DNA replication licensing factor MCM6

Overview
NameDNA replication licensing factor MCM6
Smed IDSMED30033600
Length (bp)2522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA replication licensing factor MCM6 (SMED30033600) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA replication licensing factor MCM6 (SMED30033600) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA replication licensing factor MCM6 (SMED30033600) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA replication licensing factor MCM6 (SMED30033600) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033600

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033600SMESG000038798.1 SmedASXL_015432SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30033600SMESG000038798.1 dd_Smed_v4_2682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033600SMESG000038798.1 dd_Smed_v4_2682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30033600SMESG000038798.1 dd_Smed_v4_2682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30033600SMESG000038798.1 dd_Smed_v4_2682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033600SMESG000038798.1 Contig39835uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033600SMESG000038798.1 Contig39835newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30033600SMESG000038798.1 dd_Smed_v4_2682_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Human
Match: MCM6 (minichromosome maintenance complex component 6 [Source:HGNC Symbol;Acc:HGNC:6949])

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 428/810 (52.84%), Postives = 573/810 (70.74%), Query Frame = 1
Query:  103 NRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ---------------------AAVNAVE------SEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM----AVYRTESFGGEISKDDPIVFLHPN 2433
            ++H+ V D + EKCQ+LFL+ LE F+  D E KY++ A+++   E+  L VSF DL  ++  LS  I   FYR+YP+LC+A + F+  + +     D  +   F D PT   +R L    +G L +  GQV+R+H VHPELV GTF C DC TV++++EQQF +T+P IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+AQ GD+ +FTG+LI++PD+S+L+TPG+R     ++   +GY++ G+ GL+ LGVRDL+YR+ FLA  VA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM+VRDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ G YDRS+SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y+ DDI+RY+ FAR F+P++++E+   +V +Y  +R+RD +  ++S+WRITVRQLES++RLSEA ARM   D V+   V EA RLL+KSIIRVE PD+NL Q+                     A VN +       ++++  + S  + F EY +I+ LI+ HLR ++ + +E  LK+SELV WYL  I   I  E  L+ KK++IE +IHRL   D++L+    A  +  + G E  ++DP + ++PN
Sbjct:   13 SQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKD--FYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKHLRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPN 816          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Human
Match: MCM2 (minichromosome maintenance complex component 2 [Source:HGNC Symbol;Acc:HGNC:6944])

HSP 1 Score: 325.865 bits (834), Expect = 1.901e-97
Identity = 199/587 (33.90%), Postives = 312/587 (53.15%), Query Frame = 1
Query:  364 QFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNI-EQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQ-------------------RPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            ++D   N+      H    P +  LR+LR  +L +L++  G V    GV P+L +  + C  C  V+    + Q    KP  C  P+C +   FE+  E++ Y ++Q++R+QE+  ++  G +PR  D IL  + V++ +PGD+ E TG                             YD  +       V    +    LANHVA  +NK    E                LT+++V  + ++++D  + + +   + P+ YG++++KRGL L LFGG PK      K+RGDIN+ + GDP TAKSQFLK I   S RA++T+G+ +SA GLTA V R   S E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S                     P  P         ++ +++YI +A+    P++ +     +   Y+ +R+   A+GS     ITVR +ES++R++EA AR+   D+V E DV  A R++ +S I  ++
Sbjct:  273 KYDRITNHIHVRISHL---PLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSC--PECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIY------------------------HNNYDGSLNTANGFPV----FATVILANHVAKKDNKVAVGE----------------LTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGS---IPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQK 807          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 322.783 bits (826), Expect = 2.790e-96
Identity = 212/660 (32.12%), Postives = 355/660 (53.79%), Query Frame = 1
Query:   94 ENQNRHI-RVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFDETENNDRTYTCHFIDFPTLT--NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFT-GSLIIIPDI-SQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYL-----QTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK-VTEEG-TKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            EN  R + R ID L ++ + + +++ E         Y++   ++  + + FL V+ + + ++D  L + ++     + P F     +IF    FD   ++   +      F  L   N+RNL   ++ +L+   G VIR+  + PE+    F+CQ C    +    +    +P++CG  +C       LI  +S + D Q +++QE+  ++P G  P  + +   N+ V+  QPGD+   T G L+  P + S  T    R L       S    S V G+  +  R +  R+    ++V +V   ++     +  D      L  ++  K  +E+ V  +  +++ P++ + +   L P+ Y ++++K+G+LL LFGG  K  +  G  K R +INI + GDP T+KSQ L+ +    PR  YTSGK SSA GLTA V++D E+ + V++ GAL+L++NG+CCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+TSVLAAANP+  +++  ++  +NI L   ++SRFDL F+L+D   E  D  +A  +       + E+++  + +   ++ YI +A     PR++EEA + ++  Y  MR+  ++ G  SA+    RQLESL+RL+EA A++R S+ VE  DV EA RL
Sbjct:  164 ENFQRFLQRFIDPLAKEEENVGIDITEPL-------YMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIF----FDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCG--RCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTDGVLLSSPRLESNGTILAHRNLRLPGSSHSPASASRVAGITGI-YRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSE-EQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAY---PRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRL 805          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Human
Match: MCM7 (minichromosome maintenance complex component 7 [Source:HGNC Symbol;Acc:HGNC:6950])

HSP 1 Score: 317.005 bits (811), Expect = 6.545e-96
Identity = 208/544 (38.24%), Postives = 293/544 (53.86%), Query Frame = 1
Query:  436 LRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCM-NRL--KFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT-----ESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            +R +R  ++GKLV  RG V R   V P++V+ T+ C  CG       Q   F    +C + +C  NR   +  L    S+++ FQ++++QE  +++P G IPR + V++  E    AQPGD    TG  + I                    L  G+   V GL             +L  H     NK    +D +  GELT + L +++ E+            +  + +   + P  YG+++VK+ LLL+L GGV + +  G K+RG+INIC++GDP  AKSQ L  I   +PR+ YT+G+ SS  GLTAAV+RD  SGE  +E GAL+LA+ GVCCIDEFDKM   D+ AIHE MEQQTIS+ KAGI  TLNA+ S+LAAANP  GRY+  RSL QNI L A ++SRFDL +++ D      D  +A+ IT       Q P   E  D ++     ++RYI   R  +P V E     +   Y +MR    A  S+ A   + R L +++RLS A AR+R  D VE+ DV EA RL+  S
Sbjct:  149 IREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPI--------------------LRTGFRQVVQGL---------LSETYLEAHRIVKMNK--SEDDESGAGELTREEL-RQIAEE------------DFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQ-SPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKL-----MRRYIAMCREKQPMVPESLADYITAAYVEMRRE--AWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMS 640          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 317.39 bits (812), Expect = 3.836e-95
Identity = 207/653 (31.70%), Postives = 347/653 (53.14%), Query Frame = 1
Query:   94 ENQNRHI-RVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFDETENNDRTYTCHFIDFPTLT--NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK-VTEEGT-KLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            EN  R + R ID L ++ + + +++ E         Y++   ++  + + FL V+ + + ++D  L + ++     + P F     +IF    FD   ++   +      F  L   N+RNL   ++ +L+   G VIR+  + PE+    F+CQ C    +    +    +P++CG  +C       LI  +S + D Q +++QE+  ++P G  P  + +   N+ V+  QPGD+   TG    +P                 I++    +  V+ +K +      Y+      H    + K L    ++EE E       K  +E+ V  +  +++ P++ + +   L P+ Y ++++K+G+LL LFGG  K  +  G  K R +INI + GDP T+KSQ L+ +    PR  YTSGK SSA GLTA V++D E+ + V++ GAL+L++NG+CCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+TSVLAAANP+  +++  ++  +NI L   ++SRFDL F+L+D   E  D  +A  +       + E+++  + +   ++ YI +A     PR++EEA + ++  Y  MR+  ++ G  SA+    RQLESL+RL+EA A++R S+ VE  DV EA RL
Sbjct:  114 ENFQRFLQRFIDPLAKEEENVGIDITEPL-------YMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIF----FDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCG--RCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVP-----------------IRV----NPRVSNVKSV------YKTHIDVIHYRKTDAKRLH--GLDEEAE------QKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSE-EQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAY---PRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRL 714          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Celegans
Match: mcm-6 (DNA replication licensing factor mcm-6 [Source:UniProtKB/Swiss-Prot;Acc:P34647])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 394/816 (48.28%), Postives = 530/816 (64.95%), Query Frame = 1
Query:  115 RVIDALGEKCQRLFLNLLENFK-VGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENND---RTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIK-LSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDM---NEEG---ELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVT-EEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAV----------ESEDAMGQDSQ------------TITFDEYHQITGLIISHLRAIDIDN----EEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPN-VAAD 2445
            +V D  G + Q  F   L++FK   +EF Y    K++   EK  + ++ + L  + + L+  I L +YR+YPF+C+A  +      DE+E      +       +    T +R L    +G LV+  GQ++R+H VHPEL    F C+DCG   ++++QQF +T+PT C NPQCMNR +F L    S +VDFQK+R+QETQ ELPRG IPR +DVI+R E VE  QPGD+ +  G+LI+IPDI+QL+TPG R   + Q +  +     G+TGLK LGVRDLTY+MAFLA H+        QTE +   +  G   E  Y  L  K++ ++   +  M+ D  + KN+ D LFP  YGN EVK G+LLML GGV K + +EGT LRGDIN+C+VGDPSTAKSQ LK +  FSPRA+YTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+ S+LAAANPV GRYDRSR L+ N+ +SAPIMSRFDLFFVL+DEC E  D+ IA+RI ++ R +        +Y  DDI++YI FARCF+P+++++A + +V EY K+R  D+ + + S+WRITVRQLESLVRLSEA AR+     V    V +A  LL+KSI+RVEQPDI L      N +            +D+M  D +             I+F EY Q++ +++ H+R+ D DN    E   +K+S LVEWYL +I  ++  E     +K + E +IHRLI +D++L+ V + E         DP + +HPN V AD
Sbjct:   11 QVEDTDGTRVQNEFSKFLKSFKDQKNEFIYKSAMKELVQPEKNTIFINMQHLYKFSNNLATTIELQYYRVYPFMCEALHLATLDACDESERQQMFKKQLYVSLFNLDAKTKVRELSADKVGGLVRIAGQIVRTHPVHPELSRACFVCEDCGVTTRDVQQQFRYTQPTKCANPQCMNRTRFSLDVNSSTFVDFQKIRIQETQAELPRGSIPRTVDVIVRGEMVETVQPGDKCDIVGTLIVIPDIAQLSTPGLRAETSNQNRGRATDKSEGITGLKALGVRDLTYKMAFLACHIQ-------QTESLVGGDASGAVEETDYLDLWSKMSTEDRATLKKMSDDKKIEKNIVDSLFPNIYGNHEVKLGVLLMLLGGVAKKSRDEGTSLRGDINVCLVGDPSTAKSQVLKAVEEFSPRAIYTSGKASSAAGLTAAVVKDEESFEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARASILAAANPVNGRYDRSRPLKYNVQMSAPIMSRFDLFFVLVDECNEVTDYAIARRILDNHRAISEHTERDSVYKIDDIKKYIAFARCFKPKISDKAAETLVREYKKLRMSDSNNAATSSWRITVRQLESLVRLSEALARLHCGKEVLVEHVEKAAELLNKSIVRVEQPDIALDDDDFDNNIMVVEADKENQRGDDSMDHDGEKENAPKIDIAKLKISFKEYKQLSDVLVLHMRS-DEDNQGEDEYDGVKQSALVEWYLSTIEADLETEEDFNVQKTICERVIHRLIHQDHVLLEVEQGE---------DPTLCVHPNYVIAD 809          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Celegans
Match: mcm-6 (DNA replication licensing factor mcm-6 [Source:UniProtKB/Swiss-Prot;Acc:P34647])

HSP 1 Score: 480.33 bits (1235), Expect = 2.188e-161
Identity = 273/532 (51.32%), Postives = 357/532 (67.11%), Query Frame = 1
Query:  952 MAFLANHVATVNNKYLQTEDM---NEEG---ELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVT-EEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAV----------ESEDAMGQDSQ------------TITFDEYHQITGLIISHLRAIDIDN----EEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPN-VAAD 2445
            MAFLA H+        QTE +   +  G   E  Y  L  K++ ++   +  M+ D  + KN+ D LFP  YGN EVK G+LLML GGV K + +EGT LRGDIN+C+VGDPSTAKSQ LK +  FSPRA+YTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+ S+LAAANPV GRYDRSR L+ N+ +SAPIMSRFDLFFVL+DEC E  D+ IA+RI ++ R +        +Y  DDI++YI FARCF+P+++++A + +V EY K+R  D+ + + S+WRITVRQLESLVRLSEA AR+     V    V +A  LL+KSI+RVEQPDI L      N +            +D+M  D +             I+F EY Q++ +++ H+R+ D DN    E   +K+S LVEWYL +I  ++  E     +K + E +IHRLI +D++L+ V + E         DP + +HPN V AD
Sbjct:    1 MAFLACHIQ-------QTESLVGGDASGAVEETDYLDLWSKMSTEDRATLKKMSDDKKIEKNIVDSLFPNIYGNHEVKLGVLLMLLGGVAKKSRDEGTSLRGDINVCLVGDPSTAKSQVLKAVEEFSPRAIYTSGKASSAAGLTAAVVKDEESFEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARASILAAANPVNGRYDRSRPLKYNVQMSAPIMSRFDLFFVLVDECNEVTDYAIARRILDNHRAISEHTERDSVYKIDDIKKYIAFARCFKPKISDKAAETLVREYKKLRMSDSNNAATSSWRITVRQLESLVRLSEALARLHCGKEVLVEHVEKAAELLNKSIVRVEQPDIALDDDDFDNNIMVVEADKENQRGDDSMDHDGEKENAPKIDIAKLKISFKEYKQLSDVLVLHMRS-DEDNQGEDEYDGVKQSALVEWYLSTIEADLETEEDFNVQKTICERVIHRLIHQDHVLLEVEQGE---------DPTLCVHPNYVIAD 515          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 345.895 bits (886), Expect = 1.715e-105
Identity = 224/713 (31.42%), Postives = 371/713 (52.03%), Query Frame = 1
Query:   76 IKMDATEN-QNRHIR--VID-ALGEKCQRLFLNLLENFKV--GDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSG---------------------LSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKN-IEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDP------------------EKSDTRIYNEDDIQRYITFAR--CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDI 2070
            I +D  EN + R IR  V D A+ ++ +R F N L +F      + KY++  K M +  +  L VSF DL + D+G                      + ++++N Y  Y  +C   ++ I++                   P   ++R LR  +L  L++  G V  + G+ P+L +  + C  CG ++   ++Q     +PTIC  P C  +  FEL  E + Y ++Q++ +QE+ N++  G +PR  DVIL  +  ++ +PGD+ E TG                             Y +   G        L Y+  F       V N  +    +  + ++  D    +LT++++  +  ++QDPN+ + +   + P+ YG+D+VKR + L LF G  K      +LRGDIN+ + GDP TAKSQFL+  A  +PR+V T+G+ +SA GLTA V R   + E+ +EAGA++LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L+A+ +V+AA+NP+GGRY+ +R+  +N+ L+ PI+SRFD+  V+ D      D  +AK +  + R   P                  E++  R+  +D +++YI +AR  C  P + E+  +     +A+MR+   A+GS +   ITVR +ES++RLSEA A++    +V + D   A R++ +S +  ++  I
Sbjct:  142 IPVDILENIRGRTIRDHVSDEAVAKEIERRFKNFLRSFHEPGNKQTKYIQMIKSMAADNRESLEVSFTDL-SDDNGEQNISYFLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNEIKVRISQ------------------LPVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVRPTIC--PSCQGKGPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGV----------------------------YTNNFDG-------SLNYKQGF------PVFNTLIHANHITNKDKMASD----QLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAREKC-HPTLPEQHSEKFSNIFAQMRKESMATGSVA---ITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESFVNTQKASI 784          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 345.895 bits (886), Expect = 1.715e-105
Identity = 224/713 (31.42%), Postives = 371/713 (52.03%), Query Frame = 1
Query:   76 IKMDATEN-QNRHIR--VID-ALGEKCQRLFLNLLENFKV--GDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSG---------------------LSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKN-IEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDP------------------EKSDTRIYNEDDIQRYITFAR--CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDI 2070
            I +D  EN + R IR  V D A+ ++ +R F N L +F      + KY++  K M +  +  L VSF DL + D+G                      + ++++N Y  Y  +C   ++ I++                   P   ++R LR  +L  L++  G V  + G+ P+L +  + C  CG ++   ++Q     +PTIC  P C  +  FEL  E + Y ++Q++ +QE+ N++  G +PR  DVIL  +  ++ +PGD+ E TG                             Y +   G        L Y+  F       V N  +    +  + ++  D    +LT++++  +  ++QDPN+ + +   + P+ YG+D+VKR + L LF G  K      +LRGDIN+ + GDP TAKSQFL+  A  +PR+V T+G+ +SA GLTA V R   + E+ +EAGA++LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L+A+ +V+AA+NP+GGRY+ +R+  +N+ L+ PI+SRFD+  V+ D      D  +AK +  + R   P                  E++  R+  +D +++YI +AR  C  P + E+  +     +A+MR+   A+GS +   ITVR +ES++RLSEA A++    +V + D   A R++ +S +  ++  I
Sbjct:  142 IPVDILENIRGRTIRDHVSDEAVAKEIERRFKNFLRSFHEPGNKQTKYIQMIKSMAADNRESLEVSFTDL-SDDNGEQNISYFLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNEIKVRISQ------------------LPVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVRPTIC--PSCQGKGPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGV----------------------------YTNNFDG-------SLNYKQGF------PVFNTLIHANHITNKDKMASD----QLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAREKC-HPTLPEQHSEKFSNIFAQMRKESMATGSVA---ITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESFVNTQKASI 784          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 327.02 bits (837), Expect = 5.906e-99
Identity = 202/621 (32.53%), Postives = 328/621 (52.82%), Query Frame = 1
Query:  199 YVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPT--LTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK--VTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSI 2046
            Y+E   +    E   + ++ K L  +   L + ++     + P+L     I +N+ F E  N     +     F      N+R L   ++ +L+   G V R+  + PE+  G F+C  C   +++   +    +P +C N  C N   F+L+  +S ++D Q V++QE+ +++P G  P  + V      VE+ QPGD+   TG   I         P  R L +                         YR +  A H   ++   L  ++    GE         +TE+ + +++ +++ P+++  +   + P+ Y +D+VKRGLL +LFGG  K   T   TKLR +INI + GDP T+KSQ L+ +    PR+ YTSGK SSA GLTA+V RD ++ + V++ GAL+LA+NGVCCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+ SVLAAANPV  +++R++++ +NI+L   ++SRFDL F+++D   E  D  +   +       D  +  T   + + ++ YI +A+    P+++EEA + ++ +Y  MR+  A  G  +A+    RQLESL+RLSEA A++R S  V   DV +A  L  +++
Sbjct:  157 YMERLLECNDAEVTHINLNLKHLNAFSEALYRKVIAYPADVIPYL----DIVVNEVFAERFNRTLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTN--CSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTG---IFRATGMKVNPKQRALAS------------------------VYRTSIDALHFRKMDTSRLHQDN----GE--------TITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGNQEKTEHVDMNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQHGQITAY---PRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREAL 729          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Fly
Match: Mcm6 (gene:FBgn0025815 transcript:FBtr0070952)

