Microtubule-associated protein 1A

Overview
NameMicrotubule-associated protein 1A
Smed IDSMED30033594
Length (bp)7984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microtubule-associated protein 1A (SMED30033594) t-SNE clustered cells

Violin plots show distribution of expression levels for Microtubule-associated protein 1A (SMED30033594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microtubule-associated protein 1A (SMED30033594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microtubule-associated protein 1A (SMED30033594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033594SMESG000014298.1 dd_Smed_v4_3654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033594SMESG000014298.1 dd_Smed_v4_3654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033594SMESG000014298.1 dd_Smed_v4_3654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30033594SMESG000014298.1 dd_Smed_v4_3654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033594SMESG000014298.1 dd_Smed_v4_3654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033594SMESG000014298.1 dd_Smed_v4_1301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033594SMESG000014298.1 dd_Smed_v4_1301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033594SMESG000014298.1 dd_Smed_v4_1301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30033594SMESG000014298.1 dd_Smed_v4_1301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033594SMESG000014298.1 dd_Smed_v4_1301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30033594SMESG000014298.1 dd_Smed_v6_1301_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30033594SMESG000014298.1 dd_Smed_v6_3654_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microtubule-associated protein 1A vs. Ensembl Human
Match: MAP1B (microtubule associated protein 1B [Source:HGNC Symbol;Acc:HGNC:6836])

HSP 1 Score: 71.2478 bits (173), Expect = 3.402e-11
Identity = 50/187 (26.74%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K    E ++             L  P+L    L +  N    +  + +K  +E     E+   L+ +  L +   PL + S    ++P  L+ K+G G L+ + L P   ++S   + ++++W
Sbjct:  263 YIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIE-----EACFTLQYLNKLSMKPEPLFR-SVGNTIDPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQW 441          
BLAST of Microtubule-associated protein 1A vs. Ensembl Human
Match: MAP1B (microtubule associated protein 1B [Source:HGNC Symbol;Acc:HGNC:6836])

HSP 1 Score: 70.0922 bits (170), Expect = 3.773e-11
Identity = 50/187 (26.74%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K    E ++             L  P+L    L +  N    +  + +K  +E     E+   L+ +  L +   PL + S    ++P  L+ K+G G L+ + L P   ++S   + ++++W
Sbjct:  137 YIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIE-----EACFTLQYLNKLSMKPEPLFR-SVGNTIDPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQW 315          
BLAST of Microtubule-associated protein 1A vs. Ensembl Human
Match: MAP1B (microtubule associated protein 1B [Source:HGNC Symbol;Acc:HGNC:6836])

HSP 1 Score: 70.4774 bits (171), Expect = 3.890e-11
Identity = 51/192 (26.56%), Postives = 97/192 (50.52%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESK 1274
            YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K    E ++             L  P+L    L +  N    +  + +K  +E     E+   L+ +  L +   PL + S    ++P  L+ K+G G L+ + L P   ++S   + ++++W   +K
Sbjct:  280 YIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIE-----EACFTLQYLNKLSMKPEPLFR-SVGNTIDPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQWTGTNK 463          
BLAST of Microtubule-associated protein 1A vs. Ensembl Human
Match: MAP1A (microtubule associated protein 1A [Source:HGNC Symbol;Acc:HGNC:6835])

HSP 1 Score: 69.3218 bits (168), Expect = 1.528e-10
Identity = 54/173 (31.21%), Postives = 84/173 (48.55%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKL-DIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPC 1214
            YIF  G G S+L A++GFN+L+D G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E ++             L  P L         N V EK +L D     + +IE E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD + L P 
Sbjct:   41 YIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFF----N-VPEKLRLPDASRKAKRSIE-EACLTLQHLNRLGIQAEPLYRVVSNT-IEPLTLFHKMGVGRLDMYVLNPV 206          
BLAST of Microtubule-associated protein 1A vs. Ensembl Human
Match: MAP1A (microtubule associated protein 1A [Source:HGNC Symbol;Acc:HGNC:6835])

HSP 1 Score: 68.9366 bits (167), Expect = 1.719e-10
Identity = 54/173 (31.21%), Postives = 84/173 (48.55%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKL-DIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPC 1214
            YIF  G G S+L A++GFN+L+D G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E ++             L  P L         N V EK +L D     + +IE E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD + L P 
Sbjct:  279 YIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFF----N-VPEKLRLPDASRKAKRSIE-EACLTLQHLNRLGIQAEPLYRVVSNT-IEPLTLFHKMGVGRLDMYVLNPV 444          
BLAST of Microtubule-associated protein 1A vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0307597)

