASKQEIKSVIDT---------MSFDTTQA--ATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQ--FEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQ------GSMPEYLLDSMSDVSEISSSDSRKNSKPKVYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 478          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004820.1 (SMESG000004820.1)

HSP 1 Score: 387.111 bits (993), Expect = 1.238e-128
Identity = 199/471 (42.25%), Postives = 303/471 (64.33%), Query Frame = 3
Query:  255 NLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEES------------EYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDF------KRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            NL  ++ +I++    F++++LG I  QF+RW+ LLPRV+PF+AVKCQPDPKV+ LL  LGAGFDCAS++E++  I+          +  +T+    A +IIFANPFKFK+D+++A S G+   TFD+E EL +L + WPS +L++R+ST++ ++A C LG+KFG +++ +  LL++A EL  ++ G+SFHVG+ C +  A+P+TV YC++VM+L  K+G+NPT+LDIGGG+PGLSS+  D   ++Q  FE+MC +LN  LDTY+   D + II+EPG +FV+GAYTL T+VIG R ++ +            + + E Y +    SQ      GS+   + ++ S++  I   D   +        K Y Y+++DGVY SFN + F   K +  GI       +    + + YVS +YGPTCD  DCI     LP+M++G+W+VW +MGAYT A+ S FNGI    ++Y++
Sbjct:   27 NLHIIKQRIMNCDAPFYQIDLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGVLGAGFDCASKQEIKSVIDT---------MSFDTTQA--ATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINCDLAKQMQ--FEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQ------GSMPEYLLDSMSDVSEISSSDSRKNSKPELYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 478          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004822.1 (SMESG000004822.1)

HSP 1 Score: 384.8 bits (987), Expect = 1.194e-127
Identity = 198/471 (42.04%), Postives = 302/471 (64.12%), Query Frame = 3
Query:  255 NLLAVQSQIIDSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGVNSNNIXXXXXXXXXXXFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYY--SDRFTIISEPGTFFVHGAYTLATEVIGKRQIEES------------EYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSIKVLDEPVDDF------KRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYI 1607
            NL  ++ +I++    F++++LG I  QF+RW+ LLPRV+PF+AVKCQPDPKV+ LL  LGAGFDCAS++E++  I+          +  +T+    A +IIFANPFKFK+D+++A S G+   TFD+E EL +L + W S +L++R+ST++ ++A C LG+KFG +++ +  LL++A EL  ++ G+SFHVG+ C +  A+P+TV YC++VM+L  K+G+NPT+LDIGGG+PGLSS+  D   ++Q  FE+MC +LN  LDTY+   D + II+EPG +FV+GAYTL T+VIG R ++ +            + + E Y +    SQ      GS+   + ++ S++  I   D   +        K Y Y+++DGVY SFN + F   K +  GI       +    + + YVS +YGPTCD  DCI     LP+M++G+W+VW +MGAYT A+ S FNGI    ++Y++
Sbjct:   27 NLHIIKQRIMNCDAPFYQIDLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGVLGAGFDCASKQEIKSVIDT---------MSFDTTQA--ATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWSSVQLILRLSTQRAYAATCVLGNKFGADADEVLFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINCDLAKQMQ--FEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQ------GSMPEYLLDSMSDVSEISSSDSRKNSKPELYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 478          
The following BLAST results are available for this feature:
BLAST of Ornithine decarboxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ODC13.390e-7636.44ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
ODC13.390e-7636.44ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
AZIN26.636e-6633.69antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN22.381e-6433.69antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN22.381e-6433.69antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
odc-15.752e-6530.24Ornithine decarboxylase [Source:UniProtKB/Swiss-P... [more]
F53F10.27.462e-2124.78pep chromosome:WBcel235:I:3832239:3834124:1 gene:W... [more]
F53F10.27.462e-2124.78pep chromosome:WBcel235:I:3831117:3834124:1 gene:W... [more]
F53F10.27.462e-2124.78pep chromosome:WBcel235:I:3830562:3834120:1 gene:W... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Odc12.452e-6631.62gene:FBgn0013307 transcript:FBtr0088863[more]
Odc28.113e-5628.81gene:FBgn0013308 transcript:FBtr0088864[more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odc11.168e-8136.89ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
odc11.168e-8136.89ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