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 403/823 (48.97%), Postives = 557/823 (67.68%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCH--FIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINL-------------------SQQAAVNAVE-------SEDAMGQDSQTITFDEYHQITGLIISHLRA----IDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEIS-------KDDPIVFLHPN 2433
            MD  + Q   +RV D +G + Q+LF + LE FK   E KY   A  + S ++  L VSF+D+  YD  L+  I+  +Y +YPFLCQ+   ++  +       D    C+  F + PT   +R+L    +G L++  GQV+R+H VHPELV G F C DC T ++N+EQQF FT PTIC NP C NR +F L  E+S ++DFQK+R+QETQ ELPRGCIPR +++ILR+E VE  Q GD+ +FTG+LI++PD+S L   G+R   + + K  EG D GVTGLK LG+R+L YRMAFLA  V     ++  T+      E+T + + K++T+ E +K+  M++D NL +N+   LFP+ YGNDEVKRG+LL  FGGV K T E T LRGDIN+CIVGDPSTAKSQFLK+++ FSPRA+YTSGKASSAAGLTAAVVRD+ES +FVIEAGALMLA+NG+CCIDEFDKM+ RDQVAIHEAMEQQTIS+ +AG++ATLNA+TS+LAAANP+ GRYDRS+SL+QNI LSAPIMSRFDLFF+L+DEC E VD+ IA++I +    +  E+S  R Y  +++ RY+TFAR F+P +++EA  ++V  Y  +R+RD  +  RS WRITVRQLES++RLSEA A++  S+ V E  V EA RLL+KSIIRVEQPDI+L                   +  AA N  E       +  A+ +   T++F++Y  ++ +++ H+RA     +++  +  +K+S +V WYL  + + I  E+ L+ +K +IE +I RLI  D +++ + +T +    I        +DDP++ +HPN
Sbjct:    1 MDVADAQVGQLRVKDEVGIRAQKLFQDFLEEFKEDGEIKYTRPAASLESPDRCTLEVSFEDVEKYDQNLATAIIEEYYHIYPFLCQSVSNYVKDRIGLKTQKD----CYVAFTEVPTRHKVRDLTTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVCSNRKRFMLDVEKSLFLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKPGEGMD-GVTGLKALGMRELNYRMAFLACSVQATTARFGGTD--LPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLHSNI--EESVERAYTREEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIRVEQPDIHLDDDEGLDMDDGIQHDIDMENNGAAANVDENNGMDTSASGAVQKKKFTLSFEDYKNLSTMLVLHMRAEEARCEVEGNDTGIKRSNVVTWYLEQVADQIESEDELISRKNLIEKLIDRLIYHDQVIIPL-KTSTLKPRIQVQKDFVEEDDPLLVVHPN 813          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 343.969 bits (881), Expect = 1.280e-104
Identity = 203/562 (36.12%), Postives = 312/562 (55.52%), Query Frame = 1
Query:  415 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKN-IEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYN-----------EDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            + P +  LR  R  +L +LV+  G V  + GV P+L +  + C  CG V+   ++ Q    KP  C  P+C +   F +  EQ+ Y ++QK+ +QE+   +P G IPR  DVIL  +  +  +PGD+ E TG                          +  YD  +   +   V    +    +ANHV   ++K                 +++ LT++++  +  +++DP +V+ +   + P+ YG+D +KR L L LFGG  K   E  K+RGDIN+ I GDP TAKSQFLK     +PRAV+T+G+ +SA GLTA V R+  S E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N++LS PI+SRFD+  V+ DE     D ++AK +  S     P + +                +D +++YI +A+    P++T      +   YA++R+   A+GS     ITVR +ES++R+SEA ARM   + V E DV  A R++ +S I  ++
Sbjct:  272 ELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQNTEIKPGSC--PECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIY------------------------TNNYDGSLNTDQGFPV----FATVIIANHVVVKDSK----------------QVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGS---LPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEAQK 784          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0345797)

HSP 1 Score: 304.679 bits (779), Expect = 2.719e-90
Identity = 215/658 (32.67%), Postives = 337/658 (51.22%), Query Frame = 1
Query:  112 IRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQ-------------DIMLN--FYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK--VTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            +R ID   E+ +     + EN  V     Y++  +++ +LE+ +L ++   L T+D  L +             D+ +N  F+  YP      QI + + F    N D+T            N+R+L   ++ +L+   G VIRS  V PE+    F C  C         +    +PT+C N  C     F LI  +S++ D Q V++QE+ +++  G  P  + +   N+ V+  QPGD+   TG     P            L+T       G  S V  +         Y+      H   V+NK L  +   EEG+   D +      + V  +  + + P++   +   + P+ Y ND++K+G+LL LFGG  K   T      R +I++ + GDP T+KSQ L+ +    PR+ YTSG+ SSA GLTA V +D E+ + V++ GAL+LA+NGVCCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+TS+LAAANP   ++++ +++  N+ L   ++SRFDL F+++D   E  D  +A  +         E+ DT +++   ++ YI +AR    P +++EA + ++  Y  MR+  A  G  SA+    RQLESL+RLSEA A++R S+ VE  DV EA RL
Sbjct:  173 MRFIDPSAEQDE-----ISENIDVNQPL-YLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQV-RPF----NADKT-----------RNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTN--CNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATP------------LKTG------GLSSSVKSV---------YKTHVDVVHFRKVDNKRLYED---EEGK---DHI---FPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDT-MFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAY---PRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRL 766          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0088982)

HSP 1 Score: 304.679 bits (779), Expect = 2.719e-90
Identity = 215/658 (32.67%), Postives = 337/658 (51.22%), Query Frame = 1
Query:  112 IRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQ-------------DIMLN--FYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK--VTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            +R ID   E+ +     + EN  V     Y++  +++ +LE+ +L ++   L T+D  L +             D+ +N  F+  YP      QI + + F    N D+T            N+R+L   ++ +L+   G VIRS  V PE+    F C  C         +    +PT+C N  C     F LI  +S++ D Q V++QE+ +++  G  P  + +   N+ V+  QPGD+   TG     P            L+T       G  S V  +         Y+      H   V+NK L  +   EEG+   D +      + V  +  + + P++   +   + P+ Y ND++K+G+LL LFGG  K   T      R +I++ + GDP T+KSQ L+ +    PR+ YTSG+ SSA GLTA V +D E+ + V++ GAL+LA+NGVCCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+TS+LAAANP   ++++ +++  N+ L   ++SRFDL F+++D   E  D  +A  +         E+ DT +++   ++ YI +AR    P +++EA + ++  Y  MR+  A  G  SA+    RQLESL+RLSEA A++R S+ VE  DV EA RL
Sbjct:  173 MRFIDPSAEQDE-----ISENIDVNQPL-YLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQV-RPF----NADKT-----------RNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTN--CNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATP------------LKTG------GLSSSVKSV---------YKTHVDVVHFRKVDNKRLYED---EEGK---DHI---FPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDT-MFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAY---PRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRL 766          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 298.901 bits (764), Expect = 2.936e-89
Identity = 211/648 (32.56%), Postives = 329/648 (50.77%), Query Frame = 1
Query:  193 FKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIF---INKQFDETENNDRTYTCHFIDFPTL-------TNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFI---FTKPTIC-----GNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRI------TESQRPVDPEKSDTRIYNEDDIQRYITFARCF-EPRVTEEAFKLMVTEYAKMR----ERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 2049
            +KY +  K+     + FL +  +DL+ +D  L+        +L     +  +IF     +  DE       +  H  D   L       TN+R L+   + KLVK  G ++ + G+  +    + +C  C TV+ N++       +  P  C     G P+C     F ++P++ K VDFQ +++QE  + +P+G IPR + +       E   PG++    G    I  I ++  P  R    K +               +GVR    R+  +             T D    G ++  S    +T  E      M    ++ + +   L P+ +G+ ++K+ +  MLFGG  K   +G   RGDIN+ ++GDP TAKSQ LK +   +P AVYTSGK SSAAGLTA+V++D ++  FV+E GA++LA+ GV CIDEFDKM   D+VAIHEAMEQQTIS+ KAGI  TLN++ SVLAAAN + GR+D ++   +NI     I+SRFD+ F++ D   E  D  +AK I      +    P +P + +  +      ++YI + R    PR++E A + + + Y  MR    +++ AS  R +  ITVRQLE+++R+SE+ A++R   F  +  V EA RL   S +
Sbjct:   48 YKYRDTLKRNYLNGRYFLEIEMEDLVGFDETLAD-------KLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHDIQILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYALPRKCNTEQAGRPKCPLD-PFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQG----IYSIRKVGKPSRRDGREKAV---------------VGVRAPYMRVVGI-------------TVDSEGAGAISRYS---NITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKG-EENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPSEPAEGEISLST---FKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTL 648          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Zebrafish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:ZFIN;Acc:ZDB-GENE-030909-6])