HSP 1 Score: 98.2117 bits (243), Expect = 1.318e-19
Identity = 86/355 (24.23%), Postives = 160/355 (45.07%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNE-------TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIG-----PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            NL  ++LI P Y  L + +  L  S   + ++I++ G   +G  S W+L+DG FS         E        ++ +  +M      NI    ++  W+    TL  K         F+    I I    + D   E  +    +    M++  ++   L  S  +G ++ T+   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F + L+++D ++MT  N  N+ G+ +++  K D+        +P + +    +      P+P  +K+    +  L I++    H I+  +KALD+      R+    P  LY K+G G LD + + P     S   K ++++W
Sbjct:  185 NLVTEVLIHPQYNTLIQCMRNLLSS-FTRHRHIIHAGYTFSGNGS-WILQDGTFSVADFSEAFQEHDVQRVIRAYADTITM------NIHC-ADAGLWH----TLPEK--------AFARQCRIRINPVDVLDTSSECIN-GFIDYLAPMVMPTSLRELLETSDVVGNIRFTHP--TLYVFPGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDA------HVYPQIGHFFGNVPDRKGLPSPDGDKD----RDPLLIDLFERGHGIVSDLKALDLKPQCCYRN--QEPVNLYHKVGHGTLDMYVISPA--RDSKEVKEFLQKW 501          

HSP 2 Score: 68.5514 bits (166), Expect = 1.226e-10
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 3
Query: 7395 KLPA-FYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 7766
            K PA  Y+D+ Y+P   +GN     V   FF R+RAR Y+  G E + +V +  L +++ W   D E+EV +IP   T+ L  W  E+   L+   I +  +   C+++L    T  S A+R++F
Sbjct: 5378 KKPAPVYVDLTYVP--HNGNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTW--EDKELEVTIIPTYDTDVLGYWVAENEELLAKHRIDLSPSASRCTINLQDHETSCS-AYRLEF 5495          
BLAST of Microtubule-associated protein 1A vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0307598)

HSP 1 Score: 98.2117 bits (243), Expect = 1.318e-19
Identity = 86/355 (24.23%), Postives = 160/355 (45.07%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNE-------TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIG-----PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            NL  ++LI P Y  L + +  L  S   + ++I++ G   +G  S W+L+DG FS         E        ++ +  +M      NI    ++  W+    TL  K         F+    I I    + D   E  +    +    M++  ++   L  S  +G ++ T+   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F + L+++D ++MT  N  N+ G+ +++  K D+        +P + +    +      P+P  +K+    +  L I++    H I+  +KALD+      R+    P  LY K+G G LD + + P     S   K ++++W
Sbjct:  185 NLVTEVLIHPQYNTLIQCMRNLLSS-FTRHRHIIHAGYTFSGNGS-WILQDGTFSVADFSEAFQEHDVQRVIRAYADTITM------NIHC-ADAGLWH----TLPEK--------AFARQCRIRINPVDVLDTSSECIN-GFIDYLAPMVMPTSLRELLETSDVVGNIRFTHP--TLYVFPGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDA------HVYPQIGHFFGNVPDRKGLPSPDGDKD----RDPLLIDLFERGHGIVSDLKALDLKPQCCYRN--QEPVNLYHKVGHGTLDMYVISPA--RDSKEVKEFLQKW 501          

HSP 2 Score: 68.5514 bits (166), Expect = 1.226e-10
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 3
Query: 7395 KLPA-FYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 7766
            K PA  Y+D+ Y+P   +GN     V   FF R+RAR Y+  G E + +V +  L +++ W   D E+EV +IP   T+ L  W  E+   L+   I +  +   C+++L    T  S A+R++F
Sbjct: 5378 KKPAPVYVDLTYVP--HNGNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTW--EDKELEVTIIPTYDTDVLGYWVAENEELLAKHRIDLSPSASRCTINLQDHETSCS-AYRLEF 5495          
BLAST of Microtubule-associated protein 1A vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0112628)

HSP 1 Score: 98.2117 bits (243), Expect = 1.318e-19
Identity = 86/355 (24.23%), Postives = 160/355 (45.07%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNE-------TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIG-----PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            NL  ++LI P Y  L + +  L  S   + ++I++ G   +G  S W+L+DG FS         E        ++ +  +M      NI    ++  W+    TL  K         F+    I I    + D   E  +    +    M++  ++   L  S  +G ++ T+   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F + L+++D ++MT  N  N+ G+ +++  K D+        +P + +    +      P+P  +K+    +  L I++    H I+  +KALD+      R+    P  LY K+G G LD + + P     S   K ++++W
Sbjct:  185 NLVTEVLIHPQYNTLIQCMRNLLSS-FTRHRHIIHAGYTFSGNGS-WILQDGTFSVADFSEAFQEHDVQRVIRAYADTITM------NIHC-ADAGLWH----TLPEK--------AFARQCRIRINPVDVLDTSSECIN-GFIDYLAPMVMPTSLRELLETSDVVGNIRFTHP--TLYVFPGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDA------HVYPQIGHFFGNVPDRKGLPSPDGDKD----RDPLLIDLFERGHGIVSDLKALDLKPQCCYRN--QEPVNLYHKVGHGTLDMYVISPA--RDSKEVKEFLQKW 501          