odc11.168e-8136.89ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
azin1b2.201e-5229.71antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
azin1b2.201e-5229.71antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dym6.515e-8037.84dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
dym8.703e-8037.84dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
dym1.580e-7937.84dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
slc20a21.171e-7336.52solute carrier family 20 (phosphate transporter), ... [more]
cstf21.116e-6431.15cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Odc13.297e-8037.64ornithine decarboxylase, structural 1 [Source:MGI ... [more]
Ldc17.738e-6032.89leucine decarboxylase 1 [Source:MGI Symbol;Acc:MGI... [more]
Azin22.740e-5931.10antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:24... [more]
Azin22.740e-5931.10antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:24... [more]
Azin11.108e-5831.71antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00860|DCOR_MOUSE2.306e-7937.64Ornithine decarboxylase OS=Mus musculus OX=10090 G... [more]
sp|P27118|DCOR_CHICK3.451e-7838.44Ornithine decarboxylase (Fragment) OS=Gallus gallu... [more]
sp|P27119|DCOR_MUSPA4.762e-7837.56Ornithine decarboxylase OS=Mus pahari OX=10093 GN=... [more]
sp|P27117|DCOR_BOVIN6.471e-7837.56Ornithine decarboxylase OS=Bos taurus OX=9913 GN=O... [more]
sp|P27120|DCOR1_XENLA2.388e-7737.39Ornithine decarboxylase 1 OS=Xenopus laevis OX=835... [more]
back to top
BLAST of Ornithine decarboxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BU504.540e-8337.14Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1Y1WDB33.546e-8236.04Ornithine decarboxylase OS=Linderina pennispora OX... [more]
B5LVY41.037e-8038.75Ornithine decarboxylase OS=Saccoglossus kowalevski... [more]
A0A507DK566.780e-8035.82Uncharacterized protein OS=Synchytrium endobioticu... [more]
A0A433Q4L08.004e-8036.29Pyridoxal-dependent decarboxylase OS=Jimgerdemanni... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
odc17.772e-8137.39ornithine decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000043561.16.415e-5630.82antizyme inhibitor 1-like [Source:NCBI gene;Acc:11... [more]
azin1b8.783e-5630.82antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
azin12.146e-4929.61Astyanax mexicanus antizyme inhibitor 1 (azin1), m... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AZIN14.768e-8036.43antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN18.241e-7934.73antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN16.231e-7836.24antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN13.855e-7434.38antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPE13.491e-6033.04Ornithine decarboxylase; catalyzes the first step ... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO441883.656e-7135.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264065.091e-4843.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282482.455e-2532.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
odc11.271e-7736.89ornithine decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
azin1b2.022e-5028.36antizyme inhibitor 1 [Source:NCBI gene;Acc:1011621... [more]
azin1a2.873e-4828.84antizyme inhibitor 1 [Source:NCBI gene;Acc:1011664... [more]
back to top
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041045.10.000e+0100.00SMESG000041045.1[more]
SMESG000015241.14.251e-12942.46SMESG000015241.1[more]
SMESG000004848.14.998e-12942.46SMESG000004848.1[more]
SMESG000004820.11.238e-12842.25SMESG000004820.1[more]
SMESG000004822.11.194e-12742.04SMESG000004822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033621 ID=SMED30033621|Name=Ornithine decarboxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=1754bp
AGAAAAATTACTGATGATGACGACATTTTGATGTTTATATTTAAAATTTC
ACCTACATATTTACACAGTAATACCTACGCCAAAAAAGTTTTATAACTTT
GATTTGAAAATATTTTTTATAAAACTGCGTTATCTGCTGGGTACTGATCA
TGCAACGGTCGCTTTGTCATATTGAAAAGATCTTTGTCGGTTTTTCCAAA
AATGGAGTTAGAACTTATTCGAAACAATTCAACTTGAACCGGGAACCTCT
TCGAAATCTACTAGCAGTTCAAAGCCAAATAATCGATTCTCAACAAACAT
TTTTCGAGGTCAATTTGGGTCACATTGTCAAACAATTCTTAAGATGGCGT