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 431/801 (53.81%), Postives = 555/801 (69.29%), Query Frame = 1
Query:   82 MDATE---NQNRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ---------------------------QAAVNAVESEDAM---------GQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM 2361
            MD TE   NQN    + D L EKCQ+LF   LE F+  D E KY+ +A+++   E+  L VSF DL  ++  L+  I   FYRLYP+LC+A + F  +   E   +   Y   F D PT   +R L    +G LV+  GQV+R+H VHPELV GTF C DC  V+K++EQQF +T+P+IC NP C NR +F L   +SK++DFQKVR+QETQ ELPRG IPR M+VILR E VE+AQ GD+ +F GSLI++PDISQL TPG R   + +    +GY++ G+ GLK LGVR+L+Y++AFLA HVA  N ++   E  +EE   T +S+ K+++ QE  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+C+VGDPSTAKSQFLK +  F PRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKME RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPV GRYDRS+SL+QN++L+APIMSRFDLFF+L+D+C E  D+ IA+RI +    +  E S  R+Y+ D+I+RY+ FAR F+P++++E+ + +V +Y ++R+RD +  ++SAWRITVRQLESL+RLSE+ ARM   D V+   V EA RLL+KSIIRVE PD+NL Q                              VN  E  + +          + S  ++F EY +I+ L++ HLR  + D +E  LKKSE+V WYL  I   I  E  L+ KK MIE +I+RL+  D IL+
Sbjct:    1 MDLTETGVNQNAGQVIKDELAEKCQKLFQAFLEEFQNSDGEVKYLRDAEELIRPERNTLAVSFTDLEGFNQELATAIQEEFYRLYPYLCRAVRNFA-RDHGEVPTSKEFYVA-FQDLPTRHKIRELTTVKVGSLVRISGQVVRTHPVHPELVSGTFLCLDCQGVIKDVEQQFKYTQPSICRNPVCNNRRRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEVILRAEAVESAQAGDKCDFIGSLIVVPDISQLATPGVRAETSSRTAGVQGYENEGLRGLKALGVRELSYKLAFLACHVAPTNPRFGGKEIRDEEQ--TAESIKKQMSVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCVVGDPSTAKSQFLKHVEEFCPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSRI--ENSVDRVYSLDEIRRYLLFARQFKPKISKESEEFIVEQYKRLRQRDGSGVTKSAWRITVRQLESLIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEEAMEEEEDNQMNGHDVPNGVNGAVNGEVNGHEHTNGINGHGVNGETAKPSLRLSFAEYKRISNLLVLHLRRAEEDEDEAALKKSEVVNWYLKEIESEIDSEMELISKKTMIEKVIYRLVHYDYILI 795          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 416/819 (50.79%), Postives = 569/819 (69.47%), Query Frame = 1
Query:  109 HIRVIDALGEKCQRLFLNLLENF--KVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITE-SQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ----------------------AAVNAVESED------------AMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTE----SFGGE--ISKDDPIVFLHPN 2433
            H+R  D L EKCQ+LFL  LE F  K GD   Y+ +A+++   E+  L VSF ++  Y+  L+  I   +YR+YPFLC+A + F     +   + +  +   F +FP+   +R L    +G L++  GQV+R+H VHPELV GTF C DC +V+K++EQQF +T+PTIC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE AQ GD+ +FTG+LI++PD+S +   G+R   + ++   EG+++ G+ GLK LGVR+L+YR+AFLAN+VA  N ++   E   E+   T +S+  ++T QE  KV  M+QD NL  N+C  LFPT +GNDE+KRG+LLMLFGGV K T EGT LRGDIN+CIVGDPST+KSQFLK +  F+PRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ GRY+R++SL+QN+++SAPIMSRFDLFF+L+DEC E  D+ IA+RI +   R V+   S  R+Y+ D+IQRYI FAR F+P++T EA + +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  AR+  SD V+   V EA RLL+KSIIRV+ PDIN  Q+                        VN    ED            A  + +  ++F EY +++ L++ H++ ++  +E+  LKKSEL+ WYL  I   I  E  L+ KK +IE +++RLI  D+I++ + +T     S  GE  +++DDP + ++PN
Sbjct:   11 HVR--DELSEKCQKLFLEFLEEFQDKNGDAL-YLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFLCRAVRHFARDHGNIPPSKE--FYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQ--TAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVE---SVERVYSTDEIQRYILFARQFQPKITVEAQEFVVDQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSIIRVDSPDINFDQEHDEDNINDQNELFGKETEGQNGGDVNGHAVEDMETDQTEKPEKPAAAKPALRMSFAEYKRVSNLLVLHMQKMEQLDEDSSLKKSELINWYLKEIESEIDSEAELVAKKNLIERVLYRLINFDHIIIELTKTGLKKISEDGEEPVTEDDPFLVVNPN 819          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 416/819 (50.79%), Postives = 569/819 (69.47%), Query Frame = 1
Query:  109 HIRVIDALGEKCQRLFLNLLENF--KVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITE-SQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ----------------------AAVNAVESED------------AMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRT----ESFGGE--ISKDDPIVFLHPN 2433
            H+R  D L EKCQ+LFL  LE F  K GD   Y+ +A+++   E+  L VSF ++  Y+  L+  I   +YR+YPFLC+A + F     +   + +  +   F +FP+   +R L    +G L++  GQV+R+H VHPELV GTF C DC +V+K++EQQF +T+PTIC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE AQ GD+ +FTG+LI++PD+S +   G+R   + ++   EG+++ G+ GLK LGVR+L+YR+AFLAN+VA  N ++   E   E+   T +S+  ++T QE  KV  M+QD NL  N+C  LFPT +GNDE+KRG+LLMLFGGV K T EGT LRGDIN+CIVGDPST+KSQFLK +  F+PRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ GRY+R++SL+QN+++SAPIMSRFDLFF+L+DEC E  D+ IA+RI +   R V+   S  R+Y+ D+IQRYI FAR F+P++T EA + +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  AR+  SD V+   V EA RLL+KSIIRV+ PDIN  Q+                        VN    ED            A  + +  ++F EY +++ L++ H++ ++  +E+  LKKSEL+ WYL  I   I  E  L+ KK +IE +++RLI  D+I++ + +T     S  GE  +++DDP + ++PN
Sbjct:   11 HVR--DELSEKCQKLFLEFLEEFQDKNGDAL-YLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFLCRAVRHFARDHGNIPPSKE--FYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQ--TAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVE---SVERVYSTDEIQRYILFARQFQPKITVEAQEFVVDQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSIIRVDSPDINFDQEHDEDNINDQNELFGKETEGQNGGDVNRHAVEDMETDQTEKPEKPAAAKPALRMSFAEYKRVSNLLVLHMQKMEQLDEDSSLKKSELINWYLKEIESEIDSEAELVAKKNLIERVLYRLINFDHIIIELTKTGLKKTSEDGEEPVTEDDPFLVVNPN 819          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 416/819 (50.79%), Postives = 568/819 (69.35%), Query Frame = 1
Query:  109 HIRVIDALGEKCQRLFLNLLENF--KVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITE-SQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ----------------------AAVNAVESED------------AMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTE----SFGGE--ISKDDPIVFLHPN 2433
            H+R  D L EKCQ+LFL  LE F  K GD   Y+ +A+++   E+  L VSF ++  Y+  L+  I   +YR+YPFLC+A + F     +   + +  +   F +FP+   +R L    +G L++  GQV+R+H VHPELV GTF C DC +V+K++EQQF +T+PTIC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE AQ GD+ +FTG+LI++PD+S +   G+R   + ++   EG+++ G+ GLK LGVR+L+YR+AFLAN+VA  N ++   E   E+   T +S+  ++T  E  KV  M+QD NL  N+C  LFPT +GNDE+KRG+LLMLFGGV K T EGT LRGDIN+CIVGDPST+KSQFLK +  F+PRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ GRY+R++SL+QN+++SAPIMSRFDLFF+L+DEC E  D+ IA+RI +   R V+   S  R+Y+ D+IQRYI FAR F+P++T EA + +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  AR+  SD V+   V EA RLL+KSIIRV+ PDIN  Q+                        VN    ED            A  + +  ++F EY +++ L++ H++ ++  +E+  LKKSEL+ WYL  I   I  E  L+ KK +IE +++RLI  D+I++ + +T     S  GE  +S+DDP + ++PN
Sbjct:   11 HVR--DELSEKCQKLFLEFLEEFQDKNGDAL-YLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFLCRAVRHFARDHGNIPPSKE--FYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQ--TAESVKNQMTVLEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVE---SVERVYSTDEIQRYILFARQFQPKITVEAQEFVVDQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSIIRVDSPDINFDQEHDEDNINDQNELFGKETEGQNGGDVNGHAVEDMETDQTEKPEKPAAAKPALRMSFAEYKRVSNLLVLHMQKMEQLDEDSSLKKSELINWYLKEIESEIDSEAELVAKKNLIERVLYRLINFDHIIIELTKTGLKKISEDGEEPVSEDDPFLVVNPN 819          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 313.153 bits (801), Expect = 2.353e-93
Identity = 206/653 (31.55%), Postives = 334/653 (51.15%), Query Frame = 1
Query:  142 CQRLFLNLLENFKVGD------------EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFD---ETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK-VTEEGT-KLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT----ESQRPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            C+  F   L+ F   D            E  Y++   +++ + +  L V+   + T+D+ L + ++     + P F     ++F ++  D   E +   R Y+          N+RNL   ++ +L+   G VIR+  + PE+    F+CQ C    +    +    +P +C N  C       L+  +S + D Q +++QE+  ++P G  P    V   N+ V+  QPGD+   TG     P            L  +Q ++   Y + +  +                 H    + K L    ++E+GE       K  T++ V  +  +   P++ + +   L P+ Y ++++K+G+LL LFGG  K  T+ G    R ++NI + GDP T+KSQ L+ +    PR  YTSGK SSA GLTA V++D E+ + V++ GAL+L++NG+CCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+TS+LAAANPV  +++  ++  +NI L   ++SRFDL F+++D   E  D  +A  +     +S+  ++ E  D  +     ++ YI FAR    PR++EEA + ++  Y  MR+  +  G  SA+    RQLESL+RL+EA A++RFS  VE  DV EA RL
Sbjct:  144 CKEKFQRFLQQFTDPDSREEENAGLDLNEPLYMQKLDEISVVGEPVLNVNCTHIQTFDADLYRQLICYPQEVIPTFDMSVNELFFDRFPDSVLEHQIQVRPYSAI-----KTRNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFNTRVEVDRGRIAEPAVCRN--CNTTHSMALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAP----------MRLNPRQSQVKSVYKTHIDAI-----------------HFRKTDEKRLH--GLDEDGE------QKLFTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQIEEEHLDMAV-----LKDYIAFARTTVHPRLSEEASQALIEAYVDMRKIGSGRGMVSAY---PRQLESLIRLAEAHAKVRFSGKVETIDVEEAKRL 746          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Xenopus
Match: mcm6.2 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:395030])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 421/796 (52.89%), Postives = 566/796 (71.11%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ------------------AAVNAVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGG---EISK-DDPIVFLHPN 2433
            V D + EKCQ+LF + LE F+  D E KY  +A+++   E+  L VSF DL  ++  L+  I   FYR+YP+LC+A + F     +  +N +  +   F D PT   +R L    +G L++  GQV+R+H VHPELV GTF C DC T+V+++EQQF +T+P+IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+ Q GD+ +FTGSLI++PDISQL TPG R   + ++  +EGY + GV GL+ LGVRDL+Y++ FLA +V   N ++   +D++EE ++T +S+  +++ +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+ +DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDR++SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y  D+++RY+ FAR F+P++++E+   +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  ARM  SD V+   V EA RLL+KSIIRVE PD+NL Q+                  A +   E   A  + S  + F EY +I+ L++  LR ++ D +E   +KSEL+ WYL  I   I  E  L+ +KQ+I+ ++HRL+  D IL+ + +T   G    E+ K +DP + ++PN
Sbjct:   19 VKDEVSEKCQKLFQDFLEEFRGSDGELKYQSDAEELIRPERNTLLVSFIDLEQFNQQLATTIQEEFYRVYPYLCRAVKAFARDHGNVPQNKE--FYVAFQDLPTRHKIRELTTPRIGSLLRISGQVVRTHPVHPELVSGTFLCLDCQTLVRDVEQQFKYTQPSICRNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVESCQAGDRCDFTGSLIVVPDISQLATPGVRAETSARVGGTEGYQAEGVQGLRALGVRDLSYKLVFLACYVCPTNPRF-GGKDLHEE-DMTAESIKNQMSVKEWEKVFEMSQDKNLYHNLCTSLFPTVHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDTKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRAKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYTLDEVRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGTGVTKSAWRITVRQLESMIRLSEGMARMHCSDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEDEHEAEEEPQEVINGKLPAMLRFPEPNAATPKPSLRLNFAEYKRISNLLVLQLRKME-DEDETSQRKSELINWYLKEIESEIDSEEELVTRKQIIDKVVHRLVHYDQILIELTQTGLKGTGDEEVPKEEDPYLVVNPN 807          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Xenopus
Match: mcm6.2 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:395030])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 423/808 (52.35%), Postives = 568/808 (70.30%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ--------------------AAVN---------AVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNE-EIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGG---EISK-DDPIVFLHPN 2433
            V D + EKCQ+LF + LE F+  D E KY  +A+++   E+  L VSF DL  ++  L+  I   FYR+YP+LC+A + F     +  +N +  +   F D PT   +R L    +G L++  GQV+R+H VHPELV GTF C DC T+V+++EQQF +T+P+IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+ Q GD+ +FTGSLI++PDISQL TPG R   + ++  +EGY + GV GL+ LGVRDL+Y++ FLA +V   N ++   +D++EE ++T +S+  +++ +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+ +DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDR++SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y  D+++RY+ FAR F+P++++E+   +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  ARM  SD V+   V EA RLL+KSIIRVE PD+NL Q+                    + VN         A E   A  + S  + F EY +I+ L++  LR ++ + E E   +KSEL+ WYL  I   I  E  L+ +KQ+I+ ++HRL+  D IL+ + +T   G    E+ K +DP + ++PN
Sbjct:   19 VKDEVSEKCQKLFQDFLEEFRGSDGELKYQSDAEELIRPERNTLLVSFIDLEQFNQQLATTIQEEFYRVYPYLCRAVKAFARDHGNVPQNKE--FYVAFQDLPTRHKIRELTTPRIGSLLRISGQVVRTHPVHPELVSGTFLCLDCQTLVRDVEQQFKYTQPSICRNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVESCQAGDRCDFTGSLIVVPDISQLATPGVRAETSARVGGTEGYQAEGVQGLRALGVRDLSYKLVFLACYVCPTNPRF-GGKDLHEE-DMTAESIKNQMSVKEWEKVFEMSQDKNLYHNLCTSLFPTVHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDTKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRAKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYTLDEVRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGTGVTKSAWRITVRQLESMIRLSEGMARMHCSDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEDEHEAEEEPQEVINGDASVPSGVNGHVNGMNGHAEEPNAATPKPSLRLNFAEYKRISNLLVLQLRKMEGEYEDETSQRKSELINWYLKEIESEIDSEEELVTRKQIIDKVVHRLVHYDQILIELTQTGLKGTGDEEVPKEEDPYLVVNPN 820          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Xenopus
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:548975])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 424/802 (52.87%), Postives = 558/802 (69.58%), Query Frame = 1
Query:  124 DALGEKCQRLFLNLLENFKVGDEFK-YVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAVE----------SEDAM--GQDSQ-----------TITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTE----SFGGEISKD---DPIVFLHPN 2433
            D L +KCQ+LFL  LE  K  D    YV  A+++   E+  L V+F D+  Y+  L+  I   +YR+YP LC+A + F  +Q      N   Y   F DFP    +R L    +G L++  GQV+R+H VHPELV GTF C DC +VVK++EQQF +T+PTIC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR +++ILR E VE A  GD+ +FTG+LI++PDIS L    +R     ++   EG++S GV GLK LGVRDL+YR+AFLA HV   N ++   +D+ EE + T +S+  ++T QE  KV  M+QD NL  N+C  LFPT +GNDE+KRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPST+KSQFLK +  FSPRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRY+RS+SL+ N++LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +       E+S  R+Y+ +DIQRY+ FAR F+P++T+EA + +V +Y ++R+RD +  ++S+WRITVRQLESL+RLSE+ ARM  SD V+   V EA RLLSKSIIRV+ PD++  Q      VE           E+AM   QD              ++F EY QI+ L++ H++ ++   EE  L  ++LV WYL  +   I  E  L+ KK++IE +IHRLI  D+IL+ + ++E        E S+D   D I+ ++PN
Sbjct:   21 DELSDKCQKLFLEFLEECKGKDGSNLYVSAAEELVRPERNTLVVNFTDIEYYNQQLATTIQEEYYRVYPHLCRAVRSFA-RQMGNIPANKEFYVA-FSDFPARQKIRELSSAKIGTLLRISGQVVRTHPVHPELVSGTFLCMDCQSVVKDVEQQFRYTQPTICKNPVCANRRRFTLDTNKSRFVDFQKVRIQETQAELPRGAIPRSVEIILRAEAVETAMAGDRCDFTGTLIVVPDISALAAGDARMETGAKVTGGEGFNSEGVQGLKALGVRDLSYRLAFLACHVGATNPRF-GGKDLREEDQ-TAESIKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGVLLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYERSKSLKHNVNLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLH--ARNEESIERVYSIEDIQRYLLFARQFQPKITKEAEEFIVEQYRRLRQRDGSGVAKSSWRITVRQLESLIRLSESMARMHCSDEVQPKHVKEAFRLLSKSIIRVDTPDVSFDQGEDEKNVEEEVNNANLNNGEEAMETNQDEPINDKPSTNAGLKMSFAEYKQISNLLVLHMQKMEEVEEECHLTTTDLVNWYLKEMEAEIETETELILKKRLIEKVIHRLINYDHILIELNKSELKTMDDSKETSEDAAEDRILVVNPN 816          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Xenopus
Match: mcm6.2 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:395030])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 416/785 (52.99%), Postives = 556/785 (70.83%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ--------------------AAVN---------AVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNE-EIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRT 2376
            V D + EKCQ+LF + LE F+  D E KY  +A+++   E+  L VSF DL  ++  L+  I   FYR+YP+LC+A + F     +  +N +  +   F D PT   +R L    +G L++  GQV+R+H VHPELV GTF C DC T+V+++EQQF +T+P+IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+ Q GD+ +FTGSLI++PDISQL TPG R   + ++  +EGY + GV GL+ LGVRDL+Y++ FLA +V   N ++   +D++EE ++T +S+  +++ +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+ +DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDR++SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y  D+++RY+ FAR F+P++++E+   +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  ARM  SD V+   V EA RLL+KSIIRVE PD+NL Q+                    + VN         A E   A  + S  + F EY +I+ L++  LR ++ + E E   +KSEL+ WYL  I   I  E  L+ +KQ+I+ ++HRL+  D IL+ + +T
Sbjct:   19 VKDEVSEKCQKLFQDFLEEFRGSDGELKYQSDAEELIRPERNTLLVSFIDLEQFNQQLATTIQEEFYRVYPYLCRAVKAFARDHGNVPQNKE--FYVAFQDLPTRHKIRELTTPRIGSLLRISGQVVRTHPVHPELVSGTFLCLDCQTLVRDVEQQFKYTQPSICRNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVESCQAGDRCDFTGSLIVVPDISQLATPGVRAETSARVGGTEGYQAEGVQGLRALGVRDLSYKLVFLACYVCPTNPRF-GGKDLHEE-DMTAESIKNQMSVKEWEKVFEMSQDKNLYHNLCTSLFPTVHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDTKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRAKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYTLDEVRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGTGVTKSAWRITVRQLESMIRLSEGMARMHCSDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEDEHEAEEEPQEVINGDASVPSGVNGHVNGMNGHAEEPNAATPKPSLRLNFAEYKRISNLLVLQLRKMEGEYEDETSQRKSELINWYLKEIESEIDSEEELVTRKQIIDKVVHRLVHYDQILIELTQT 797          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Xenopus
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:548975])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 413/764 (54.06%), Postives = 538/764 (70.42%), Query Frame = 1
Query:  124 DALGEKCQRLFLNLLENFKVGDEFK-YVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAVE----------SEDAM--GQDSQ-----------TITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLI 2340
            D L +KCQ+LFL  LE  K  D    YV  A+++   E+  L V+F D+  Y+  L+  I   +YR+YP LC+A + F  +Q      N   Y   F DFP    +R L    +G L++  GQV+R+H VHPELV GTF C DC +VVK++EQQF +T+PTIC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR +++ILR E VE A  GD+ +FTG+LI++PDIS L    +R     ++   EG++S GV GLK LGVRDL+YR+AFLA HV   N ++   +D+ EE + T +S+  ++T QE  KV  M+QD NL  N+C  LFPT +GNDE+KRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPST+KSQFLK +  FSPRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRY+RS+SL+ N++LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +       E+S  R+Y+ +DIQRY+ FAR F+P++T+EA + +V +Y ++R+RD +  ++S+WRITVRQLESL+RLSE+ ARM  SD V+   V EA RLLSKSIIRV+ PD++  Q      VE           E+AM   QD              ++F EY QI+ L++ H++ ++   EE  L  ++LV WYL  +   I  E  L+ KK++IE +IHRLI
Sbjct:   21 DELSDKCQKLFLEFLEECKGKDGSNLYVSAAEELVRPERNTLVVNFTDIEYYNQQLATTIQEEYYRVYPHLCRAVRSFA-RQMGNIPANKEFYVA-FSDFPARQKIRELSSAKIGTLLRISGQVVRTHPVHPELVSGTFLCMDCQSVVKDVEQQFRYTQPTICKNPVCANRRRFTLDTNKSRFVDFQKVRIQETQAELPRGAIPRSVEIILRAEAVETAMAGDRCDFTGTLIVVPDISALAAGDARMETGAKVTGGEGFNSEGVQGLKALGVRDLSYRLAFLACHVGATNPRF-GGKDLREEDQ-TAESIKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGVLLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYERSKSLKHNVNLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLH--ARNEESIERVYSIEDIQRYLLFARQFQPKITKEAEEFIVEQYRRLRQRDGSGVAKSSWRITVRQLESLIRLSESMARMHCSDEVQPKHVKEAFRLLSKSIIRVDTPDVSFDQGEDEKNVEEEVNNANLNNGEEAMETNQDEPINDKPSTNAGLKMSFAEYKQISNLLVLHMQKMEEVEEECHLTTTDLVNWYLKEMEAEIETETELILKKRLIEKVIHRLI 778          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 433/810 (53.46%), Postives = 573/810 (70.74%), Query Frame = 1
Query:  103 NRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ-----------QAAVNAV------------ESEDA----MGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM----AVYRTESFGGEISKDDPIVFLHPN 2433
            ++H  V D + EKCQ+LFL+ LE F+  D E KY++ A+++   E+  L VSF DL  ++  LS  I   FYR+YP+LC+A + F+  + +     D  +   F D PT   +R L    +G L +  GQV+R+H VHPELV GTF C DC TV+K++EQQF +T+P IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+AQ GD+ +FTG+LI++PD+S+L+TPG+R     ++  ++GY++ G+ GL+ LGVRDL+YR+ FLA HVA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPV G YDRS+SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y+ DDI+RY+ FAR F+P++++E+   +V +Y ++R+RD +  ++S+WRITVRQLES++RLSE+ ARM   D V+   V EA RLL+KSIIRVE PD+NL Q           Q  VN               SEDA    + + S  + F EY +I+ LI+ HLR ++ + +E  LK+SELV WYL  I   I  E  L+ KK +IE ++HRL   D++L+    A  +  S G E  ++DP + ++PN
Sbjct:   13 SQHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKD--FYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQFKYTQPNICRNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMETDEGQGGVNGHADSPAPVNRFNGSSEDASQETVSKPSLRLGFAEYCRISNLIVLHLRKMEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKTIIEKVVHRLTHYDHVLIELTQAGLKGSSEGSESYEEDPYLVVNPN 816          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 423/774 (54.65%), Postives = 554/774 (71.58%), Query Frame = 1
Query:  103 NRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ-----------QAAVNAV------------ESEDA----MGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRL 2337
            ++H  V D + EKCQ+LFL+ LE F+  D E KY++ A+++   E+  L VSF DL  ++  LS  I   FYR+YP+LC+A + F+  + +     D  +   F D PT   +R L    +G L +  GQV+R+H VHPELV GTF C DC TV+K++EQQF +T+P IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+AQ GD+ +FTG+LI++PD+S+L+TPG+R     ++  ++GY++ G+ GL+ LGVRDL+YR+ FLA HVA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPV G YDRS+SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y+ DDI+RY+ FAR F+P++++E+   +V +Y ++R+RD +  ++S+WRITVRQLES++RLSE+ ARM   D V+   V EA RLL+KSIIRVE PD+NL Q           Q  VN               SEDA    + + S  + F EY +I+ LI+ HLR ++ + +E  LK+SELV WYL  I   I  E  L+ KK +IE ++HRL
Sbjct:   13 SQHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKD--FYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQFKYTQPNICRNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMETDEGQGGVNGHADSPAPVNRFNGSSEDASQETVSKPSLRLGFAEYCRISNLIVLHLRKMEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKTIIEKVVHRL 780          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 326.635 bits (836), Expect = 6.297e-98
Identity = 200/587 (34.07%), Postives = 311/587 (52.98%), Query Frame = 1
Query:  364 QFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNI-EQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQ-------------------RPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            ++D   N+      H    P +  LR+LR  +L +L++  G V    GV P+L +  + C  C  V+    + Q    KP  C  P+C +   FE+  E++ Y ++Q++R+QE+  ++  G +PR  D IL  + V++ +PGD+ E TG                             YD  +       V    +    LANHVA  +NK    E                LT+++V  +  +++D  + + +   + P+ YG++++KRGL L LFGG PK      K+RGDIN+ + GDP TAKSQFLK I   S RA++T+G+ +SA GLTA V R   S E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S                     P  P         ++ +++YI +A+    P++ +     +   Y+ +R+   A+GS     ITVR +ES++R++EA ARM   D+V E DV  A R++ +S I  ++
Sbjct:  273 KYDRITNHIHVRISHL---PLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFVLGPFCQSQNQEVKPGSC--PECQSAGPFEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIY------------------------HNNYDGSLNTANGFPV----FATIILANHVAKKDNKVAVGE----------------LTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTLEPAMPNTYGVEPLPQEVLKKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGS---IPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVMMESFIDTQK 807          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Mouse
Match: Mcm7 (minichromosome maintenance complex component 7 [Source:MGI Symbol;Acc:MGI:1298398])

HSP 1 Score: 315.849 bits (808), Expect = 1.481e-95
Identity = 206/544 (37.87%), Postives = 292/544 (53.68%), Query Frame = 1
Query:  436 LRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCM-NRL--KFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT-----ESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            +R +R  ++GKL+  RG V R   V P +V+ T+ C  CG       Q   F    +C + +C  NR   +  L    SK+V FQ++++QE  +++P G IPR + V+L  E    AQPGD    TG  I +P                   L  G+     GL             +L  H      K    +D++  GEL+ + L K++ E+            +  + +   + P  YG+++VK+ LLL+L GGV + + +G K+RG+I+IC++GDP  AKSQ L  I   +PR+ YT+G+ SS  GLTAAV+RD  SGE  +E GAL+LA+ GVCCIDEFDKM   D+ AIHE MEQQTIS+ KAGI  TLNA+ S+LAAANP  GRY+  RSL QN+ L A ++SRFDL +++ D      D  +A+ IT       Q P   E  D ++     ++RYI      +P V E     +   Y +MR    A  S+ A   + R L +++RLS A AR+R  D VE+ DV EA RL+  S
Sbjct:  149 IREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTG--IFLP------------------VLRTGFQQMAQGL---------LSETYLEAHWIVKMTK--SDDDVSGAGELSSEEL-KQIAEE------------DFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQ-SPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKL-----MRRYIAMCHERQPTVPESLADYITAAYVEMRRE--ARASKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMS 640          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 301.597 bits (771), Expect = 4.159e-90
Identity = 214/662 (32.33%), Postives = 335/662 (50.60%), Query Frame = 1
Query:  145 QRLFLNLLENFKVGDE-----FKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENND---RTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFI---FTKPTIC-----GNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDI---QRYITF--ARCFEPRVTEEAFKLMVTEYAKMR------ERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 2049
            QR F   L  ++VG +     FKY +  K+  +L + ++ V  +DL ++D  L+  +          L +A +   ++        D   +          + +++R L+   +  LVK  G +I +  V  +    + +C+ C   + NI  +     +  P  C     G P+C     F ++P++ K VDFQ +++QE  + +P G +PR M +       +   PG++               +T  G  +++   +  S+G D    G++   +R L  ++                  D +  G     S    ++ QE  +   +   PN+ + +   + P+ +G  ++K+ +  +LFGG  K   +G   RGDIN+ ++GDP TAKSQ LK +   SP  VYTSGK SSAAGLTA+V+RD  S  F++E GA++LA+ GV CIDEFDKM   D+VAIHEAMEQQTIS+ KAGI  TLN++ SVLAAAN V GR+D ++    NI     I+SRFD+ F++ DE  E+ D  +AK +      V        +  E D+   +++I +  ARC  PR++ EA + +   Y  MR      ERD  S  RS+  ITVRQLE++VR++EA ++M+   F  E DV EA RL   S +
Sbjct:   32 QRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVADEVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYALPRKCNMDQAGRPKCPLDPYF-IMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNR---------------VTIMGIYSIKKFGLNPSKGRDRVGVGIRSSYIRVLGIQV------------------DTDGSGR----SFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKG-EDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLH--VSALTQTQAVEGEIDLAKMKKFIAYCRARC-GPRLSAEAAEKLKNRYIIMRSGARQHERD--SDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTL 649          
BLAST of DNA replication licensing factor MCM6 vs. UniProt/SwissProt
Match: sp|Q14566|MCM6_HUMAN (DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1)