HSP 2 Score: 68.5514 bits (166), Expect = 1.226e-10
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 3
Query: 7395 KLPA-FYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 7766
            K PA  Y+D+ Y+P   +GN     V   FF R+RAR Y+  G E + +V +  L +++ W   D E+EV +IP   T+ L  W  E+   L+   I +  +   C+++L    T  S A+R++F
Sbjct: 5378 KKPAPVYVDLTYVP--HNGNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTW--EDKELEVTIIPTYDTDVLGYWVAENEELLAKHRIDLSPSASRCTINLQDHETSCS-AYRLEF 5495          
BLAST of Microtubule-associated protein 1A vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 78.9518 bits (193), Expect = 1.066e-13
Identity = 80/309 (25.89%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  360 AGYSSN---WLLEDGIFSAHTMLTTLNE---TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFD--QEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            +G SS+    +L+ G+FS  T L    E   +  + K S    + + + + ++ A W+ +    +I+E       + +++    +  E I    + + +F++ + E    +     +L    + G L+L+      YIF  G G S+L A++GFN+LID G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E +EE S  +  Y       + P +G      P  ++  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD F L P
Sbjct:  151 SGQSSDQGDLVLQTGVFSHQTFLRVFAEPGVSHLLGKASSGQRASLTV-SCRSDAGWSSLGQQQRIRE-------LLNYT----LNPEPILPKMEGVTEFTEYISETVD-VPSPFDLLEPPTSGGFLKLSKP--CCYIFPGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKV--AEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIE-----EASLTLQYLNKLGIKPEPLFRVVSNT-IEPITLFHKMGVGRLDMFVLNP 436          
BLAST of Microtubule-associated protein 1A vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 78.9518 bits (193), Expect = 1.066e-13
Identity = 80/309 (25.89%), Postives = 144/309 (46.60%), Query Frame = 3
Query:  360 AGYSSN---WLLEDGIFSAHTMLTTLNE---TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFD--QEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            +G SS+    +L+ G+FS  T L    E   +  + K S    + + + + ++ A W+ +    +I+E       + +++    +  E I    + + +F++ + E    +     +L    + G L+L+      YIF  G G S+L A++GFN+LID G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E +EE S  +  Y       + P +G      P  ++  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD F L P
Sbjct:  151 SGQSSDQGDLVLQTGVFSHQTFLRVFAEPGVSHLLGKASSGQRASLTV-SCRSDAGWSSLGQQQRIRE-------LLNYT----LNPEPILPKMEGVTEFTEYISETVD-VPSPFDLLEPPTSGGFLKLSKP--CCYIFPGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKV--AEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIE-----EASLTLQYLNKLGIKPEPLFRVVSNT-IEPITLFHKMGVGRLDMFVLNP 436          
BLAST of Microtubule-associated protein 1A vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 78.5666 bits (192), Expect = 1.384e-13
Identity = 56/173 (32.37%), Postives = 87/173 (50.29%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+LID G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E +EE S  +  Y       + P +G      P  ++  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD F L P
Sbjct:   41 YIFPGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKV--AEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIE-----EASLTLQYLNKLGIKPEPLFRVVSNT-IEPITLFHKMGVGRLDMFVLNP 205          
BLAST of Microtubule-associated protein 1A vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 78.5666 bits (192), Expect = 1.421e-13
Identity = 56/173 (32.37%), Postives = 87/173 (50.29%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+LID G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E +EE S  +  Y       + P +G      P  ++  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD F L P
Sbjct:   41 YIFPGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKV--AEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIE-----EASLTLQYLNKLGIKPEPLFRVVSNT-IEPITLFHKMGVGRLDMFVLNP 205          
BLAST of Microtubule-associated protein 1A vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 78.5666 bits (192), Expect = 1.421e-13
Identity = 56/173 (32.37%), Postives = 87/173 (50.29%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+LID G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E +EE S  +  Y       + P +G      P  ++  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD F L P
Sbjct:   41 YIFPGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKV--AEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIE-----EASLTLQYLNKLGIKPEPLFRVVSNT-IEPITLFHKMGVGRLDMFVLNP 205          
BLAST of Microtubule-associated protein 1A vs. Ensembl Xenopus
Match: MAP1A (microtubule associated protein 1A [Source:NCBI gene;Acc:100493436])

HSP 1 Score: 72.0182 bits (175), Expect = 1.773e-11
Identity = 54/173 (31.21%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G +R   FW  ++ L++ID++++T     NL G+  LL+ K    E  EE S  +  Y       + P +G      P+ +K  E  + +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD + L P
Sbjct:  139 YIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSILLTHIGADNLPGINGLLQRKI--AEQDEEQSQGSTTYSDWMKNLISPELGVVFFNVPDKLKMPESNMKVKRSIE-----EACLTLQYLNKLGIKPEPLYRVVSNT-IEPITLFHKMGVGRLDMYILNP 303          
BLAST of Microtubule-associated protein 1A vs. Ensembl Xenopus
Match: MAP1A (microtubule associated protein 1A [Source:NCBI gene;Acc:100493436])