AAATTGCTTCCGAGGGTGCGTCCTTTTTATGCCGTGAAATGCCAACCAGA
TCCCAAGGTTTTAGAACTTTTGGCCTCATTAGGTGCAGGATTTGACTGTG
CTAGCCAAGAAGAAATGGAACTGGCAATTAATAATTGCCGGAAAGCCTAC
AACAGCATTAATATTGACATTGAAACATCAAATAAGATCATAGCAGATAA
TATTATTTTTGCAAATCCTTTTAAATTTAAACAGGATATGGTATTTGCCG
GATCCTATGGGATACAGAAAACTACTTTTGACAGTGAAGGCGAACTTTAT
CGTCTAAAAAGATATTGGCCATCAGCGAAACTTTTGATTCGAGTCAGCAC
GAGAAAGAAATTTAGTGCTAAATGCCAACTGGGCGATAAATTCGGTGTCA
ATTCAAATAATATTGAAAAATTATTGAAGAAAGCAAAAGAATTAGAGTTC
GACATAGCTGGAGTCAGTTTTCATGTCGGAAATATGTGTGAGGATTTCTC
CGCGTGGCCAGATACAGTTGAGTATTGTGCTGAGGTAATGGATTTAATCA
CAAAATTAGGCTATAACCCAACTTTATTGGACATTGGAGGAGGGTATCCA
GGGTTAAGCTCAGTTATAACAGATTTTGAAGTCAAATTGCAGGAAGATTT
CGAAAAGATGTGCATTGAGCTCAACTCAGCGTTGGATACTTACTACTCTG
ATAGGTTTACTATAATTTCAGAACCAGGAACTTTTTTTGTACATGGAGCT
TATACATTGGCCACTGAAGTTATTGGAAAAAGACAAATTGAAGAATCTGA
ATATTCACAAGAATTCTATATTGATCAATCAATTCCATCACAAGATAGAA
CTGTCAAAATAGGATCTTTGGATGCTGTAATGTTTGAAAATCCTTCAAAT
TTGCATTCAATTAAAGTACTTGATGAACCTGTTGATGATTTTAAGAGATA
TATATACATACTTGATGACGGCGTTTATGGATCCTTCAATGTTCTTCAGT
TCATGGAATTTAAATTCTTATTAATAGGAATACTCAATCCAAATGCCAGC
ATTAAGAACTTCATAAGTGATGAAAAATGTTATGTCAGCAAGCTTTATGG
ACCGACATGCGACACATTGGACTGCATCAGTCCAGCAAGTAATTTACCAG
AAATGGATGTAGGGGACTGGTTGGTTTGGGTCGACATGGGGGCATATACA
AATGCAAGCCGAAGTGATTTCAATGGGATCACTAAGCCTAATTCATATTA
TTACATTTCTAATGAAGATAAAGAAATAATTGATTCTATAAAAAAAATTG
TCAGAAATGACGTCTTGAAACGCTTCCATGCAATTCAGTAAATTCTTTCG
GTGAAAACGTTTAAAATTTCTTTTTTTAATAAATTGATTGATAGTTAAAA
AAAA
back to top

protein sequence of SMED30033621-orf-1

>SMED30033621-orf-1 ID=SMED30033621-orf-1|Name=SMED30033621-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MQRSLCHIEKIFVGFSKNGVRTYSKQFNLNREPLRNLLAVQSQIIDSQQT
FFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDC
ASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFA
GSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLGDKFGV
NSNNIEKLLKKAKELEFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLI
TKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYS
DRFTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDR
TVKIGSLDAVMFENPSNLHSIKVLDEPVDDFKRYIYILDDGVYGSFNVLQ
FMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLP
EMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISNEDKEIIDSIKKI
VRNDVLKRFHAIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002433Orn_de-COase
IPR000183Orn/DAP/Arg_de-COase
IPR022644De-COase2_N
IPR029066PLP-binding_barrel
IPR022643De-COase2_C
IPR009006Ala_racemase/Decarboxylase_C
Vocabulary: biological process
TermDefinition
GO:0006596polyamine biosynthetic process
GO:0001822kidney development
GO:0006595polyamine metabolic process
GO:0008284positive regulation of cell proliferation
GO:0009446putrescine biosynthetic process
GO:0009615response to virus
GO:0033387putrescine biosynthetic process from ornithine
GO:0042176regulation of protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004586ornithine decarboxylase activity
GO:0016829lyase activity
GO:0016831carboxy-lyase activity
GO:0042803protein homodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002433Ornithine decarboxylasePRINTSPR01182ORNDCRBXLASEcoord: 75..102
score: 61.67
coord: 431..441
score: 60.61
coord: 49..73
score: 38.0
coord: 390..403
score: 51.19
coord: 451..464
score: 52.14
IPR002433Ornithine decarboxylasePANTHERPTHR11482ARGININE/DIAMINOPIMELATE/ORNITHINE DECARBOXYLASEcoord: 45..491
IPR000183Ornithine/DAP/Arg decarboxylasePRINTSPR01179ODADCRBXLASEcoord: 464..477
score: 46.54
coord: 305..324
score: 42.42
coord: 77..95
score: 44.41
coord: 97..109
score: 46.51
coord: 216..229
score: 36.94
IPR022644Orn/DAP/Arg decarboxylase 2, N-terminalPFAMPF02784Orn_Arg_deC_Ncoord: 56..314
e-value: 7.0E-55
score: 186.1
IPR022643Orn/DAP/Arg decarboxylase 2, C-terminalPFAMPF00278Orn_DAP_Arg_deCcoord: 316..464
e-value: 1.5E-13
score: 50.8
NoneNo IPR availablePANTHERPTHR11482:SF6ORNITHINE DECARBOXYLASE 1-RELATEDcoord: 45..491
NoneNo IPR availableCDDcd00622PLPDE_III_ODCcoord: 49..485
e-value: 5.6404E-134
score: 390.702
IPR009006Alanine racemase/group IV decarboxylase, C-terminalSUPERFAMILYSSF50621Alanine racemase C-terminal domain-likecoord: 297..494
IPR029066PLP-binding barrelSUPERFAMILYSSF51419PLP-binding barrelcoord: 51..317