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 428/810 (52.84%), Postives = 573/810 (70.74%), Query Frame = 1
Query:  103 NRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ---------------------AAVNAVE------SEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM----AVYRTESFGGEISKDDPIVFLHPN 2433
            ++H+ V D + EKCQ+LFL+ LE F+  D E KY++ A+++   E+  L VSF DL  ++  LS  I   FYR+YP+LC+A + F+  + +     D  +   F D PT   +R L    +G L +  GQV+R+H VHPELV GTF C DC TV++++EQQF +T+P IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+AQ GD+ +FTG+LI++PD+S+L+TPG+R     ++   +GY++ G+ GL+ LGVRDL+YR+ FLA  VA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM+VRDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ G YDRS+SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y+ DDI+RY+ FAR F+P++++E+   +V +Y  +R+RD +  ++S+WRITVRQLES++RLSEA ARM   D V+   V EA RLL+KSIIRVE PD+NL Q+                     A VN +       ++++  + S  + F EY +I+ LI+ HLR ++ + +E  LK+SELV WYL  I   I  E  L+ KK++IE +IHRL   D++L+    A  +  + G E  ++DP + ++PN
Sbjct:   13 SQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKD--FYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKHLRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPN 816          
BLAST of DNA replication licensing factor MCM6 vs. UniProt/SwissProt
Match: sp|P97311|MCM6_MOUSE (DNA replication licensing factor MCM6 OS=Mus musculus OX=10090 GN=Mcm6 PE=1 SV=1)

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 433/810 (53.46%), Postives = 573/810 (70.74%), Query Frame = 1
Query:  103 NRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ-----------QAAVNAV------------ESEDA----MGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM----AVYRTESFGGEISKDDPIVFLHPN 2433
            ++H  V D + EKCQ+LFL+ LE F+  D E KY++ A+++   E+  L VSF DL  ++  LS  I   FYR+YP+LC+A + F+  + +     D  +   F D PT   +R L    +G L +  GQV+R+H VHPELV GTF C DC TV+K++EQQF +T+P IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+AQ GD+ +FTG+LI++PD+S+L+TPG+R     ++  ++GY++ G+ GL+ LGVRDL+YR+ FLA HVA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPV G YDRS+SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y+ DDI+RY+ FAR F+P++++E+   +V +Y ++R+RD +  ++S+WRITVRQLES++RLSE+ ARM   D V+   V EA RLL+KSIIRVE PD+NL Q           Q  VN               SEDA    + + S  + F EY +I+ LI+ HLR ++ + +E  LK+SELV WYL  I   I  E  L+ KK +IE ++HRL   D++L+    A  +  S G E  ++DP + ++PN
Sbjct:   13 SQHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKD--FYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQFKYTQPNICRNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMETDEGQGGVNGHADSPAPVNRFNGSSEDASQETVSKPSLRLGFAEYCRISNLIVLHLRKMEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKTIIEKVVHRLTHYDHVLIELTQAGLKGSSEGSESYEEDPYLVVNPN 816          
BLAST of DNA replication licensing factor MCM6 vs. UniProt/SwissProt
Match: sp|Q2KIZ8|MCM6_BOVIN (DNA replication licensing factor MCM6 OS=Bos taurus OX=9913 GN=MCM6 PE=2 SV=1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 431/812 (53.08%), Postives = 572/812 (70.44%), Query Frame = 1
Query:  103 NRHIRVIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ------------------------AAVNAVESEDAMGQDSQT-----ITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM----AVYRTESFGGEISKDDPIVFLHPN 2433
            ++H+ V D + EKCQ+LFL+ LE F+  D E KY++ A+++   E+  L VSF DL  ++  LS  I   FYR+YP+LC+A + F+  + +     D  +   F D PT   +R L    +G L +  GQV+R+H VHPELV GTF C DC TV+K++EQQF +T+P IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+AQ GD+ +FTG+LI++PD+S+L+TPG+R     ++   +GY++ GV GL+ LGVRDL+YR+ FLA  VA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKAS AAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM+VRDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ G YDRS+SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E S  R+Y+ D+I+RY+ FAR F+P++++E+   +V +Y ++R+RD +  ++S+WRITVRQLES++RLSEA ARM   D V+   V EA RLL+KSIIRVE PD+NL Q+                        + +N   SED M QDS       + F EY +I+ LI+ HLR ++ + +E  LK+SELV WYL  I   I  E  L+ KK++IE +I+RL   D++L+    A  +  + G E  ++DP + ++PN
Sbjct:   13 SQHLEVRDEVAEKCQKLFLDFLEEFQNSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKD--FYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETDSRVSGVDGYETEGVRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASIAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EDSIDRVYSLDEIRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEDAQMEVDEGPDGINGHADSPAPASGING-HSED-MNQDSVPKASLRLGFSEYCRISNLIVLHLRKMEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIYRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPN 816          
BLAST of DNA replication licensing factor MCM6 vs. UniProt/SwissProt
Match: sp|Q498J7|MC6ZA_XENLA (Zygotic DNA replication licensing factor mcm6-A OS=Xenopus laevis OX=8355 GN=zmcm6-a PE=1 SV=1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 419/807 (51.92%), Postives = 568/807 (70.38%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ------------------------QAAVNAV-----ESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTE--SFGGEI--SKDDPIVFLHPN 2433
            V D + EKCQ+LF + LE F+  D E KY  +A+++   E+  L VSF DL  ++  L+  I   FYR+YP+LC+A + F     +  +N +  +   F D PT   +R L    +G L++   QV+R+H VHPELV GTF C DC T+V+++EQQF +T+P+IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+ Q GD+ +FTGSLI++PDISQL+TPG R   + ++   EGY++ GV GL+ LGVRDL+Y++ FLA +V   N ++   E ++EE ++T +S+  +++ +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+C+VGDPSTAKSQFLK +  FSPRAVYTSGKAS+AAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+ +DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDR++SL+QN++LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y  D+++RY+ FAR F+P++++E+   +V +Y ++R+RD +  ++SAWRITVRQLES++RLSE  ARM  SD V+   V EA RLL+KSIIRVE PD+NL Q                           VN +     ES  A  + S  + F EY +I+ L++  LR ++ D +E   ++SEL+ WYL  I   I  E  L+ +KQ+I+ +IHRL+  D IL+ + +TE    G E+   ++DP + ++PN
Sbjct:   19 VKDEVAEKCQKLFQDFLEEFQGSDGELKYQSDAEELIRPERNTLLVSFVDLEQFNQQLATTIQEEFYRVYPYLCRAVRAFARDHGNIPQNKE--FYVAFQDLPTRHKIRELTTPRIGSLLRISAQVVRTHPVHPELVSGTFLCLDCQTLVRDVEQQFKYTQPSICRNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVESCQAGDRCDFTGSLIVVPDISQLSTPGVRAETSSRVGGREGYEAEGVQGLRALGVRDLSYKLVFLACYVCPTNPRFGGKE-LHEE-DMTAESIKNQMSVKEWEKVFEMSQDKNLYHNLCTSLFPTVHGNDEVKRGILLMLFGGVPKSTMEGTSLRGDINVCVVGDPSTAKSQFLKHVEEFSPRAVYTSGKASTAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDTKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRAKSLKQNVNLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYTVDEVRRYLLFARQFKPKISKESADFIVEQYKRLRQRDGSGVTKSAWRITVRQLESMIRLSEGMARMHCSDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQDDEHEPEDETQEGTNGDAEVPNGVNGHVNGINGHSQESNAAAAKPSLRLNFAEYKRISNLLVQQLRKME-DEDETSQRRSELMNWYLKEIESEIDSEEELINRKQIIDKVIHRLVHYDQILIELTQTELKGTGDEVVAKEEDPYLVVNPN 818          
BLAST of DNA replication licensing factor MCM6 vs. UniProt/SwissProt
Match: sp|Q6P1V8|MCM6Z_XENTR (Zygotic DNA replication licensing factor mcm6 OS=Xenopus tropicalis OX=8364 GN=zmcm6 PE=2 SV=1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 423/807 (52.42%), Postives = 568/807 (70.38%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ--------------------AAVN---------AVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGG---EISK-DDPIVFLHPN 2433
            V D + EKCQ+LF + LE F+  D E KY  +A+++   E+  L VSF DL  ++  L+  I   FYR+YP+LC+A + F     +  +N +  +   F D PT   +R L    +G L++  GQV+R+H VHPELV GTF C DC T+V+++EQQF +T+P+IC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++VILR E VE+ Q GD+ +FTGSLI++PDISQL TPG R   + ++  +EGY + GV GL+ LGVRDL+Y++ FLA +V   N ++   +D++EE ++T +S+  +++ +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+ +DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDR++SL+QNI+LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +    +  E+S  R+Y  D+++RY+ FAR F+P++++E+   +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  ARM  SD V+   V EA RLL+KSIIRVE PD+NL Q+                    + VN         A E   A  + S  + F EY +I+ L++  LR ++ D +E   +KSEL+ WYL  I   I  E  L+ +KQ+I+ ++HRL+  D IL+ + +T   G    E+ K +DP + ++PN
Sbjct:   19 VKDEVSEKCQKLFQDFLEEFRGSDGELKYQSDAEELIRPERNTLLVSFIDLEQFNQQLATTIQEEFYRVYPYLCRAVKAFARDHGNVPQNKE--FYVAFQDLPTRHKIRELTTPRIGSLLRISGQVVRTHPVHPELVSGTFLCLDCQTLVRDVEQQFKYTQPSICRNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVESCQAGDRCDFTGSLIVVPDISQLATPGVRAETSARVGGTEGYQAEGVQGLRALGVRDLSYKLVFLACYVCPTNPRF-GGKDLHEE-DMTAESIKNQMSVKEWEKVFEMSQDKNLYHNLCTSLFPTVHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDTKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRAKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRI--EESIDRVYTLDEVRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGTGVTKSAWRITVRQLESMIRLSEGMARMHCSDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEDEHEAEEEPQEVINGDASVPSGVNGHVNGMNGHAEEPNAATPKPSLRLNFAEYKRISNLLVLQLRKME-DEDETSQRKSELINWYLKEIESEIDSEEELVTRKQIIDKVVHRLVHYDQILIELTQTGLKGTGDEEVPKEEDPYLVVNPN 818          
BLAST of DNA replication licensing factor MCM6 vs. TrEMBL
Match: A0A5K3FJ61 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 460/823 (55.89%), Postives = 597/823 (72.54%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLS--------QQAA--VNAVESEDAMG---------QDSQTITFDEYHQITGLIISHLRAI-------------DIDNEEIQLKKSELVEWYLGSI-IENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKD--DPIVFLHPNVAAD 2445
            MD  + Q R I V D LGE CQR F   LE+ K  +  KY+E+AK++  LEK  L VSF DL+ YDS  +  I   ++R+YP+LC A + FIN Q  +T N+ R +  +F +  TL  LR L    LGKLVK R QV+RSH VHPEL LGTFKC DCGTV++N+EQQF +T+P++C NPQC NR+KFEL+  QSK+VDFQKVRVQETQ E+ RG IPR M+V+LR + VE AQPGD+ EF G+LI++PD+ QL +PG+R+LE K  +  +G ++G++GLK+LGVR+LTY++AF A  V   N +YL ++D+     ++Y+++ K+L + E++ +  M+QD NL  N+C  LFPT +G++EVK+GLLLMLFGGVPKVTEEGT LRGDIN+C+VGDPSTAKSQFLK++  FSPRA+YTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+GGRYDRSRSLRQNI +SAP+MSRFDLFF+L+DEC + VD+ IAK I +     D + S ++IY+ DDI+RYI F RCF+P+++ EA + MV EY K+R+RDA+S S+SAWRITVRQLESLVRLSEA AR+  +D V    V EA  LL+KSIIRVEQPDINL         Q AA   +A+E E   G         Q    IT+ +Y +I  L+I   R +             +  +E+  ++KS+L+ WYL  I  E +  E  L+  K MIE II RL++KDN+L+++ R+   G + S D  DP + +HPN + D
Sbjct:    1 MDVAQAQIRTISVPDVLGEDCQRRFQIFLESHKENNVSKYIEDAKELKQLEKSTLSVSFDDLLMYDSRFASLIEDEYFRVYPYLCNAVKNFINDQVPDTLNSGRDFYVNFTNISTLHRLRELNAQQLGKLVKIRAQVVRSHPVHPELTLGTFKCSDCGTVIRNVEQQFKYTQPSVCFNPQCANRIKFELLTNQSKFVDFQKVRVQETQAEVSRGSIPRSMEVLLRADAVELAQPGDRCEFIGTLIVVPDVGQLASPGTRSLERKGTRTIDGQETGISGLKDLGVRELTYKIAFFACTVVPANGRYLPSDDLESADGISYEAMSKRLNQAELDTICNMSQDKNLFSNLCASLFPTIHGSEEVKKGLLLMLFGGVPKVTEEGTHLRGDINVCLVGDPSTAKSQFLKQVEQFSPRAIYTSGKASSAAGLTAAVVRDEESFEFVIEAGALMLADNGVCCIDEFDKMDIRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIGGRYDRSRSLRQNIGMSAPVMSRFDLFFILVDECNDVVDYAIAKSIIDLHMGHDTQVSASKIYSSDDIRRYIAFGRCFKPKISIEAMQFMVEEYKKLRQRDASSASKSAWRITVRQLESLVRLSEAVARLHCADTVTVPFVREAFALLNKSIIRVEQPDINLEETEEHAEVQPAAEGTSAMEVEQVEGISAEQNAPNQQHLRITYQQYRRIADLLILETRRVEESGFVTFSTEGTEQSSEQTAIRKSQLINWYLEEIAAETLHSEADLIACKLMIERIIDRLVKKDNVLISLSRS---GLDASTDELDPYLVVHPNYSMD 820          
BLAST of DNA replication licensing factor MCM6 vs. TrEMBL
Match: A0A564YU75 (DNA helicase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9576 PE=3 SV=1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 459/834 (55.04%), Postives = 602/834 (72.18%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFK--VGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ--------------QAAVNAVESEDAMGQDSQT----ITFDEYHQITGLIISHLRAID----------IDNEEIQ---------------LKKSELVEWYLGSI-IENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD 2445
            MD  + Q R I V D +GE+CQR FL+ LE+FK    D FKY E AK+M  LE+  L VSF DL+ +DS L+  I   ++RLYP++C A + FIN    +T+N+ R +   F D   L  +R L    LG+LVK R QV+RSH VHPEL LGTFKC++CGT++ N+EQQF +T+P++C NPQC NR+KFELI   SK+VDFQKVRVQETQ E+ RG IPR M+++LR++TVE AQPGD+ EF G+LI++PD+ QL TPG+RTLE K  +  +G +SGV+GLK+LGVR+LTY+ AF A  V   N +YL ++D+     ++Y++L K+LTE E++ ++ M+QD NL  N+C  LFPT +G++EVK+G+LLMLFGGVPKVTEEGT+LRGDIN+C+VGDPSTAKSQFLK++  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+GGRYDRSRSLRQNI LSAP+MSRFDLFFVL+DEC + VD+ IAK I +    V+ + + T+IY  D+++RYI FARCF+P+++ EA + MV EY K+R+RDA+SGS+SAWRITVRQLESLVRLSEA AR+  +D V    V EA  LL+KSIIRVEQPDINL +              Q  +   +    +G  +Q     +T+++Y +I  L+I   R ++          +  EE +               ++KSELV WYL  I  + +  E  L++ K ++E II RL+ KD IL+A+ R+     +   +DP++ +HPN + D
Sbjct:    1 MDVAQAQIRTIHVPDLVGEECQRKFLSFLESFKDEGEDVFKYAEKAKEMKKLERSTLSVSFNDLLMHDSHLASLIEDEYFRLYPYICNAVKNFINDHVPDTQNSGRDFYIGFTDVSVLHRIRELNAHQLGRLVKIRAQVVRSHPVHPELTLGTFKCEECGTIIHNVEQQFKYTQPSVCFNPQCSNRVKFELITNGSKFVDFQKVRVQETQAEVLRGSIPRSMEILLRSDTVELAQPGDRCEFIGTLIVVPDVGQLATPGTRTLERKGTRTIDGQESGVSGLKDLGVRELTYKTAFFACSVFPANGRYLPSDDLECADGVSYEALSKRLTEAELDTIVQMSQDKNLFANLCASLFPTIHGSEEVKKGILLMLFGGVPKVTEEGTRLRGDINVCLVGDPSTAKSQFLKQVEQFSPRAVYTSGKASSAAGLTAAVVRDEESFEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIGGRYDRSRSLRQNIGLSAPVMSRFDLFFVLVDECNDVVDYAIAKSILDLHMGVETQITTTKIYTADEVRRYIAFARCFKPKISIEAMQCMVEEYKKLRQRDASSGSKSAWRITVRQLESLVRLSEAIARLHCADIVTVPFVKEAFALLNKSIIRVEQPDINLEEEAAEKAEVSAEPEGQEQMEVGQPTGTLGDQAQQPHLRVTYEQYRRIADLLILQTRRVEEAKSGEPRSVVVTEEPEDAVSQEATVVEKSGAIRKSELVNWYLEEIAADTLQSEAELIECKVLVERIIDRLVNKDRILIALTRS-GLDADEEDEDPLLVVHPNYSMD 833          
BLAST of DNA replication licensing factor MCM6 vs. TrEMBL
Match: A0A158QCS4 (DNA helicase OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1876 PE=3 SV=1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 459/834 (55.04%), Postives = 602/834 (72.18%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFK--VGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQ--------------QAAVNAVESEDAMGQDSQT----ITFDEYHQITGLIISHLRAI------------------DIDNEEI-------QLKKSELVEWYLGSI-IENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD 2445
            MD  + Q R I V D +GE+CQR FL+ LE+FK    D FKY E AK+M  LE+  L VSF DL+ +DS L+  I   ++RLYP++C A + FIN    +T+N+ R +   F D   L  +R L    LG+LVK R QV+RSH VHPEL LGTFKC++CGT++ N+EQQF +T+P++C NPQC NR+KFELI   SK+VDFQKVRVQETQ E+ RG IPR M+++LR++TVE AQPGD+ EF G+LI++PD+ QL TPG+RTLE K  +  +G +SGV+GLK+LGVR+LTY+ AF A  V   N +YL ++D+     ++Y++L K+LTE E++ ++ M+QD NL  N+C  LFPT +G++EVK+G+LLMLFGGVPKVTEEGT+LRGDIN+C+VGDPSTAKSQFLK++  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+GGRYDRSRSLRQNI LSAP+MSRFDLFFVL+DEC + VD+ IAK I +    V+ + + T+IY  D+++RYI FARCF+P+++ EA + MV EY K+R+RDA+SGS+SAWRITVRQLESLVRLSEA AR+  +D V    V EA  LL+KSIIRVEQPDINL +              Q  +   +    +G  +Q     +T+++Y +I  L+I   R +                  D+ ++E         ++KSELV WYL  I  + +  E  L++ K ++E II RL+ KD IL+A+ R+     +   +DP++ +HPN + D
Sbjct:    1 MDVAQAQIRTIHVPDLVGEECQRKFLSFLESFKDEGEDVFKYAEKAKEMKKLERSTLSVSFNDLLMHDSHLASLIEDEYFRLYPYICNAVKNFINDHVPDTQNSGRDFYIGFTDVSVLHRIRELNAHQLGRLVKIRAQVVRSHPVHPELTLGTFKCEECGTIIHNVEQQFKYTQPSVCFNPQCSNRVKFELITNGSKFVDFQKVRVQETQAEVLRGSIPRSMEILLRSDTVELAQPGDRCEFIGTLIVVPDVGQLATPGTRTLERKGTRTIDGQESGVSGLKDLGVRELTYKTAFFACSVFPANGRYLPSDDLECADGVSYEALSKRLTEAELDTIVQMSQDKNLFANLCASLFPTIHGSEEVKKGILLMLFGGVPKVTEEGTRLRGDINVCLVGDPSTAKSQFLKQVEQFSPRAVYTSGKASSAAGLTAAVVRDEESFEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIGGRYDRSRSLRQNIGLSAPVMSRFDLFFVLVDECNDVVDYAIAKSILDLHMGVETQITTTKIYTADEVRRYIAFARCFKPKISIEAMQCMVEEYKKLRQRDASSGSKSAWRITVRQLESLVRLSEAIARLHCADIVTVPFVKEAFALLNKSIIRVEQPDINLEEEAAEKAEVSAEPEGQEQMEVGQPTGTLGDQAQQPHLRVTYEQYRRIADLLILQTRRVEEAKSGEPRSVVVTEEPEDVVSQEATVVEKSGAIRKSELVNWYLEEIAADTLQSEAELIECKVLVERIIDRLVNKDRILIALTRS-GLDADEEDEDPLLVVHPNYSMD 833          
BLAST of DNA replication licensing factor MCM6 vs. TrEMBL
Match: A0A0X3PHC8 (DNA helicase OS=Schistocephalus solidus OX=70667 GN=MC6ZB PE=3 SV=1)