HSP 1 Score: 72.0182 bits (175), Expect = 1.826e-11
Identity = 54/173 (31.21%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G +R   FW  ++ L++ID++++T     NL G+  LL+ K    E  EE S  +  Y       + P +G      P+ +K  E  + +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD + L P
Sbjct:  267 YIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSILLTHIGADNLPGINGLLQRKI--AEQDEEQSQGSTTYSDWMKNLISPELGVVFFNVPDKLKMPESNMKVKRSIE-----EACLTLQYLNKLGIKPEPLYRVVSNT-IEPITLFHKMGVGRLDMYILNP 431          
BLAST of Microtubule-associated protein 1A vs. Ensembl Xenopus
Match: pcbp2 (poly(rC) binding protein 2 [Source:Xenbase;Acc:XB-GENE-5903797])

HSP 1 Score: 71.633 bits (174), Expect = 2.618e-11
Identity = 59/227 (25.99%), Postives = 111/227 (48.90%), Query Frame = 3
Query:  624 IEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF---------DSTENKEELSH---PNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            + +F++ L E  + M     +L    + G L+L+      YIF  G G S+L A++GFN+L++ G  R   FW  ++ L+++D++++T   + NL G+ S+L+ K           ST N + L +   P+L    L +  N    +    ++  LE     E+   L+ +  L +   PL + S    ++P  L+ K+G G L+ + L P   + S   + ++++W
Sbjct:  224 LSEFTEYLSESVE-MPSPFDILEPPTSGGFLKLSKP--CCYIFPGGRGDSALFAVNGFNMLVNGGSDRKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKMAELEEEQSQGSTTNSDWLKNLISPDLGVVFLNVPDNLKNPEPNFKVRRSLE-----EACFTLQYLNKLSMKPEPLFR-SVGNTIDPIILFQKMGVGKLEMYVLNPV--KGSTEMQYFMQQW 439          
BLAST of Microtubule-associated protein 1A vs. Ensembl Xenopus
Match: MAP1S (microtubule associated protein 1S [Source:NCBI gene;Acc:100494497])

HSP 1 Score: 60.077 bits (144), Expect = 6.628e-8
Identity = 60/245 (24.49%), Postives = 109/245 (44.49%), Query Frame = 3
Query:  207 KKKIDIADKETNLSVQI-LIQP--TYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRV-FSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLL 929
            K    I + +T L   + LI P  T+  + + I Y +     + K ++++G    G     L + G FS    +    +    E  S+   S    LT     +W+  +S L  K + QD + + F+ +  +P   E+   QE+ ++     E          +L     +G L+L       Y+F  G G S+  A++GFN+L++ G      FW  ++ L++ID++++T     +L G+ SLL
Sbjct:   72 KGMFAILNNQTALLFTLSLITPSKTHTYIHKLICYES-----QHKLLIFIGPFLEGTGEILLQDGGNFSVKDFIQIFADKEIGETLSLSDPSAHVNLTVTCPQNWD--VSQLD-KGSLQDFIEMRFNPAQLLP---ETEGLQELAEYLSESLEPSSPF----ELLEPPSTVGFLKLFKP--CCYVFPGGRGDSAFFAVNGFNMLMNGGSDTRSPFWKLVRHLDRIDSILLTHMGTDSLPGINSLL 299          
BLAST of Microtubule-associated protein 1A vs. Ensembl Mouse
Match: Map1b (microtubule-associated protein 1B [Source:MGI Symbol;Acc:MGI:1306778])

HSP 1 Score: 71.633 bits (174), Expect = 1.941e-11
Identity = 57/204 (27.94%), Postives = 103/204 (50.49%), Query Frame = 3
Query:  684 VLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF---------DSTENKE---ELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            +L    + G L+L+      YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K           ST N +    L  P+L    L + P  +K+ E  +IK    I     + + L ++     PL + S    + P  L+ K+G G L+ + L P   ++S   + ++++W
Sbjct:  245 ILEPPTSGGFLKLSKP--CCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNV-PENLKDPEP-NIKMKRSIEEACFTLQYLNKLSMKPEPLFR-SVGNTIEPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQW 441          
BLAST of Microtubule-associated protein 1A vs. Ensembl Mouse
Match: Map1a (microtubule-associated protein 1 A [Source:MGI Symbol;Acc:MGI:1306776])

HSP 1 Score: 67.3958 bits (163), Expect = 3.364e-10
Identity = 53/172 (30.81%), Postives = 84/172 (48.84%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKL-DIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E ++             L  P L         N V +K +L D     + +IE E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD + L P
Sbjct:   41 YIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFF----N-VPDKLRLPDASRKAKRSIE-EACLTLQHLNRLGIQAEPLYRVVSNT-IEPLTLFHKMGVGRLDMYVLNP 205          
BLAST of Microtubule-associated protein 1A vs. Ensembl Mouse
Match: Map1a (microtubule-associated protein 1 A [Source:MGI Symbol;Acc:MGI:1306776])