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 456/815 (55.95%), Postives = 587/815 (72.02%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINL----------------SQQAAVNAVESEDAMGQDSQT-ITFDEYHQITGLIISHLRAI---------DIDNEEIQLKKSELVEWYLGSI-IENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD 2445
            MD  + Q R I+V D +G+ CQ+ F   LE++K  D  KYVE AK++  LE+  L V+F+DL+ +DS L+  I   +YRLYPFLC A + FIN    +T N+ R +   F D  TL  +R L    LGKLVK R QV+RSH VHPEL  GTFKC DCG +++N+EQQF +T+P++C NPQC NR KFEL+  QSK+VDFQKVR QETQ EL RG IPR ++V+LR + VE AQPGD+ EF G+LI++PD+ QL TPG+R LE K  +  +G +SG++GLK LGVR+LTYRMAF A  V   N +YL ++D+     ++Y+++ ++L+  E++K+  M+QD +L  N+C  LFPT +G++EVK+G+LLMLFGGVPKVTEEGT LRGDIN+C+VGDPSTAKSQFLK++  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKME+RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDRSRSLRQNI +SAP+MSRFDLFFVL+DEC + VD+ IA+ I +      P  S    Y  D+I+RYI FARCF+P+++ +A + MV EY K+R+RDA+SGS+SAWRITVRQLESLVRLSEATAR+  +D V    V EA  LL+KSIIRVEQPDINL                 Q   V A  +E A  Q  +  IT+ EY +I  L+I H R +         D   E   ++KSEL+ WYL  + ++ +  E  L+Q K M+E I+ RLI+KD++L+++ R+          DP++ +HPN + D
Sbjct:    1 MDVAQVQVRTIQVADVVGDDCQKRFQIFLESYKENDIRKYVEAAKELKQLERSTLSVNFEDLLMHDSRLASLIEDEYYRLYPFLCNAVKNFINDHVPDTLNSGRDFYVSFTDISTLNKIRELNAHQLGKLVKIRAQVVRSHPVHPELTSGTFKCTDCGIIIRNVEQQFKYTQPSVCFNPQCGNRSKFELLTSQSKFVDFQKVRTQETQAELSRGSIPRSLEVLLRADAVELAQPGDRCEFIGTLIVVPDVGQLATPGTRYLERKGTRTVDGQESGISGLKALGVRELTYRMAFFACTVIPANGRYLPSDDLESADGISYEAMSRRLSPAELDKICQMSQDKHLFNNLCGSLFPTIHGSEEVKKGILLMLFGGVPKVTEEGTHLRGDINVCLVGDPSTAKSQFLKQVEQFSPRAVYTSGKASSAAGLTAAVVRDEESFEFVIEAGALMLADNGVCCIDEFDKMEIRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSRSLRQNIGMSAPVMSRFDLFFVLVDECNDIVDYAIARSIVDLHMGCVP-PSAFASYTADEIRRYIAFARCFKPKISVDAMQCMVEEYKKLRQRDASSGSKSAWRITVRQLESLVRLSEATARLHCADTVTVAYVREAFALLNKSIIRVEQPDINLEEHEEAPVVTETPMETDQTDVVEATPTEPAADQVQRLRITYQEYRRIADLLILHTRHVEEAGTAVQSDSTTEPTAIRKSELINWYLEEVAVDTLQSEADLIQCKLMVERILDRLIKKDHVLISLSRSGLDATSEEDADPLLVVHPNYSTD 814          
BLAST of DNA replication licensing factor MCM6 vs. TrEMBL
Match: A0A0R3T666 (DNA helicase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2553 PE=3 SV=1)

HSP 1 Score: 919.842 bits (2376), Expect = 0.000e+0
Identity = 462/837 (55.20%), Postives = 603/837 (72.04%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKV-GDEF-KYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQA-----AVNAVESEDAMGQDSQT------------ITFDEYHQITGLIISHLRAI------------------DIDNEEIQL-----------KKSELVEWYLGSI-IENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD 2445
            MD  + Q R I V D +G++CQR FL+ LENFK  GDEF KY E AK+M  LE+  L VSF DL+ +DS L+  I   ++RLYP+LC A + FIN    +T+N+ R +   F D   L  +R L    LG+LVK R QV+RSH VHPEL LGTFKC++CGT+++N+EQQF +T+P++C NPQC NR+KFELI  +SK+VDFQKVRVQETQ E+ RG IPR ++V+LR++ VE AQPGD+ EF G+LI++PD+ QL TPG+RTLE K  +  +G +SG++GLK+LGVR+LTY+ AF A  V   N +YL ++D+     ++Y++L K+LTE E++ ++ M+QD NL  N+C  LFPT +G++EVK+G+LLMLFGGV KVT+EGT LRGDIN+C+VGDPSTAKSQFLK++  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM++RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+GGRYDRSRSLRQNI LSAP+MSRFDLFFVL+DEC + VD+ IAK I +    ++P+ + T+IY  D+I+RYI FARCF+P+++ EA + MV EY K+R+RDA+SGS+SAWRITVRQLESLVRLSEA AR+  +D V    V EA  LL+KSIIRVEQPDINL ++A          E ++ M  D  T            +T+++Y +I  L+I   R +                  D   +E  L           +KSELV WYL  I  + +  E  L++ K ++E II RL+ KD IL+A+ R+     +   +DP++ +HPN + D
Sbjct:    1 MDVAQAQIRTIHVPDIVGDECQRKFLSFLENFKEEGDEFFKYAEKAKEMKKLERSTLSVSFNDLLMHDSRLASLIEDEYFRLYPYLCNAVKNFINDHVPDTQNSGRDFYIGFTDVSVLHRMRELNAHQLGRLVKIRAQVVRSHPVHPELTLGTFKCEECGTIIRNVEQQFKYTQPSVCFNPQCSNRVKFELITNESKFVDFQKVRVQETQAEVLRGSIPRSLEVLLRSDAVELAQPGDRCEFIGTLIVVPDVGQLATPGTRTLERKGARTIDGQESGISGLKDLGVRELTYKTAFFACSVTPANGRYLPSDDLECADGVSYEALSKRLTEAELDTIVQMSQDKNLFANLCASLFPTIHGSEEVKKGILLMLFGGVSKVTQEGTHLRGDINVCLVGDPSTAKSQFLKQVEQFSPRAVYTSGKASSAAGLTAAVVRDEESFEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIGGRYDRSRSLRQNIGLSAPVMSRFDLFFVLVDECNDIVDYAIAKSILDLHMGIEPQVT-TKIYTVDEIRRYIAFARCFKPKISIEAMECMVEEYKKLRQRDASSGSKSAWRITVRQLESLVRLSEAIARLHCADVVTVPFVKEAFALLNKSIIRVEQPDINLEEEAEDKVEVPAEPEGQEQMQVDQPTGGVADQTQPHLRVTYEQYRRIADLLILQTRRVEEAKSLEPRPATVTEESEDSAGQESSLAATGVEQSGAIRKSELVNWYLEEIAADTLQSEAELIECKVLVERIIDRLVTKDRILIALTRS-GLDADEEDEDPLLVVHPNYSTD 835          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Cavefish
Match: mcm6l (maternal DNA replication licensing factor mcm6-like [Source:NCBI gene;Acc:111194477])

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 416/830 (50.12%), Postives = 571/830 (68.80%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENF--KVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITE-SQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQ---------------AAVNAVESEDAMGQDSQT---------------------ITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRT------ESFGGEISKDDPIVFLHPN 2433
            M+  E  N  ++V D L EKCQ+LFL  LE F  KVGD   Y+  A+++   E+  L VSF ++  Y+  L+  I   +YR+YPFLC+A + F     +   + +  +   F DFP+   +R L    +G L++  GQV+R+H VHPELV GTF C DC +V+K++EQQF +T+PTIC NP C NR +F L   +S++VDFQKVR+QETQ ELPRG IPR ++V+LR E VE AQ GD+ +FTG+LI++PD+S +   G+R   + ++   EG+++ G+ GLK LGVR+L+YR+AFLAN+VA  N ++   E   E+   T +S+  ++T QE  KV  M+QD NL  N+C  LFPT +GNDE+KRG+LLMLFGGV K T EGT LRGDIN+CI+GDPST+KSQFLK +  F PRAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANP+ GRY+RS+SL+QN+++SAPIMSRFDLFF+L+DEC E  D+ IA+RI +   R +D   S  R+Y  +DIQRYI FAR F+P++T EA + +V +Y ++R+RD    ++SAWRITVRQLES++RLSE  AR+  SD V+   V EA RLL+KSIIRV+ PDIN  Q+                 VN V+ ++ +  D++                      ++F EY +++ L++ H++ ++  +EE  LKKSELV WYL  I   I  E  L+ +K +IE ++HRL+  D+I++ + +T      E     + ++DP + ++PN
Sbjct:    1 MEPAETTNAGVQVRDDLAEKCQKLFLEFLEEFQDKVGDPL-YLPEAQELIRPERNTLTVSFTNIEHYNQQLATTIQEEYYRVYPFLCRAVRHFARDHGNIPPSKE--FYVAFSDFPSRQKIRELSTARIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVVLRAEAVETAQAGDRCDFTGTLIVVPDVSAMALSGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQ--TAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIIGDPSTSKSQFLKHVEDFVPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRSKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNID---SVERVYASEDIQRYILFARQFQPKITPEAQEFVVEQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSIIRVDSPDINFDQEQDDNEDINGQNEALGGEVNGVKGQNGVAADAEEAMDTGEAERQEKSNKAQPAVRMSFSEYRRLSNLLVLHMQKMEQLDEESSLKKSELVNWYLKEIEGEIESEAELIARKNLIEKVLHRLVHYDHIIIELTKTGLKKVSEEGEEPVMEEDPFLVVNPN 822          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Cavefish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:103037949])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 425/818 (51.96%), Postives = 559/818 (68.34%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAA--------------------------------------VNAVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRT------ESFGGEISKDDPIVFLHPN 2433
            V D L EKCQ+LF   LE F   D E KY+ +A+++   E+  L VSF D+  ++  L+  I   FYR+YP+LC+A + F   + +   + +  +     D PT   +R L    +G LV+  GQV+R+H VHPELV GTF C DC + +K++EQQF +T+P+IC NP C NR +F L   +SK++DFQKVR+QETQ ELPRG IPR M++ILR E VE+AQ GD+ +F G LI++PD+SQL T G R   + +   ++GY++ GV GLK LGVR+LTY++AFLA+HVA  N ++   E  +EE   T +S+  ++T +E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGDIN+CIVGDPSTAKSQFLK +  FSPRAVYTSGKASSAAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKME RDQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDRS+SL+QN++L+APIMSRFDLFF+L+D+  E  D+ IA+RI +    +  E S  R+Y  D+I+RY+ FAR F+P++++E+   +V +Y ++R+RD +  ++SAWRITVRQLES++RLSE+ ARM   D V+   V EA RLL+KSIIRVE PDINL Q+                                         + V  E   G+ S  ++F EY +I+ L++ HLR  + + EE  LKKS +V WYL  I   I  E  L+ KK MIE ++HRL+  D IL+ + +T      ES G E  ++D  + ++PN
Sbjct:   15 VKDELAEKCQKLFQAFLEEFHNSDGELKYLRDAEELIRPERNTLLVSFTDVEGFNQELATTIQEEFYRIYPYLCRAVRNFARDRGNVPASKE--FYVAIQDLPTRHKIRELTTLRIGSLVRISGQVVRTHPVHPELVSGTFLCLDCQSAIKDVEQQFKYTQPSICRNPVCNNRRRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEIILRAEAVESAQAGDKCDFIGCLIVVPDVSQLATSGVRAETSSRTAGTQGYENEGVRGLKALGVRELTYKLAFLASHVAPTNPRFGGKEIRDEEQ--TAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDSNEVTDYAIARRIVDLHSRI--ENSIDRMYTLDEIRRYLLFARQFKPKISKESEDFIVEQYKRLRQRDGSGVTKSAWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDINLDQEEQEAMEEDEDNQLNGHDVPNGQADGQVNGHVNGHVNGHDHTHGVNGESHSGKSSMRLSFAEYKRISNLVVLHLRRAEEEEEEEALKKSAVVNWYLKEIESEIDSELELISKKAMIEKVLHRLVHYDYILIELSQTGLKGSAESSGTESQEEDVTLVVNPN 826          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 322.398 bits (825), Expect = 1.472e-96
Identity = 195/567 (34.39%), Postives = 313/567 (55.20%), Query Frame = 1
Query:  415 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQ-QFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITES---QRP-------------VDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            + P +  LR+LR  +L +L++  G V    GV P+L +  + C  C  ++    Q Q    KP  C  P+C +   FE+  EQ+ Y ++Q++ +QE+  ++  G +PR  D IL  + V++ +PGD+ E TG       I      GS       + ++ G+                +    LANH+A  +++    E                LT+++V  ++ +++D  + + +   + P+ YG++++KRGL L LFGG  K      K+RGDIN+ + GDP TAKSQFLK +   + RAV+T+G+ +SA GLTA V R   + E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S     P             V P  SD     ++ +++YI +A+    P++ +     +   Y+ +R+   A+GS     ITVR +ES++R++EA ARM   D+V+E DV  A R++ +S I  ++
Sbjct:  266 NLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSC--PECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTG-------IYHNNYDGS-------LNMANGFP--------------VFATVILANHIARKDDRVAVAE----------------LTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGS---IPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFIDTQK 783          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 322.013 bits (824), Expect = 2.313e-96
Identity = 195/567 (34.39%), Postives = 313/567 (55.20%), Query Frame = 1
Query:  415 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQ-QFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITES---QRP-------------VDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            + P +  LR+LR  +L +L++  G V    GV P+L +  + C  C  ++    Q Q    KP  C  P+C +   FE+  EQ+ Y ++Q++ +QE+  ++  G +PR  D IL  + V++ +PGD+ E TG       I      GS       + ++ G+                +    LANH+A  +++    E                LT+++V  ++ +++D  + + +   + P+ YG++++KRGL L LFGG  K      K+RGDIN+ + GDP TAKSQFLK +   + RAV+T+G+ +SA GLTA V R   + E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S     P             V P  SD     ++ +++YI +A+    P++ +     +   Y+ +R+   A+GS     ITVR +ES++R++EA ARM   D+V+E DV  A R++ +S I  ++
Sbjct:  275 NLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSC--PECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTG-------IYHNNYDGS-------LNMANGFP--------------VFATVILANHIARKDDRVAVAE----------------LTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGS---IPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFIDTQK 792          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 320.857 bits (821), Expect = 5.107e-96
Identity = 195/567 (34.39%), Postives = 313/567 (55.20%), Query Frame = 1
Query:  415 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQ-QFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITES---QRP-------------VDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            + P +  LR+LR  +L +L++  G V    GV P+L +  + C  C  ++    Q Q    KP  C  P+C +   FE+  EQ+ Y ++Q++ +QE+  ++  G +PR  D IL  + V++ +PGD+ E TG       I      GS       + ++ G+                +    LANH+A  +++    E                LT+++V  ++ +++D  + + +   + P+ YG++++KRGL L LFGG  K      K+RGDIN+ + GDP TAKSQFLK +   + RAV+T+G+ +SA GLTA V R   + E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S     P             V P  SD     ++ +++YI +A+    P++ +     +   Y+ +R+   A+GS     ITVR +ES++R++EA ARM   D+V+E DV  A R++ +S I  ++
Sbjct:  266 NLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSC--PECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTG-------IYHNNYDGS-------LNMANGFP--------------VFATVILANHIARKDDRVAVAE----------------LTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGS---IPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFIDTQK 783          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 265.774 bits (678), Expect = 1.328e-79
Identity = 173/489 (35.38%), Postives = 258/489 (52.76%), Query Frame = 1
Query:  610 GNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTIS-LTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNE---DDIQRYITFARC-FEPRVTEEAFKLMVTEYAKM----RERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 2049
            G P C     F ++P++ K VD+Q +++QE  + +P G +PR M +       +   PG++    G   I    +++   G                           RD T          A + N YL+   +  + +    S+   L  QE  ++  +   P++ + +   + P+ YG  ++K+ +  +L GG  K   +G   RGDIN+ ++GDP TAKSQ LK +   SP  VYTSGK SSAAGLTA+V+RD  +  F++E GA++LA+ GV CIDEFDKM   D+VAIHEAMEQQTIS L   GI  TLN++ SVLAAAN V GR+D S+   +NI     I+SRFD+ F++ DE  E+ D  +AK +      ++ +     +  E     ++++I + R    PR++ EA + +   Y  M    RE D     R++  ITVRQLE++VR+SE+ A+MR   F  E  V EA RL   S +
Sbjct:   11 GRPSCPIDPYF-IMPDKCKCVDYQTLKLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSIKKAFTKMQGKG---------------------------RDRTG---------AGIRNPYLRVVGITVDTDGAGRSMGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGGSRKRLPDGLTRRGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKG-EENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVH--LNAKTQMQAVEGEIELSTLKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVSTL 459          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.003 bits (676), Expect = 1.729e-77
Identity = 207/676 (30.62%), Postives = 322/676 (47.63%), Query Frame = 1
Query:  136 EKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQAT------------------------QIFINKQFDETENND----------RTYTCHFIDFPTLTNL--RNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRL---KFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            + C++      ++  +G  +FKY E    +   E++ L +   DL   +  L++ ++ N  R       A                         ++ +  +  + + +D          R +  +F    TL  L  R+++  ++G+LV  RG V R+  V P +V+ T+ C  CG           F    +C +  C       +  L    SK+V FQ++++QE  +++P GCIPR M V +R E    AQPGD    TG  I +P + Q    G R ++  Q  LSE                      FL  H     NK   TED   + E   +S ++++TE++  + L  +            + P  YG+++VK+ LLL+L GGV + +  G K+RG+INIC++GDP  AKSQ L  I   +PR+ YT+G+ SS  GLTAAV++D  +GE  +E GAL+LA++GVCCIDEFDKM   D+ +IHE MEQQTIS+ K       + +T VL       G      S    I L A ++SRFDL +++ D+     D  +A+ IT   +      S     +   ++RYI   +  +P V +     +   Y +MR+   A  S+     + R L +++RLS A AR+R  D VE+ DV EA RL+  S
Sbjct:   11 DNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSELLPEYRQGEPVQKDALDVYIEHRLMLQNRHGDADAHDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITG--IFLPVLKQ----GFRAMQ--QGLLSE---------------------TFLEAHRVVKMNK---TEDNELDVEELSESELRQITEEDFYEKLAAS------------IAPEIYGHEDVKKALLLLLVGGVDR-SPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVLQLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQHTPLDMKLMRRYIALCQRRQPAVPDTLADYITAAYVEMRKE--ARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEA-RLMEMS 638          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.758 bits (652), Expect = 3.217e-74
Identity = 207/679 (30.49%), Postives = 324/679 (47.72%), Query Frame = 1
Query:  136 EKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQAT------------------------QIFINKQFDETENND----------RTYTCHFIDFPTLTNL--RNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRL---KFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKA--GIKATLNAKTSVLAAANPVGGRYDR-SRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            + C++      ++  +G  +FKY E    +   E++ L +   DL   +  L++ ++ N  R       A                         ++ +  +  + + +D          R +  +F    TL  L  R+++  ++G+LV  RG V R+  V P +V+ T+ C  CG           F    +C +  C       +  L    SK+V FQ++++QE  +++P GCIPR M V +R E    AQPGD    TG  I +P + Q    G R ++  Q  LSE                      FL  H     NK   TED   + E   +S ++++TE++  + L  +            + P  YG+++VK+ LLL+L GGV + +  G K+RG+INIC++GDP  AKSQ L  I   +PR+ YT+G+ SS  GLTAAV++D  +GE  +E GAL+LA++GVCCIDEFDKM   D+ +IHE MEQQTIS+ K   G+ A+  A  S         GR  R    +   + L A ++SRFDL +++ D+     D  +A+ IT   +      S     +   ++RYI   +  +P V +     +   Y +MR+   A  S+     + R L +++RLS A AR+R  D VE+ DV E  RL+  S
Sbjct:   11 DNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSELLPEYRQGEPVQKDALDVYIEHRLMLQNRHGDADAHDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITG--IFLPVLKQ----GFRAMQ--QGLLSE---------------------TFLEAHRVVKMNK---TEDNELDVEELSESELRQITEEDFYEKLAAS------------IAPEIYGHEDVKKALLLLLVGGVDR-SPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRALCSDGGGRTVAAGRASRIDDCVWLALMLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQHTPLDMKLMRRYIALCQRRQPAVPDTLADYITAAYVEMRKE--ARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEM-RLMEMS 641          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Sea Lamprey
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 251.521 bits (641), Expect = 1.544e-73
Identity = 144/363 (39.67%), Postives = 216/363 (59.50%), Query Frame = 1
Query: 1540 KATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQP--------DINLSQQAA----------------------------------------VNAVESED----------AMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRT---ESFGGE----ISKDDPIVFLHPN 2433
            +ATLNA+TS+LAAANPVGGRYDR++SL+ N++LSAPIMSRFDLFF+L+DEC E  D+ IA+RI +     D   +  R+Y+ +D++RY  FAR F+P++T+ A   MV +Y ++R+RD++  ++SAWRITVRQLES++RLSEA ARM   D V+   V EA RLL+KSIIRVE P        D + S++A+                                        V+A   E           A  + S  ++F EY +++ L++ HLR ++ + E+  +++ ELVEWYL  I   I  E  L+ KK ++E +I+RL+  D++L+ + +T   +   GE    + +DDP + ++PN
Sbjct:  259 QATLNARTSILAAANPVGGRYDRAKSLKHNVNLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSHKD--AAVQRVYSLEDMRRYQLFARQFKPKITKAAEDFMVEQYKRLRQRDSSGITKSAWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDINLDQDEDYHASEEASGQRSMPPFTTPSGSNGIVLNAADGINDGTNGGTNGATNGSVHASAPESPPQEVGAVPPATAKASLRLSFSEYRRLSNLLVLHLRRVE-EQEDASVRRGELVEWYLKEIESEIETEAELVTKKTVVEKVIYRLVHYDHVLIEIAKTGLGQRRRGEGDEVVQEDDPFLVVNPN 618          

HSP 2 Score: 161.384 bits (407), Expect = 6.478e-42
Identity = 77/191 (40.31%), Postives = 117/191 (61.26%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKV 687
            V D L EKCQ+LF + LE F+  + E KYV +A+++   E+  L V F DL  ++  L+  +  ++YR+YP+LC+A + F    + +       Y   F +      +R L    +G L++   QV+R+H VHPELV GTF+C DC +VV+++EQQF +T+PTIC NP C +R +F L   +S++VDFQK 
Sbjct:   15 VKDELAEKCQKLFQDFLEEFQTAEGERKYVRDAEELGRPERNTLVVDFTDLEQHNQQLATTVQEDYYRVYPYLCRAVRNFARDHWKDIPQAKEFYVA-FTEVLARHKIRELTTTKIGTLLRISAQVVRTHPVHPELVSGTFQCLDCQSVVRDVEQQFKYTQPTICRNPVCSHRRRFLLDTNKSRFVDFQKA 204          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.128 bits (627), Expect = 3.055e-73
Identity = 163/511 (31.90%), Postives = 262/511 (51.27%), Query Frame = 1
Query:  241 FLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQF-----IFTKPTICGNP---QCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQ--DPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQR 1743
             L  SF++L+ +   L ++++ N    Y    ++  + +   F     + RT T  F                LG +V   G V +   V P++V     C       K+IE+++     +   P+    P   +  N L+ E     S Y D Q + +QE   + P G +PR  DV+L ++ V+  +PGD+ +  G+   +P        G +           GY SG            T+R   + N+V  +N + + T                  + ++VNK+ T ++    N+   +   L P+ +G++ +K+ +L +L GG  K+ + G+++RGDIN+ ++GDPS AKSQ L+ +   +PRA+ T+G+ SS  GLTAAV  DQE+GE  +EAGA++L + GV CIDEFDKM   D+ AIHE MEQ  +++ KAGI A LNA+ SVLAAANP+ GRYD+ ++  +NI L   ++SRFDL F+++D+   + D EI+  +    R
Sbjct:    2 LLNSSFEELLAFQQAL-KELVGNVDGTYAKQFESFYVGLEGSFGARHLSPRTLTSRF----------------LGNMVCVEGIVTKCSLVRPKVVRSVHYCP---ATQKSIERKYSDLTSLDAFPSSAAYPTKDEESNPLETEY--GLSIYRDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLP--------GKKA----------GYTSG------------TFRTILIGNNVKQMNKEVVPT-----------------FSGEDVNKIKTFSKTHSKNIFDQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMHR 443          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 323/731 (44.19%), Postives = 467/731 (63.89%), Query Frame = 1
Query:  379 ENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPG---SRTLETKQI-KLSEGYDSGVTGLKELGVRDLTYRMAFLANHV-------------ATVNNK--------YLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRI---YNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINL----------SQQAAVNAVESEDAMG---------------------------QDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRT 2376
            E  +R +   F + PT+  +R++R   +G L+   G V R+  V PEL   +F C  C  +V N+EQ F +T+PT C NP C NR  + L   +S+++D+QKVR+QE  NE+P G +PR +DVILR ++VE A+PGD+ +FTG  I++PD++QL  PG   S TL+T+ I K +EG +SGVTGL+ LGVRDLTY+++FLA HV             A  NN+         LQ  ++ ++ E   +  +  L+  E+N++  M +D ++   +   + P  +G++ VK+G+LL + GGV K T EG KLRGDINIC+VGDPST+KSQFLK + GF+PR+VYTSGKASSAAGLTAAVVRD+E G++ IEAGALMLA+NG+CCIDEFDKM++ DQVAIHEAMEQQTIS+ KAGI ATLNA+TS+LAAANPVGGRY+R  SLR N++++APIMSRFDLFFV++D+C E++D E+A  I +        K D  I   ++ + ++RYI +AR F+P +T+EA   +V +Y ++R+ DA   SRS++RITVRQLES++RLSEA AR    D +    + EA  LL +SIIRV+  D+ +          S  A+ N  +++D  G                           +   T+T+D+Y  +  +I+  +  +D +  E +L   ++V+WYL     ++       +++++   +I RL+ KD ILM ++ T
Sbjct:  257 EQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHM-----KRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKKKTTVTYDKYVSMMNMIVRKIAEVDREGAE-ELTAVDIVDWYLLQKENDLGSLAEYWEERRLAFKVIKRLV-KDRILMEIHGT 980          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 328.176 bits (840), Expect = 3.483e-99
Identity = 215/680 (31.62%), Postives = 347/680 (51.03%), Query Frame = 1
Query:  136 EKCQRLFLNLLENFK-----------------VGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDI---MLNFYRLYPFL-------CQATQIFINK-QFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSL-------MKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDI------QRYITFAR-CFEPRVTEEAFKLMVTEYAKMRER-DAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSI 2046
            ++C   F N L +FK                   +E  Y++   +M  L    L +  ++L+ Y    ++D+   +LN+ +    +       C  + I  N   +D  E   + Y     +  +   +R L   ++ KL+  +G V+RS  V P++ +  FKC  C   +     + +  +P  C    C       LI  +  + D Q +++QET + +P G  P  + + + +E V++ + GD+ E TG+   IP         SR    K +                      Y+      HV  V++K L  +    E EL  + +       ++++T+Q++ K+  +    +L   +   + P+ Y  ++VK+G+LL LFGG  K   +G + RGDINI + GDPST+KSQ L+ +   +PR VYTSGK SSA GLTA + RD ++ + V+E+GAL+L++ GVCCIDEFDKM    +  +HE MEQQTIS+ KAGI  TLNA++S+LA+ANP+G RY+ +  + +NI L  P++SRFDL ++++D+  E+ D E+AK +T       PE       ++DD+        YI++A+    P +TE A   +V  Y  MR+  D +         T RQLES++RL+EA A+M+  + VE  DV EA RL+  +I
Sbjct:  188 QECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQ--TEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIP-----IRANSRQRVLKSL----------------------YKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEH-----ISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 304.679 bits (779), Expect = 4.331e-91
Identity = 197/598 (32.94%), Postives = 308/598 (51.51%), Query Frame = 1
Query:  415 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVV------KNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTR----IYN---------EDDIQ-----------------------------RYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            DFPT+ +LR LR  NL  LV+  G V R  GV P+L    F C  CG+++       N E +  F     C N  C ++  F +  E++ Y ++Q+V +QE    +P G +PR  +VIL  + V+ ++PG++ E TG                             YD  +       V    +     AN   ++  +   T +  EEG   +       TE+E  +   +++D  ++  +   + P+ YG+ ++K  +   LFGGVPK       +RGDIN+ ++GDP TAKSQ LK +   + RAV+ +G+ +SA GLTA+V +D  + E+ +E GAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI  TL A+ S++AAANP GGRY+ +  L QN+SL+ PI+SRFD+  V+ D   E+ D  +A  + +S     PE  + R    + N         ED+I                              +YI +AR    P++ +     +   YA +R    ++GS   + ITVR LES++R++E+ A+MR S+FV   D+  A +++  S +  ++
Sbjct:  299 DFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISF-----CTN--CKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIY------------------------KNNYDGNLNAKNGFPV----FATIIEAN---SIKRREGNTANEGEEGLDVF-----SWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGS---FPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQK 850          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Yeast
Match: MCM7 (Component of the Mcm2-7 hexameric helicase complex; MCM2-7 primes origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation in S-phase; forms an Mcm4p-6p-7p subcomplex [Source:SGD;Acc:S000000406])

HSP 1 Score: 291.197 bits (744), Expect = 2.892e-86
Identity = 201/574 (35.02%), Postives = 300/574 (52.26%), Query Frame = 1
Query:  376 TENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQC-MNRLKFELI--PEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKEL--GVRDLTYRMA-FLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQ----------RPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRE--RDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            ++N  R Y    I    L+ +R ++   LG+L+  RG + R   V P + +  + C  CG  V        FT  + C + +C  N+ K +L      SK+  FQ+ ++QE   ++P G IPR +++ +    V +  PGD  + TG  +  P                            TG K L  G+   TY  A F+  H     +  L T D+ E                   +V+ +    ++   +   + P  YGN +VK+ LLL+L GGV K   +G K+RGDIN+C++GDP  AKSQ LK I   SPR VYT+GK SS  GLTAAV++D  + E ++E GAL+LA+NG+CCIDEFDKM+  D+ AIHE MEQQTIS++KAGI  TLNA+TS+LAAANP+ GRY+   S   NI+L A ++SRFD+ F+++D  +   D ++A+ +T              PV+P K          ++ YI +A+   P ++E     +V  Y ++R+  +       S  + T R L  ++RLS+A A++R +D V+  DV EA RL+  S
Sbjct:  208 SQNCARRYRKKAISSKPLS-VRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAP---------------------------YTGFKALKAGLLTETYLEAQFVRQHKKKFASFSL-TSDVEE-------------------RVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSK----------MREYIAYAKTKRPVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVS 723          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Yeast
Match: MCM3 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex [Source:SGD;Acc:S000000758])

HSP 1 Score: 246.899 bits (629), Expect = 1.204e-69
Identity = 162/450 (36.00%), Postives = 239/450 (53.11%), Query Frame = 1
Query:  439 RNLRMGNLGKLVKFRGQVIRSHGVHPELV--------LGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQC---MNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDP 1755
            R L   +L KLV   G V ++  V P+L+         G F  +D       +  +     PT    P      N+L  E     S ++D Q++ VQE     P G +PR +DVIL ++ V+  +PGD+    G          L   G          +++   + + G K L + +  Y +   +  VA                        + LT+ ++  +  +++  ++   +   L P+ YG+D +K+ +LLML GGV K  E G+ LRGDINI +VGDPSTAKSQ L+ +   +  A+ T+G+ SS  GLTAAV  D+E+GE  +EAGA++LA+ GV CIDEFDKM   D+VAIHE MEQQT+++ KAGI  TLNA+ SV+AAANPV G+YD +R   QNI+L   ++SRFDL FV+ D+  E  D  I++ +  + R + P
Sbjct:  169 RTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRI----PTPAIYPTEDTEGNKLTTEY--GYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVF------KSLGAGG----------MNQSNSNTLIGFKTLILGNTVYPLHARSTGVAA----------------------RQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPP 574          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 421/826 (50.97%), Postives = 576/826 (69.73%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLS-EGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITE--SQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAVESEDAMGQDSQT-----------------------------ITFDEYHQITGLIISHLRAIDIDNEEIQ---LKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTES------FGGEISKDDPIVFLHPN 2433
            MD  +       V D L ++CQ+LF + LE F++  E KY+ +A+++   E+  L VS++D+ +Y++ L+  I  ++YR++P+LCQA + F   +     N +  +   FID PT   +R L    +G L++  GQV+R+H VHPELV  TF C DC TV+K++EQQF +T+PT+C NP C NR +F L   +S+YVDFQKVR+QETQ ELPRGCIPR ++VILR E VE AQ GD+ +FTG+LI++PDI+QL TPG+R+ ET Q + S EGY++ GV GLK LGVRDLTYR++FLA  V   N ++   +D++ + ++T +++ K++T QE  K+  M++D NL +N+ + +FPT +GNDEVKRG+LLMLFGGVPK T E T LRGDINIC+VGDPSTAKSQFLK +  FS RAVYTSGKASSAAGLTAAVV+D+ES EFVIEAGA+MLA+NGVCCIDEFDKM+ RDQVAIHEAMEQQTISLTKAG+KA+LNA+TSVLAAANP+GGRYDR++SL+QN+++SAPIMSRFDLFF+L+DEC E VD+ IA+RI +  S+R    E+S  R+Y  D++QRY+TFAR F+P +T+EA   MV +Y  +RERD +S ++SAWRITVRQLES++RLSEA AR+   D VE   V EA RLL+KSIIRVE PDI   ++   +     +   Q SQ                              +TF EY ++  L++ H+R  +  +E+ Q   L++S +V WYLG I   I  E  L +KK +++ ++ RLI  D +++ +   +          +  ++DP++ +HPN
Sbjct:    1 MDVADRTTGTANVRDELADRCQKLFQDFLEEFELDGEVKYLADAQELIRPERNTLVVSYQDVESYNAQLATLIQEDYYRVFPYLCQAVRNFARDRGQVPPNKE--FYVSFIDLPTRHKIRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQTVIKDVEQQFKYTQPTVCRNPICQNRARFALDINKSRYVDFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRS-ETGQRQTSGEGYEAEGVRGLKALGVRDLTYRLSFLACSVQATNPRF-GGKDLDGD-DMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEKTSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRR----EQSVERVYAVDEVQRYLTFARQFKPTITKEAQDYMVEQYKHLRERDGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKSIIRVETPDIQFDEEGEEDMETDNNEETQPSQNGINGTVNRNNGEATTTESVADHSTKPKLRLTFKEYKEMANLLVFHIRREEEKSEDEQSKGLRRSRVVNWYLGEIQSEIETEEELAEKKMLVDKVLDRLIHNDGVILELKSWKESDKEKEGEKDEEEEDPLLVVHPN 817          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 322.398 bits (825), Expect = 1.493e-97
Identity = 199/578 (34.43%), Postives = 316/578 (54.67%), Query Frame = 1
Query:  382 NNDRTYT---CHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDC----GTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITES---QRPVDPEKSDTRI-----------YNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 2049
            N DR  T       + P +  LR+LR  ++ +L++  G V  S G+ P+L +  + C  C    G   +  +Q+    KP  C  P+C +R  FE+  EQ+ Y ++QK+++QE+ +++  G +PR  DVIL  + V++ +PGD+ E TG   I  D S              +  S G+    T ++              AN +   ++K   T                 LT++++  +  +++D  + + +   + P+ YG++++KR L L LFGGV K      K+RGDIN+ + GDP TAKSQFLK +   +PRAV+T+G+ +SA GLTA V R   + E+ +EAGAL+LA+ G+C IDEFDKM   D+ +IHEAMEQQ+IS++KAGI  +L A+ S+LAAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S     P  PE  D  +             +D +++Y+ +AR    PR+       +   +A +R+   A+GS     ITVR +ES++R++E+ A+M   ++V E DV  A R++ +S I
Sbjct:  197 NYDRITTEIHVRIAELPLMEELRSLRQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKCSFILGPFFQGSDQE---VKPGSC--PECQSRGPFEINMEQTLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSS--------------LNRSNGFPVFATIIE--------------ANFITKQDDKMAVT----------------SLTDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKDPGGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHPNTPENEDEDMEVHMFTLRRNAIPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLRKESMATGS---IPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVMLESFI 722          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 303.523 bits (776), Expect = 1.558e-91
Identity = 222/681 (32.60%), Postives = 339/681 (49.78%), Query Frame = 1
Query:  136 EKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYR--------LYPFLCQ----------ATQIFINKQFDETENNDRTYTCHFID----------------FPTLT-----NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQC-MNRL--KFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRM---AFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            +K +R           G EFKY E   K+   E+  L +   D+   D  L++++  N  R        +Y  L +          A  I+I  +    + N +      ID                F  L+     ++RN++   +GKL   RG V+R   V P + + T+ C  CG       Q   F    +C + +C  NR   +  L    SK+V FQ++++QE  +++P G IPR M +I + E    A PGD    TG  I +P                              + + G R +T  +    FL  H     NK        E+ E+  D L    +++E+  + T   + +    +   L P  YG++++K+ LLL+L GGV   T  G K+RG+INI ++GDP  AKSQ L  I   +PR+ YT+G+ S+  GLTAAV++D  +GE ++E GAL+LA+ GVCCIDEFDKM   D+ AIHE MEQQT+S+ KAGI  TLNA+ S+LAAANP  GRY+  +S  QNI L A ++SRFDL +++ D+  ++ D  +A+ IT   +      S     + + ++RYI   +  +P V  E    +V+ Y +MR +DA +   + +  + R L +++RL+ A AR+R +D VE+ DV EA RL+  S
Sbjct:    9 DKAKRFLAEFYVQEDEGKEFKYGEQLIKIAHREQQELLIELDDIAEIDQDLAENVKENTRRYKRLFEDAIYEMLPEYKEREVQTKDALDIYIEHRLLLEQRNRQNEPGGAIDPRTKYPPELLRRFEVNFKHLSTQKHESVRNVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGAESYQTIQSQTFMPLLMCPSEECKTNRAGGRLYLQTRGSKFVKFQELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTG--IFLP------------------------------MMKTGFRQMTQGLLSDTFLEAHRIVRMNK-------TEDDEMPTDDL----SDEEIRALST---EADFYDKLASSLAPEIYGHEDIKKALLLLLVGGV-DCTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQHSAHPPSHYDPLDMNLMRRYIAACKEKQPIVPGELSDYIVSAYVEMR-KDARNNHDTTF-TSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLMEMS 640          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Nematostella
Match: EDO48453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT1])