HSP 1 Score: 67.0106 bits (162), Expect = 4.151e-10
Identity = 53/172 (30.81%), Postives = 84/172 (48.84%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKL-DIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G  R   FW  ++ L++ID++++T     NL G+  LL+ K    E ++             L  P L         N V +K +L D     + +IE E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD + L P
Sbjct:  279 YIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFF----N-VPDKLRLPDASRKAKRSIE-EACLTLQHLNRLGIQAEPLYRVVSNT-IEPLTLFHKMGVGRLDMYVLNP 443          
BLAST of Microtubule-associated protein 1A vs. UniProt/SwissProt
Match: sp|Q9W596|FUTSC_DROME (Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4)

HSP 1 Score: 98.2117 bits (243), Expect = 1.321e-18
Identity = 86/355 (24.23%), Postives = 160/355 (45.07%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNE-------TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIG-----PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            NL  ++LI P Y  L + +  L  S   + ++I++ G   +G  S W+L+DG FS         E        ++ +  +M      NI    ++  W+    TL  K         F+    I I    + D   E  +    +    M++  ++   L  S  +G ++ T+   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F + L+++D ++MT  N  N+ G+ +++  K D+        +P + +    +      P+P  +K+    +  L I++    H I+  +KALD+      R+    P  LY K+G G LD + + P     S   K ++++W
Sbjct:  185 NLVTEVLIHPQYNTLIQCMRNLLSS-FTRHRHIIHAGYTFSGNGS-WILQDGTFSVADFSEAFQEHDVQRVIRAYADTITM------NIHC-ADAGLWH----TLPEK--------AFARQCRIRINPVDVLDTSSECIN-GFIDYLAPMVMPTSLRELLETSDVVGNIRFTHP--TLYVFPGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDA------HVYPQIGHFFGNVPDRKGLPSPDGDKD----RDPLLIDLFERGHGIVSDLKALDLKPQCCYRN--QEPVNLYHKVGHGTLDMYVISPA--RDSKEVKEFLQKW 501          

HSP 2 Score: 68.5514 bits (166), Expect = 1.229e-9
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 3
Query: 7395 KLPA-FYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 7766
            K PA  Y+D+ Y+P   +GN     V   FF R+RAR Y+  G E + +V +  L +++ W   D E+EV +IP   T+ L  W  E+   L+   I +  +   C+++L    T  S A+R++F
Sbjct: 5378 KKPAPVYVDLTYVP--HNGNSYYAHVD--FFKRVRARYYVFSGTEPSRQVYDALLEAKQTW--EDKELEVTIIPTYDTDVLGYWVAENEELLAKHRIDLSPSASRCTINLQDHETSCS-AYRLEF 5495          
BLAST of Microtubule-associated protein 1A vs. UniProt/SwissProt
Match: sp|P14873|MAP1B_MOUSE (Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 1.358e-10
Identity = 57/204 (27.94%), Postives = 103/204 (50.49%), Query Frame = 3
Query:  684 VLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF---------DSTENKE---ELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            +L    + G L+L+      YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K           ST N +    L  P+L    L + P  +K+ E  +IK    I     + + L ++     PL + S    + P  L+ K+G G L+ + L P   ++S   + ++++W
Sbjct:  245 ILEPPTSGGFLKLSKP--CCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNV-PENLKDPEP-NIKMKRSIEEACFTLQYLNKLSMKPEPLFR-SVGNTIEPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQW 441          
BLAST of Microtubule-associated protein 1A vs. UniProt/SwissProt
Match: sp|P14401|ENP2_TETCF (Electromotor neuron-associated protein 2 (Fragment) OS=Tetronarce californica OX=7787 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.614e-10
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSH--------------PNLNYCVLPIGPNPVKEKE-KLDIKSYLEINIEMESHKILRQIKALDIPLLQMSR--DAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQ 1280
            YIF  G G S+L A++GFN+L+D G +R   FW  ++ L++ID++++T     NL G+  LL+ K    E  EE S               P L      + P+ +K +E  + +K  +E     E+   L+ +  L +    ++R   A ++P  L+ K+G G LD + L P   + S   +  +++W   SK +
Sbjct:   36 YIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSILLTHIGADNLPGINGLLQRKI--AEQDEEQSQGSTTYSDWMKNLISPELGVVFFNV-PDKLKTQESSMRVKRSIE-----EACLTLQYLTKLGVNPEPLNRVVTATIDPIPLFHKMGVGRLDMYILNPV--KDSKEMQFLMQKWAGNSKAK 221          
BLAST of Microtubule-associated protein 1A vs. UniProt/SwissProt
Match: sp|P46821|MAP1B_HUMAN (Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.634e-10
Identity = 50/187 (26.74%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEE------------LSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K    E ++             L  P+L    L +  N    +  + +K  +E     E+   L+ +  L +   PL + S    ++P  L+ K+G G L+ + L P   ++S   + ++++W
Sbjct:  263 YIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIE-----EACFTLQYLNKLSMKPEPLFR-SVGNTIDPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQW 441          
BLAST of Microtubule-associated protein 1A vs. UniProt/SwissProt
Match: sp|P15205|MAP1B_RAT (Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.998e-10
Identity = 56/207 (27.05%), Postives = 103/207 (49.76%), Query Frame = 3
Query:  684 VLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF---------DSTENKE---ELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEW 1259
            +L    + G L+L+      YIF  G G S+L A++GFN+LI+ G +R   FW  ++ L+++D++++T   + NL G+ S+L+ K           ST N +    L  P+L    L +  N    +  + +K   E     E+   L+ +  L +   PL +   +A + P  L+ K+G G L+ + L P   ++S   + ++++W
Sbjct:  245 ILEPPTSGGFLKLSKP--CCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSTE-----EACFTLQYLNKLSMKPEPLFRSVGNA-IEPVILFQKMGVGKLEMYVLNPV--KSSKEMQYFMQQW 441          
BLAST of Microtubule-associated protein 1A vs. TrEMBL
Match: W4VRG5 (Putative microtubule-associated protein futsch (Fragment) OS=Corethrella appendiculata OX=1370023 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.289e-27
Identity = 109/437 (24.94%), Postives = 201/437 (46.00%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNE-------TSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVN---NAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLN--YCVLPIGP-NPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKD--------NASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKI----NPVCN 1475
            NL  +ILI P      + I  L  S   + ++I++ G   AG  S W+L+DG FS         E        ++ +  +M    P   L       W  +          QD  + F+ + +I I  + + D   E  + +  +    M++    + +L  S+ +G ++ ++   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F++ L+++D ++MT  N  N+ G+ S+++ K  +        +P +   +C +P G  N +KEK+       L +N+  E HKI++ +K L++      +D+   P  LY K+G G LD + + P   + S   K +I++W   S  + ++  +  KD         +   LL+W  +       N E N +TRIL   S  +  +   L++   I    +PVC+
Sbjct:   11 NLVTEILIHPQVNTFIQCIRNLLSS-FTRHRHIIHAGYTFAGNGS-WMLQDGTFSVSDFSDAFQEHEVQRVLRAYPDSITMNIHCPTGEL-------WKNV----------QD--KNFAKTCKIKINPDDVIDSASEKLN-TFLDYLSPMIIPTDISTLLESSEIVGNIRFSH--PTLYVFPGGQGDAALFGINGFNMLVDGGFSRKSCFWDFVRHLDRLDAVLMTRINNSNINGMNSIIERKHGA------HVYPQIGHFFCNIPDGKDNSLKEKD------TLVVNLVAEGHKIVKNLKTLNLNAQNCYQDS--EPINLYHKVGHGTLDMYVISPA--KDSKEVKEFIQKW--NSNDRKLFTTKDGKDFVFPLQNMVSICALLVWQPA-------NPEDN-ITRILFPGSTPDQKIFDGLDKVKNIEFMKHPVCS 397          