HSP 1 Score: 291.197 bits (744), Expect = 6.932e-87
Identity = 213/661 (32.22%), Postives = 333/661 (50.38%), Query Frame = 1
Query:  142 CQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQAT-----QIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFI---FTKPTIC-----GNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDD-----IQRYITF--ARCFEPRVTEEAFKLMVTEYAKMR----ERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 2049
             ++ F   L  F  G   F Y +  K+  +L + +L V  +DL ++D  L+  +  N     P    A      ++   +   E E  D   T      P    +R LR  ++  LVK  G +I +  +  +    T +C+ C   + +I  +     +  P  C     G P C     F ++P++ K VDFQ +++QE+ + +P G +PR M +       E   PG++    G    I  I ++    ++  +   + + + Y      L+ +G+                    Y+ TE        +  + M    E+E  ++ T    P++   +   + P+ YG+ ++K+ +  +LFGG  K   +G   RGDIN+ ++GDP TAKSQ LK +   SP  VYTSGK SSAAGLTA+V+RD  S  FV+E GA++LA+ GV CIDEFDKM   D+VAIHEAMEQQTIS+ KAGI  TLN++ +VLAAAN V GR+D ++   QNI     I+SRFD  F++ DE  +  D  +AK + +    V    + T   NE +     +++YI++  ++C  PR++E A + +   Y  MR    E +  +  + +  ITVRQLE+++R+SE+ A+M  S F  E  V EA RL   S +
Sbjct:   31 AKKRFKEFLREFHEGTFAFPYRDQLKQHYNLGQYYLEVDLEDLSSFDENLADKLRKNPSEYLPLFETAAKEVADEVTRPRPIGEEEVQDVQITLRSGANPF--QIRELRSEHMAALVKIPGIIISASSIRSKATNITIQCRSCQNTISSIPLKPGLEGYAMPRKCPTDQTGRPPCPLD-PFFIMPDKCKCVDFQVLKLQESPDAVPNGEMPRHMQLYCDRYLTERVVPGNRVTVIG----IYSIKKVAQKANKERDAIGVGIRKPY------LRVVGI--------------------YVDTEGPGR----STGAPMNPADEEEFRRLATR---PDVADVIARSIAPSIYGSVDIKKCIACLLFGGSRKRLPDGLTRRGDINVLLLGDPGTAKSQLLKFVEKVSPIGVYTSGKGSSAAGLTASVMRDPVSRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCAVLAAANSVFGRWDDTKG-DQNIDFMPTILSRFDTIFIVKDEHNQAKDIHLAKHVMQ----VHLNAAQTTQANEGELSLSFLKKYISYCKSKC-GPRLSESAAEKLKNRYVLMRSGAKEHERDTEKKISIPITVRQLEAIIRISESLAKMSLSPFATETHVDEALRLFQVSTL 645          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Nematostella
Match: EDO42446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E9])

HSP 1 Score: 271.937 bits (694), Expect = 2.485e-81
Identity = 182/535 (34.02%), Postives = 285/535 (53.27%), Query Frame = 1
Query:  448 RMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVK---NIEQQFIFTKPTICGNPQCMNRLKFELIPEQ----SKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLI--IIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQR-PVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEA 2022
            +  ++G+ +   G VIR   +        F C  C  V     + EQ +   KPT C + +     KF  + E     +   D+Q++++QE   +L  G IPR M V+L ++ V++ + GD    +G ++    P I+++                                DL   + F ANHV +VNN+      + EE +  +D    K      +K   ++   +++ + C    P  YG   VK  + L+L GGV +V   GT++RG+ ++ ++GDP T KSQFLK  A   PR+V T+G  S++AGLT A VRD  SGE+ +EAGAL+LA+ G+CCIDEF+ +   D+ +IHEAMEQQTIS+ KAG+   LN +T++LAA NP  G+ D  +SL  N +L++P++SRFDL FVL D   E  D  ++  I E +   +  EK    ++  D +Q YI  A+  EP++  ++ +++   Y   R+ D    +R+A R T+R LESL+RL++A AR+ + + V   D V A
Sbjct:   27 KSSDMGRFLAVSGTVIRVSSIKMLEHEREFICSRCKYVFSAQADFEQFYTIPKPTSCPSGEGCTSNKFNCLSEPGSNPTSCRDYQEIKIQEQVQKLAVGTIPRSMWVVLEDDLVDSCKAGDDVTISGVVMRRWWPVIAEVKC------------------------------DL--EVVFKANHV-SVNNEQRIGAIVTEEMKQEFDEFWSK------HKDKPLSGRNHILASFC----PQVYGLYAVKLAVTLILMGGVQRVDASGTRVRGESHMLLIGDPGTGKSQFLKYSAKIMPRSVLTTGIGSTSAGLTVAAVRD--SGEWQLEAGALVLADGGLCCIDEFNSIREHDRGSIHEAMEQQTISVAKAGMVCKLNTRTTILAATNP-KGQLDIDQSLSVNTALASPLLSRFDLVFVLQDVKNEDWDRIVSSFILEGKGVRMSAEKPAEALWGMDRLQAYICHAKTLEPQLNTDSNRVLRQYYQCQRQAD----TRNAARTTLRLLESLIRLAQAHARLMYREHVTVQDAVVA 511          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Medaka
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:101159855])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 416/779 (53.40%), Postives = 548/779 (70.35%), Query Frame = 1
Query:  118 VIDALGEKCQRLFLNLLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLS-EGYDS-GVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDA-ASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAA---------------------------VNAVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILM 2361
            V D L EKCQ+LF   LE F+  D E KY+   +++   E+  L VSF DL  ++  L+  I   +YR+YP+LC+A + F     +     +  +     D PT   +R L    +G LVK   QV+R+H VHPELV GTF C DC  V+K++ QQF ++ PTIC NP C NR +F L   +SK++DFQKVR+QETQ ELPRG IPR ++V+LR E VE AQ GD+ +FTG+LI++PD+SQL+TPG R   + ++    +GY++ G+ GLK LGVR+L+YR+AFLA +VA  N ++   E  +EE   T +S+  ++TE+E  KV  M+QD NL  N+C  LFPT +GNDEVKRG+LLMLFGGVPK T EGT LRGD+N+CIVGDPSTAKSQFLK +  FSPRAVYTSGKAS+AAGLTAAVVRD+ES EFVIEAGALMLA+NGVCCIDEFDKM+++DQVAIHEAMEQQTIS+TKAG+KATLNA+TS+LAAANPVGGRYDRS+SL+QN++L+APIMSRFDLFF+L+D+C E  D+ IA+RI +    V  E+S  R+Y+ D+I+RY+ FAR F+P++++E+ + +V +Y ++R+RD+  S S+SAWRITVRQLES++RLSEA ARM   D V+   V EA RLL+KSIIRVE PDINL Q+                             VN      A  + S  ++F EY +I+ L++ HLR ++   EE +LKK+ +V WYL  I   I  E  L+ KK +IE +IHRL+  D+IL+
Sbjct:   15 VKDELAEKCQKLFQAFLEEFQTADGEVKYLREGEELIRPERNTLVVSFTDLEGFNQELATTIQEEYYRVYPYLCRAVRNFARDHGNVPLTKE--FYVAIEDLPTRHKIRELSSMRIGTLVKISCQVVRTHPVHPELVSGTFVCMDCQMVIKDVPQQFKYSPPTICRNPVCSNRSRFHLDTHKSKFIDFQKVRIQETQAELPRGSIPRSLEVVLRAEAVETAQAGDRCDFTGTLIVVPDVSQLSTPGLRAETSSRVGGGRQGYEAEGLRGLKALGVRELSYRLAFLACNVAPTNPRFGGKELRDEEQ--TAESIKSQMTEKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDVNVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASTAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDIKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSRV--EESVDRLYSLDEIRRYLLFARQFKPKISKESEEFIVEQYKRLRQRDSTGSVSKSAWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDINLEQEDEVEEEEQQEEGNNVPNGVNGHVNGHMEDVNGHSEHSAQSKPSLRLSFSEYKRISNLLVLHLRRVEEAEEEEELKKNAVVNWYLKEIESEIDSEEELINKKGLIEKVIHRLVHYDHILI 787          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Medaka
Match: mcm7 (minichromosome maintenance complex component 7 [Source:NCBI gene;Acc:101165815])