HSP 2 Score: 70.0922 bits (170), Expect = 1.041e-7
Identity = 37/120 (30.83%), Postives = 64/120 (53.33%), Query Frame = 3
Query: 7407 FYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 7766
             Y+D++Y+P    GN   + V   FF R+RAR Y+  G E + +V    L +++ W   D ++EV +IP   T+ L  W  E+   L+  +I +  +   C+++L    T  S A+R++F
Sbjct: 3932 VYVDLSYVP--HHGNSYYSHVE--FFKRVRARYYVFSGTEPSKDVYNALLEAKQTW--EDKDLEVTIIPTYDTDVLGYWVSENEELLAQYHIDLSPSAARCTINLQDHETSCS-AYRLEF 4044          
BLAST of Microtubule-associated protein 1A vs. TrEMBL
Match: A0A182Q9U6 (Uncharacterized protein OS=Anopheles farauti OX=69004 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.618e-26
Identity = 112/436 (25.69%), Postives = 193/436 (44.27%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSA---HWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLN--YCVLPIG---PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAF----------LLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKI----NPVC 1472
            NL  +ILI P      + I  L  S   + ++I++ G   +G  S W+L+DG FS    +    E    E   +  A P  I    + A    W+ I              + FS   +I +    +     E  S +      SM++   +   L  S  +G ++ ++   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F++ L+++D ++MT  N  N+ G+ S+++ K       E   +P +   +C +P     P+P  +K+    +  L ++I  E H+I+  +K+L++      RDA+  P  LY K+G G LD + + P     S   K ++  W   +  Q ++  E       AF          LL+W  +       N E N +TRIL   S  E  +L+ LE+   +     PVC
Sbjct:   33 NLVTEILIHPQVNTFIQCIRNLLSS-FTRHRHIIHTGYTFSGNGS-WILQDGTFSVVDFMEAFQEH---EVQRVLRAYPDTITMDVHCAPVGQWHNIQE------------KSFSRLCQIRLNPVDVLSSGSERLS-AFVAYLSSMIIPTEISELLESSDVVGNIRFSHP--TLYVFPGGQGDAALFGINGFNMLVDGGFSRKSCFWDFVRHLDRLDAVLMTRINNTNIKGISSVVERK------SEAHVYPQIGHFFCNIPERKGLPSPDGDKD----RDPLLVDILQEGHQIVTNLKSLNLKAQNCYRDAE--PINLYHKVGHGTLDMYVISPA--RDSREVKDFLARW--AAADQRLFTKEGKDGKDFAFPLQNLISICALLVWTPA-------NPEDN-ITRILFPGSAPEHKILEGLEKMRNVEFMRQPVC 424          
BLAST of Microtubule-associated protein 1A vs. TrEMBL
Match: A0A182PJ46 (Uncharacterized protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.696e-26
Identity = 112/436 (25.69%), Postives = 192/436 (44.04%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSA---HWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLN--YCVLPIG---PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAF----------LLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKI----NPVC 1472
            NL  +ILI P      + I  L  S   + ++I++ G   +G  S W+L+DG FS    +    E    E   +  A P  I    + A    W+ I              + FS    + +    + +   E  S +      SM++   +   L  S  +G ++ ++   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F++ L+++D ++MT  N  N+ G+ S+++ K       E   +P +   +C +P     P+P  +K+       L ++I  E H+I+  +K+L++      RDA+  P  LY K+G G LD + + P     S   K ++  W   S  Q ++  E       AF          LL+W  +       N E N +TRIL   S  E  +L+ LE+   +     PVC
Sbjct:   41 NLVTEILIHPQVNTFIQCIRNLLSS-FTRHRHIIHTGYTFSGNGS-WILQDGTFSVMDFMEAFQEH---EVQRVLRAYPDTITMDIHCAPVGQWHTIQE------------KSFSRLCRLRLNPVDVLESGSERLS-AFVAYLSSMIIPTEISELLESSDVVGNIRFSHP--TLYVFPGGQGDAALFGINGFNMLVDGGFSRKSCFWDFVRHLDRLDAVLMTRINNTNIKGISSVVERK------SEAHVYPQIGHFFCNIPERKGLPSPDGDKD----HDPLLVDILQEGHQIVTNLKSLNLKAQNCYRDAE--PINLYHKVGHGTLDMYVISPA--RDSREVKDFLARW--ASADQRLFTKEAKDGKDFAFPLQNLISICALLVWTPA-------NPEDN-ITRILFPGSAPEYKILEGLEKMKNVEFMRQPVC 432          
BLAST of Microtubule-associated protein 1A vs. TrEMBL
Match: A0A3S3P7D4 (Microtubule-associated protein futsch-like protein (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_08262 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.183e-26
Identity = 130/521 (24.95%), Postives = 236/521 (45.30%), Query Frame = 3