HSP 1 Score: 311.227 bits (796), Expect = 6.097e-94
Identity = 202/544 (37.13%), Postives = 287/544 (52.76%), Query Frame = 1
Query:  436 LRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRL---KFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITE-----SQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            +R++R  ++G+LV  RG V R+  V P + + T+ C  CG       Q   F    +C + +C+      +  L    SK+V FQ++R+QE  +++P G IPR M V  R E    AQPGD    TG  + +                    L  GY   + GL             +L  H  T+ NK   TED     E   D  ++ +TE+               + +   + P  YG+++VK+ LLL+L GGV +  + G K+RG INIC++GDP  AKSQ L  I   +PR+ YT+G+ SS  GLTAAV+RD  +GE  +E GAL+LA+ GVCCIDEFDKM   D+ AIHE MEQQTIS+ KAGI  +LNA+ S+LAAANP  GRY+  +S+  NI L A ++SRFDL +++ D+     D  +A+ IT       Q P      D ++     ++RYI   +  +P V E     +   Y +MR+   A  S+     + R L S++RLS A AR+R  D VE+ DV EA RL+  S
Sbjct:  149 VRDIRADSIGQLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIQSPSFMPLIMCPSQECVTNKSGGRLYLQTRGSKFVKFQELRIQEHSDQVPVGNIPRSMTVYARGENTRLAQPGDHVAITGVFLPL--------------------LRSGYSQAIQGL---------LSETYLEAHNITLMNK---TEDDELATEELSDEELRSITEE------------GFYEKLAGSIAPEIYGHEDVKKALLLLLVGGVEQAPK-GMKIRGSINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPLTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNARCSILAAANPAYGRYNPRKSIEANIQLPAALLSRFDLLWLIQDKPDADADLRLAQHITYVHQHCRQPPTHFTPIDMKL-----MRRYIALCKKRQPVVPEALADYITAAYVEMRKE--ARVSKDTTFTSARTLLSILRLSTALARLRMMDTVEKEDVNEAMRLMEMS 640          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 313.923 bits (803), Expect = 2.084e-93
Identity = 194/566 (34.28%), Postives = 312/566 (55.12%), Query Frame = 1
Query:  415 DFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQ-QFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITES---QRP------------VDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 2061
            + P +  +R LR  +L +L++  G V    GV P+L +  + C  C  V+    Q Q    KP  C  P+C ++  FE+  E++ Y ++Q++ +QE+  ++  G +PR  D IL  + V++ +PGD+ E TG       I      GS       + ++ G+                +    LANH++             +EG       + +LT+++V  ++ +++D  + + +   + P+ YG++++KR L L LFGG PK      K+RGDIN+ + GDP TAKSQFLK +   + RAV+T+G+ +SA GLTA V R   S E+ +EAGAL+LA+ GVC IDEFDKM   D+ +IHEAMEQQ+IS++KAGI  +L A+ +V+AAANP+GGRYD S +  +N+ L+ PI+SRFD+  V+ D      D  +A+ +  S     P            V P  +D     +D +++YI +A+    P++ +     +   Y+ +R+   A+GS     ITVR +ES++R++EA A+M   D+V E DV  A R++ +S I  ++
Sbjct:  275 NLPLVEEIRALRQLHLNQLIRTSGVVSCCTGVLPQLSMVKYNCSKCSFVLGPFFQSQNQEVKPGSC--PECQSQGPFEVNMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTG-------IYHNNYDGS-------LNMANGFP--------------VFATVILANHISR-----------RDEG-----VAVAELTDEDVKAIVALSKDECIGERIFASVAPSIYGHEDIKRALALSLFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSTKEGGVALEEMVLPNTTDVSPIPQDLLRKYIIYAKERVHPKLNQMDQDKVARIYSDLRKESMATGS---IPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMAIRVMLESFIDTQK 791          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 311.612 bits (797), Expect = 4.149e-93
Identity = 201/650 (30.92%), Postives = 334/650 (51.38%), Query Frame = 1
Query:  136 EKCQRLFLNLLENFKVGDEFK--------YVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFDETENNDRTYTCHFIDFPTLT--NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK-VTEEG-TKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT----ESQRPVDPEKSDTRIYNEDDIQRYITFARCF-EPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            EK QR     ++     DE          Y++  ++++ +    L V+ + + ++D+ L + ++     + P F     ++F    F+   ++   Y      +  L   N+RNL   ++ +L+   G VIR+  + PE+    F+CQ C    +    +    +P +C N  C N     L+  +S + D Q +++QE+  ++P G  P    +   N+ V+  QPGD+   TG    +P            +  +Q  +   Y + +  +                 H    + K L   D + E +L         TE  V  +  +   P++ + +   L P+ Y ++++K+G+LL LFGG  K  ++ G    R ++NI + GDP T+KSQ L+ +    PR  YTSGK SSA GLTA V++D E+ + V++ GAL+L++NG+CCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+T+VLAAANPV  +++  ++  +NI L   ++SRFDL F+++D   E  D  +A  +     +S+  ++ E  D  +     ++ YI +AR +  PR++EEA + ++  Y  MR+  +  G  SA+    RQLESL+RL+EA A++RFS+ VE  DV EA RL
Sbjct:  123 EKFQRFLQRFIDPTSTEDENAGLDLNEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNELF----FERFPDSVLEYQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEVDRGRIAEPAVCRN--CNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVP----------MRVHPRQSNVRSVYKTHIDAI-----------------HFRKTDEKRLHGLDQDGEQKL--------FTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQMEEEFLDMAV-----LKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGSGRGMVSAY---PRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRL 723          
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 310.071 bits (793), Expect = 1.983e-92
Identity = 203/650 (31.23%), Postives = 337/650 (51.85%), Query Frame = 1
Query:  136 EKCQRLFLNLLENFKVGDEFK--------YVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFDETENNDRTYTCHFIDFPTLT--NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPK-VTEEG-TKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT----ESQRPVDPEKSDTRIYNEDDIQRYITFARCF-EPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            EK QR     ++     DE          Y++  ++++ +    L V+ + + ++D+ L + ++     + P F     ++F    F+   ++   Y      +  L   N+RNL   ++ +L+   G VIR+  + PE+    F+CQ C    +    +    +P +C N  C N     L+  +S + D Q +++QE+  ++P G  P    +   N+ V+  QPGD+   TG    +P                 +++           ++  VR + Y+    A H    + K L   D + E +L         TE  V  +  +   P++ + +   L P+ Y ++++K+G+LL LFGG  K  ++ G    R ++NI + GDP T+KSQ L+ +    PR  YTSGK SSA GLTA V++D E+ + V++ GAL+L++NG+CCIDEFDKM    +  +HE MEQQT+S+ KAGI   LNA+T+VLAAANPV  +++  ++  +NI L   ++SRFDL F+++D   E  D  +A  +     +S+  ++ E  D  +     ++ YI +AR +  PR++EEA + ++  Y  MR+  +  G  SA+    RQLESL+RL+EA A++RFS+ VE  DV EA RL
Sbjct:  159 EKFQRFLQRFIDPTSTEDENAGLDLNEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNELF----FERFPDSVLEYQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEVDRGRIAEPAVCRN--CNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVP-----------------MRVHP---------RQSNVRSV-YKTHIDAIHFRKTDEKRLHGLDQDGEQKL--------FTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQMEEEFLDMAV-----LKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGSGRGMVSAY---PRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRL 759          
BLAST of DNA replication licensing factor MCM6 vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 1634 bits (4230), Expect = 0.000e+0
Identity = 787/788 (99.87%), Postives = 787/788 (99.87%), Query Frame = 1
Query:   82 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAVESEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD 2445
            MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAVE EDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD
Sbjct:    1 MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQPDINLSQQAAVNAVEPEDAMGQDSQTITFDEYHQITGLIISHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIHRLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD 788          
BLAST of DNA replication licensing factor MCM6 vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 333.183 bits (853), Expect = 9.793e-102
Identity = 207/626 (33.07%), Postives = 328/626 (52.40%), Query Frame = 1
Query:  187 DEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFL-CQATQIFINKQFDETENN-DRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEE---GTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT----ESQRPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRE-RDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 2031
            D+  Y++  K+M+ L + ++ +    L  YD  L  ++++    + P + C A  +F +   D  E    R Y C         NLRNL   +L +LV   G VIR   + PE++   FKC  C  V K   ++     P  C   QC  +   +++    +++D Q V++QE+  ++P G  P  + +    + V+  QPGD+   TG   I    SQ      R ++                          ++      H     N+ +  E+              KL+++ V ++  ++Q P+L + +   + PT YGN+ +K+GLL+MLFGG  K T++   G  +R +I++ + GDP T+KSQ L+ +   +PR  YTSGK SS  GLTA + +D E+G   +++GAL L++NG+CCIDEFDKM    +  +HE MEQQ++S+ KAGI   L+A+TSVLAAANP+G  +D  +++ +NI L   ++SRFDL F+++D   EQ D ++A+ I        +  +P   DT +     ++ YI +A+    P ++EEA   +  EY +MR+  +A  G  SA+    RQLESL+RL+EA ARMR SD V   D +EA RL
Sbjct:  104 DDPLYIQKMKEMSLLRRAWMNIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEIS-----RNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCN--QCQAKHTQQIVHNCCEFIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTG---IYRAASQRENSKQRVIKA------------------------VFKTYLDVLHFQKSKNRLIDEEE-------------AKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAM-----LRDYIAYAKENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAY---PRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 674          
BLAST of DNA replication licensing factor MCM6 vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 305.834 bits (782), Expect = 7.297e-92
Identity = 221/689 (32.08%), Postives = 339/689 (49.20%), Query Frame = 1
Query:  160 NLLENF--KVGD--EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENND-----------------------------------------RTYTCHFIDFPT--LTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGT-VVKNIEQQFIFTKPTICGNPQCM--NRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRI----TESQRP------VDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            N +ENF  +  D  +F Y E    ++  E+  + +S  D+  +DS L++ I  N +R    +C A    I+     T N                                           R Y  +FI   T    ++RN+    +G ++K +  VIR+  V P + + T+ C  CG+   + I  + +    T C N  C      +  L  + SKYV  Q++R+QE  +++P G IPR M+V          QPGD    TG  + +P    L   G RTL                       R L   +   A+ +  +     +++D+ E             TE E+ K+    +DP +   M   + P  +G+++VK+GLL+M+ GG   +   GTK+RG +NIC++GDP  AKSQ L  +    PR+ YT+G+ SS AGLTA+VVRDQ +GE  +EAG+L+LA+ G+CCIDEFDKM   D+ AIHE MEQQTIS+ KAGI  TLNA+ S+LAAANP  GRY+  R++ QNI L A ++SRFDL +++ D+     D  +A+ I    T ++ P         + +     +  +++RY+   R   +P V E     +V  Y  MR +++ +GS+ +   + R L +L+R+S A +R++    V+  DV EA RLL  S
Sbjct:   13 NFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLT-CTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITG--VFLP----LLNTGMRTLN----------------------RGLVTELFLDAHFINRITKD--ESDDLGE---------TIPATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKGLLIMMAGGA-GIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMR-KESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 655          
BLAST of DNA replication licensing factor MCM6 vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 305.064 bits (780), Expect = 1.306e-91
Identity = 221/689 (32.08%), Postives = 339/689 (49.20%), Query Frame = 1
Query:  160 NLLENF--KVGD--EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENND-----------------------------------------RTYTCHFIDFPT--LTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGT-VVKNIEQQFIFTKPTICGNPQCM--NRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRI----TESQRP------VDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 2043
            N +ENF  +  D  +F Y E    ++  E+  + +S  D+  +DS L++ I  N +R    +C A    I+     T N                                           R Y  +FI   T    ++RN+    +G ++K +  VIR+  V P + + T+ C  CG+   + I  + +    T C N  C      +  L  + SKYV  Q++R+QE  +++P G IPR M+V          QPGD    TG  + +P    L   G RTL                       R L   +   A+ +  +     +++D+ E             TE E+ K+    +DP +   M   + P  +G+++VK+GLL+M+ GG   +   GTK+RG +NIC++GDP  AKSQ L  +    PR+ YT+G+ SS AGLTA+VVRDQ +GE  +EAG+L+LA+ G+CCIDEFDKM   D+ AIHE MEQQTIS+ KAGI  TLNA+ S+LAAANP  GRY+  R++ QNI L A ++SRFDL +++ D+     D  +A+ I    T ++ P         + +     +  +++RY+   R   +P V E     +V  Y  MR +++ +GS+ +   + R L +L+R+S A +R++    V+  DV EA RLL  S
Sbjct:   16 NFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLT-CTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITG--VFLP----LLNTGMRTLN----------------------RGLVTELFLDAHFINRITKD--ESDDLGE---------TIPATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKGLLIMMAGGA-GIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMR-KESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 658          
BLAST of DNA replication licensing factor MCM6 vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 297.36 bits (760), Expect = 1.218e-88
Identity = 211/667 (31.63%), Postives = 327/667 (49.03%), Query Frame = 1
Query:  163 LLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFDETENNDRTYTCHFIDFPTLT-NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQ-----FIFTKPTICG----------NPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTG-SLIIIPDISQLTTPGSRTLETKQIKLS-EGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQR------------PVDPEKSDTRIYNEDDIQRYITFAR--CFEPRVTEEAFKLMVTEYAKMR----ERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 2049
             L+++K  D  + Y +  K+  + +K +L V +K L  +D  L+  +M       P F     ++  +  +   EN +       +   +   +LR ++   + KL+K  G V+ + G+  +    T +C+ C   + ++  +     ++  +  I              Q      + + P++ K  DFQ +++QE    +P G +PR   + +     E A PG++    G S II  D   +   G +    + + +  E   S  +G+  LGV D                          EE E    SL                  P + + +   + P  YGN ++K+ +  +LFGG  K   EG  LRGDIN+ ++GDP TAKSQ LK +   +P AVYTSGK SSAAGLTA+V+RD  +  FV+E GA++LA+ GV CIDEFDKM+  D+VAIHEAMEQQTIS+ KAGI   LN++ SVLAAAN V G +D ++   +NI     IMSRFD+ FV+ D   E+ D +I + +                  +D   ++T I     +++YI F R  C  PR+T EA K++   Y  MR    E +  +G  ++  IT+RQLE++VR++E+ A+MR + F  E D  EA RL   S +
Sbjct:   35 FLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTD-------------------------KEEKEFREFSL-----------------KPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQC-GPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTL 657          
The following BLAST results are available for this feature:
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM60.000e+052.84minichromosome maintenance complex component 6 [So... [more]
MCM21.901e-9733.90minichromosome maintenance complex component 2 [So... [more]
MCM42.790e-9632.12minichromosome maintenance complex component 4 [So... [more]
MCM76.545e-9638.24minichromosome maintenance complex component 7 [So... [more]
MCM43.836e-9531.70minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-60.000e+048.28DNA replication licensing factor mcm-6 [Source:Un... [more]
mcm-62.188e-16151.32DNA replication licensing factor mcm-6 [Source:Un... [more]
mcm-21.715e-10531.42DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-21.715e-10531.42DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-45.906e-9932.53DNA replication licensing factor mcm-4 [Source:Un... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm60.000e+048.97gene:FBgn0025815 transcript:FBtr0070952[more]
Mcm21.280e-10436.12gene:FBgn0014861 transcript:FBtr0081827[more]
dpa2.719e-9032.67gene:FBgn0015929 transcript:FBtr0345797[more]
dpa2.719e-9032.67gene:FBgn0015929 transcript:FBtr0088982[more]
Mcm52.936e-8932.56gene:FBgn0017577 transcript:FBtr0082279[more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm60.000e+053.81minichromosome maintenance complex component 6 [So... [more]
mcm6l0.000e+050.79MCM6 minichromosome maintenance deficient 6, like ... [more]
mcm6l0.000e+050.79MCM6 minichromosome maintenance deficient 6, like ... [more]
mcm6l0.000e+050.79MCM6 minichromosome maintenance deficient 6, like ... [more]
mcm42.353e-9331.55minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm6.20.000e+052.89minichromosome maintenance complex component 6 [So... [more]
mcm6.20.000e+052.35minichromosome maintenance complex component 6 [So... [more]
mcm60.000e+052.87minichromosome maintenance complex component 6 [So... [more]
mcm6.20.000e+052.99minichromosome maintenance complex component 6 [So... [more]
mcm60.000e+054.06minichromosome maintenance complex component 6 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm60.000e+053.46minichromosome maintenance complex component 6 [So... [more]
Mcm60.000e+054.65minichromosome maintenance complex component 6 [So... [more]
Mcm26.297e-9834.07minichromosome maintenance complex component 2 [So... [more]
Mcm71.481e-9537.87minichromosome maintenance complex component 7 [So... [more]
Mcm54.159e-9032.33minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14566|MCM6_HUMAN0.000e+052.84DNA replication licensing factor MCM6 OS=Homo sapi... [more]
sp|P97311|MCM6_MOUSE0.000e+053.46DNA replication licensing factor MCM6 OS=Mus muscu... [more]
sp|Q2KIZ8|MCM6_BOVIN0.000e+053.08DNA replication licensing factor MCM6 OS=Bos tauru... [more]
sp|Q498J7|MC6ZA_XENLA0.000e+051.92Zygotic DNA replication licensing factor mcm6-A OS... [more]
sp|Q6P1V8|MCM6Z_XENTR0.000e+052.42Zygotic DNA replication licensing factor mcm6 OS=X... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FJ610.000e+055.89Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564YU750.000e+055.04DNA helicase OS=Hymenolepis diminuta OX=6216 GN=WM... [more]
A0A158QCS40.000e+055.04DNA helicase OS=Hymenolepis diminuta OX=6216 GN=HD... [more]
A0A0X3PHC80.000e+055.95DNA helicase OS=Schistocephalus solidus OX=70667 G... [more]
A0A0R3T6660.000e+055.20DNA helicase OS=Rodentolepis nana OX=102285 GN=HNA... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm6l0.000e+050.12maternal DNA replication licensing factor mcm6-lik... [more]
mcm60.000e+051.96minichromosome maintenance complex component 6 [So... [more]
mcm21.472e-9634.39minichromosome maintenance complex component 2 [So... [more]
mcm22.313e-9634.39minichromosome maintenance complex component 2 [So... [more]
mcm25.107e-9634.39minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm51.328e-7935.38minichromosome maintenance complex component 5 [So... [more]
ENSPMAT00000006035.11.729e-7730.62pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
ENSPMAT00000006014.13.217e-7430.49pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
mcm6l1.544e-7339.67MCM6 minichromosome maintenance deficient 6, like ... [more]
ENSPMAT00000008164.13.055e-7331.90pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM60.000e+044.19Protein involved in DNA replication; component of ... [more]
MCM43.483e-9931.62Essential helicase component of heterohexameric MC... [more]
MCM24.331e-9132.94Protein involved in DNA replication; component of ... [more]
MCM72.892e-8635.02Component of the Mcm2-7 hexameric helicase complex... [more]
MCM31.204e-6936.00Protein involved in DNA replication; component of ... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339710.000e+050.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350601.493e-9734.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379461.558e-9132.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484536.932e-8732.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424462.485e-8134.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm60.000e+053.40minichromosome maintenance complex component 6 [So... [more]
mcm76.097e-9437.13minichromosome maintenance complex component 7 [So... [more]
mcm22.084e-9334.28minichromosome maintenance complex component 2 [So... [more]
mcm44.149e-9330.92minichromosome maintenance complex component 4 [So... [more]
mcm41.983e-9231.23minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038798.10.000e+099.87SMESG000038798.1[more]
SMESG000060238.19.793e-10233.07SMESG000060238.1[more]
SMESG000057772.17.297e-9232.08SMESG000057772.1[more]
SMESG000057772.11.306e-9132.08SMESG000057772.1[more]
SMESG000005389.11.218e-8831.63SMESG000005389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033600 ID=SMED30033600|Name=DNA replication licensing factor MCM6|organism=Schmidtea mediterranea sexual|type=transcript|length=2522bp
ATTAATAACACAATTTAATTTTATTTAACTTAGAGATGATTCGATTGTTT
TAATAATTTTTTTGGGAGATTTTATATAAAAATGGATGCCACTGAAAATC
AGAATAGGCATATTCGTGTTATTGATGCCTTAGGGGAAAAATGTCAACGC
TTGTTTCTGAACCTTCTTGAAAATTTTAAAGTCGGGGATGAATTTAAATA
TGTTGAAAATGCCAAAAAGATGACTAGTTTGGAAAAAATGTTTTTAGGTG
TCAGTTTCAAAGATTTAATGACTTATGATAGTGGTTTATCCCAAGATATC
ATGCTTAATTTTTATCGATTATATCCATTTTTATGTCAAGCAACACAAAT
TTTTATTAATAAGCAATTTGATGAAACAGAAAATAATGACAGGACATATA
CATGCCATTTTATAGATTTTCCTACTTTAACGAATTTGAGAAATCTAAGA
ATGGGAAACCTTGGAAAATTGGTGAAATTCCGAGGTCAGGTGATTAGGTC
TCATGGTGTTCATCCTGAGTTGGTTCTCGGAACTTTTAAGTGTCAAGATT
GTGGGACAGTTGTAAAGAATATTGAACAACAGTTTATTTTCACGAAGCCT
ACTATTTGTGGAAATCCTCAATGCATGAATCGCTTAAAGTTTGAATTAAT
TCCTGAACAATCAAAGTATGTTGATTTTCAAAAAGTCAGAGTACAAGAAA
CTCAGAATGAATTGCCTAGAGGATGTATTCCTAGATGCATGGATGTAATT
TTGAGAAATGAAACTGTGGAAAACGCACAACCGGGAGATCAAAGTGAATT
TACTGGATCTCTAATCATAATTCCAGATATTAGTCAATTGACAACTCCCG
GCAGTCGAACATTAGAAACCAAACAGATAAAATTATCAGAAGGGTATGAC
AGTGGAGTCACTGGTTTAAAAGAATTAGGTGTTCGAGATTTAACTTATCG
AATGGCATTCCTTGCTAATCATGTTGCAACTGTCAATAATAAATATTTGC
AAACTGAAGACATGAATGAAGAAGGTGAATTGACATATGATAGTTTGATG
AAGAAATTAACGGAACAGGAAGTCAACAAAGTTCTAACCATGAATCAAGA
CCCAAATTTAGTAAAAAATATGTGCGATTGTCTGTTTCCCACAACTTATG
GAAACGATGAAGTAAAACGGGGGCTTCTTTTAATGCTTTTCGGTGGGGTT
CCAAAAGTTACTGAAGAAGGAACAAAACTGCGAGGGGATATCAATATTTG
CATAGTCGGAGATCCAAGCACAGCCAAGTCGCAATTCCTCAAACGTATTG
CTGGATTCAGTCCTAGGGCGGTTTATACGAGTGGTAAAGCCAGCAGTGCT
GCCGGTCTGACTGCTGCTGTCGTCAGAGATCAGGAAAGCGGGGAATTCGT
TATTGAAGCCGGAGCTTTGATGTTGGCGAATAATGGAGTTTGTTGTATTG
ATGAGTTCGATAAAATGGAAGTCCGTGACCAGGTTGCTATTCACGAGGCC
ATGGAACAACAAACAATCAGTTTAACAAAGGCCGGCATAAAGGCTACTTT
GAATGCAAAAACGAGCGTGCTAGCAGCTGCTAACCCAGTCGGCGGTCGAT
ATGATCGATCTAGATCGCTTCGACAGAACATATCACTTTCAGCTCCAATC
ATGTCTCGATTTGATTTGTTTTTCGTGCTAATCGATGAATGCACCGAACA
AGTCGACCACGAAATTGCCAAACGAATCACTGAATCCCAGCGGCCAGTTG
ATCCGGAAAAGAGCGATACTCGCATCTACAATGAGGACGATATCCAACGC
TATATAACATTTGCCCGATGTTTCGAACCCCGGGTAACTGAGGAGGCATT
CAAATTGATGGTTACGGAATACGCGAAAATGCGTGAGAGAGATGCAGCGA
GTGGCAGTCGATCAGCCTGGAGAATAACCGTTCGACAATTAGAGAGTTTG
GTGCGTCTTTCTGAGGCCACTGCCCGGATGAGATTTTCAGATTTCGTAGA
GGAGTGCGATGTTGTTGAGGCGAATCGATTACTGAGTAAATCGATAATAC
GAGTTGAGCAGCCGGATATCAATCTGTCGCAACAGGCCGCTGTGAATGCG
GTCGAATCGGAAGATGCTATGGGCCAGGACAGTCAGACGATCACATTCGA
TGAGTACCATCAGATCACCGGGCTAATCATTTCCCATTTGCGCGCGATTG
ATATTGACAATGAAGAAATCCAGTTGAAAAAGAGTGAACTAGTGGAATGG
TATCTCGGTAGCATCATTGAGAACATTGCCGATGAAAATGTGCTGCTACA
AAAGAAACAAATGATTGAAATGATCATTCATAGGTTGATTGAGAAGGATA
ATATTCTGATGGCGGTTTATCGGACGGAATCATTTGGCGGGGAGATTAGT
AAGGATGATCCGATTGTATTTCTCCATCCAAACGTTGCAGCCGATTAGAT
TAATCCCTGCTATTATTTGTTGTTAGATGTATTGTAATAAATTAGATAAT
ATATTGTTCTATCACTCGAAAA
back to top

protein sequence of SMED30033600-orf-1

>SMED30033600-orf-1 ID=SMED30033600-orf-1|Name=SMED30033600-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=789bp
MDATENQNRHIRVIDALGEKCQRLFLNLLENFKVGDEFKYVENAKKMTSL
EKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETE
NNDRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLG
TFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQ
KVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDI
SQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVAT
VNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDC
LFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKS
QFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLAN
NGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAA
NPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT
ESQRPVDPEKSDTRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKM
RERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL
LSKSIIRVEQPDINLSQQAAVNAVESEDAMGQDSQTITFDEYHQITGLII
SHLRAIDIDNEEIQLKKSELVEWYLGSIIENIADENVLLQKKQMIEMIIH
RLIEKDNILMAVYRTESFGGEISKDDPIVFLHPNVAAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032508DNA duplex unwinding
GO:0006270DNA replication initiation
GO:0006260DNA replication
GO:0006268DNA unwinding involved in DNA replication
GO:0007049cell cycle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041024Mcm6_C
IPR041562MCM_lid
IPR033762MCM_OB
IPR008049MCM6
IPR001208MCM_dom
IPR003593AAA+_ATPase
IPR031327MCM
IPR012340NA-bd_OB-fold
IPR027417P-loop_NTPase
IPR004039Rubredoxin-type_fold
IPR027925MCM_N
IPR018525MCM_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
GO:0003678DNA helicase activity
GO:0000166nucleotide binding
GO:0003697single-stranded DNA binding
GO:0004003ATP-dependent DNA helicase activity
GO:0004386helicase activity
GO:0005515protein binding
GO:0016787hydrolase activity
GO:0042802identical protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0042555MCM complex
GO:0000784nuclear chromosome, telomeric region
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008049DNA replication licensing factor Mcm6PRINTSPR01662MCMPROTEIN6coord: 77..89
score: 53.85
coord: 166..183
score: 63.58
coord: 219..230
score: 55.56
coord: 275..296
score: 72.73
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 384..399
score: 67.94
coord: 496..508
score: 72.46
coord: 444..458
score: 70.25
coord: 472..485
score: 74.88
coord: 523..531
score: 65.71
IPR001208MCM domainPFAMPF00493MCMcoord: 331..552
e-value: 1.6E-97
score: 325.0
IPR001208MCM domainPROSITEPS50051MCM_2coord: 343..549
score: 88.902
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 115..656
e-value: 9.2E-251
score: 849.0
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 7..672
coord: 677..769
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 385..535
e-value: 6.7E-4
score: 29.0
IPR041024Mcm6, C-terminal winged-helix domainPFAMPF18263MCM6_Ccoord: 685..786
e-value: 2.6E-20
score: 72.7
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 571..655
e-value: 4.7E-25
score: 87.8
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 149..193
e-value: 1.8E-32
score: 114.0
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 119..245
e-value: 1.8E-32
score: 114.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 327..660
e-value: 5.4E-125
score: 419.0
NoneNo IPR availableGENE3DG3DSA:1.20.58.870coord: 681..788
e-value: 1.2E-24
score: 88.4
NoneNo IPR availableGENE3DG3DSA:3.30.1640.10coord: 8..115
e-value: 5.0E-14
score: 54.4
NoneNo IPR availablePANTHERPTHR11630:SF73DNA REPLICATION LICENSING FACTOR MCM6coord: 677..769
NoneNo IPR availablePANTHERPTHR11630:SF73DNA REPLICATION LICENSING FACTOR MCM6coord: 7..672
NoneNo IPR availableCDDcd17757MCM6coord: 346..654
e-value: 0.0
score: 554.286
IPR027925MCM N-terminal domainPFAMPF14551MCM_Ncoord: 22..110
e-value: 1.1E-11
score: 45.2
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 119..247
e-value: 4.0E-34
score: 117.2
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 452..460
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 352..662
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 27..249