Query:  150 LPSIIPTIKNSKNIGWDNHKKKIDIADKETNLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSAHWNKILST--LKIKETKQDTVRVFSFSSEIPI-GEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDI-KSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWE--KESKCQPIYFDELVKDNAS----------------AFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKINPVC------NTLSGKACEKKIPEK---KSNVSEK---KSTVPLGDKVSTAKKSPPVIDKNK 1610
            + S++  I  +KN   DN   +I +      ++V++L+ P    LK+ +  L  +     K+I++ G    G  S W+L+DGIF          +   +E + ++S S  +I    + A   + ++T     K +K   V++    S + + G  ++ D     F  +L    +S+ + N +L  +  +G ++      + Y+F  G G  SL  ++GF +LID G+   P FW F++ LE++D++M+T  NE NL+GV S LK K           +P++ Y    I    V   +++   ++ L +++     K+L  +K + I   Q  R+  ++P  LY K+G G LD F L P  P  S   + +++ W   KES      F  +  ++AS                  LLIW  +        E +  + R+L   S  +S + + LE+   ++ +C      ++L     EK  P+     +N+ ++   +S  PL  K+ +A    P +D NK
Sbjct:   51 MESVLRNIAVNKNASLDN---EILVQHSTDKMAVEVLLNPQLFTLKQCLKNLLIAPT-GHKHIIHAGYSFTGTGS-WMLQDGIFRFQDFADAFEDKD-VENF-LKSCSSGSITIHLHCAPVGEWITTNFQNQKFSKLANVQLNPADSSLGVQGAAALLDF----FEATL----KSLDIENEMLT-TPIVGNIRFNR--PTLYVFPSGQGDCSLFGVTGFTMLIDGGFTPLPCFWKFVRHLERLDSIMVTRLNESNLWGVSSFLKKKVLQP------IYPHIGYVFCNITEGKVSPTDEMQKDRNELLVSVIDVGQKLLGDLKHVGISPHQCLREPCISPLTLYHKVGHGTLDMFVLSP--PRESRILRDFLQHWSTNKES------FSFVRTNSASQPGQDIAIPISNIMSICCLLIWRPA--------EPNENIVRMLFPGSAPQSRIFEGLEKIKHLDVLCYQSCSRSSLRPMVIEKPKPKSVLDSNNIQQQARLRSVSPLQRKIKSAYPKQPSVDSNK 531          
BLAST of Microtubule-associated protein 1A vs. TrEMBL
Match: A0A182JSF9 (Uncharacterized protein OS=Anopheles christyi OX=43041 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 3.315e-26
Identity = 111/436 (25.46%), Postives = 192/436 (44.04%), Query Frame = 3
Query:  240 NLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSA---HWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAV---LNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLN--YCVLPIG---PNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAF----------LLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKI----NPVC 1472
            NL  +ILI P      + I  L  S   + ++I++ G   +G  S W+L+DG FS         E    E   +  A P  I    + A    W+ I              + FS    + +    + D   E  + +      SM++   +   L  S  +G ++ ++   + Y+F  G G ++L  ++GFN+L+D G+ R   FW+F++ L+++D ++MT  N  N+ G+ S+++ K       E   +P +   +C +P     P+P  +K+    +  L ++I  E H+I+  +K+L++      RDA+  P  LY K+G G LD + + P     S   K ++  W   +  Q ++  E       AF          LL+W  +       N E N +TRIL   S  E  +L+ LE+   +     PVC
Sbjct:   31 NLVTEILIHPQVNTFIQCIRNLLSS-FTRHRHIIHTGYTFSGNGS-WILQDGTFSVMDFTEAFQEH---EVQRVLRAYPDTITMDIHCAPMGQWHTIQE------------KSFSRLCRLRLNPVDVLDSGSEKLN-AFVAYLSSMIIPTEISELLESSDVVGNIRFSHP--TLYVFPGGQGDAALFGINGFNMLVDGGFSRKSCFWDFVRHLDRLDAVLMTRINNTNIKGISSVVERK------SEAHVYPQIGHFFCNIPERKGLPSPDGDKD----RDPLLVDILQEGHQIVTNLKSLNLKAQNCYRDAE--PINLYHKVGHGTLDMYVISPA--RDSREVKDFLARW--AAADQRLFTKEAKDGKDFAFPLQNLISICALLVWTPA-------NPEDN-ITRILFPGSAPEYKILEGLEKMKNVEFMRQPVC 422          
BLAST of Microtubule-associated protein 1A vs. Ensembl Cavefish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 79.7221 bits (195), Expect = 5.166e-14
Identity = 56/173 (32.37%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IG------PNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+LID G +R   FW  ++ L++ID++++T     NL G+  LL+ K    E +EE S  +  Y       + P +G      P  ++  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ K+G G LD F L P
Sbjct:  261 YIFPGGRGDSALFAVNGFNILIDGGSERRSCFWKLVRHLDRIDSILLTHIGADNLPGINGLLQRKI--AEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIE-----EASLTLQYLDKLGIKPEPLFRVVSNT-IEPITLFHKMGVGRLDMFVLNP 425          

HSP 2 Score: 60.077 bits (144), Expect = 5.086e-8
Identity = 40/134 (29.85%), Postives = 61/134 (45.52%), Query Frame = 3
Query: 7401 PAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPG-----LEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF*LCNIEF 7787
            P FY+D+AYIP     + +   V + FF R+RA  Y++ G      E +  VL+  L  + +W      ++V LIP   TE  R W  +   +   LNI + A+    S  +  D + P+         C IEF
Sbjct: 4086 PPFYVDLAYIP----NHCSAKNVDQEFFKRVRASYYVVSGNDPSSGEPSRAVLDALLEGKAQWG---TNLQVTLIPTHDTEVTRDWYQQTHEKQQDLNIMVLAS---SSTVVMQDESFPA---------CKIEF 4200          
BLAST of Microtubule-associated protein 1A vs. Ensembl Cavefish
Match: map1aa (microtubule-associated protein 1Aa [Source:ZFIN;Acc:ZDB-GENE-100426-2])

HSP 1 Score: 73.1738 bits (178), Expect = 4.624e-12
Identity = 59/197 (29.95%), Postives = 95/197 (48.22%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSH--------------PNLNYCVLPIGPNPVKEKEK-LDIKSYLEINIEMESHKILRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQ 1280
            YIF  G G S+L A++GFN+LID G  R   FW  ++ L++ID++++T     N+ G+  LL+ K    E +EE S               P L      + P+ +K  E  L +K  +E     E+   L+ +  L I   PL ++  +  + P  L+ KLG G LD + L P   + S     ++++W   SK +
Sbjct:  264 YIFPGGRGDSALFAVNGFNILIDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNIPGINGLLQRKI--AEQEEEQSQGSNAYGEWMKNLISPELGVVFFNV-PDKLKTSEPTLKVKRSIE-----EASLTLQYLSKLGIRPEPLYRVVSNT-IEPVTLFHKLGVGKLDMYILNPV--KDSKEMHFFMQKWAGNSKAK 449          

HSP 2 Score: 56.9954 bits (136), Expect = 4.091e-7
Identity = 38/134 (28.36%), Postives = 63/134 (47.01%), Query Frame = 3
Query: 7401 PAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPG-----LEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF*LCNIEF 7787
            P  Y+D+AYIP     + +   V + FF R+R+  Y++ G      E +  VL+  L  + +W    + ++V LIP   TE +R+W  +   +   LNI + A+    S  +  D + P+         C IEF
Sbjct: 2487 PLIYVDLAYIP----NHCSAKNVDQEFFKRVRSAYYVVSGNDSSNGEPSRVVLDALLEGKAQWG---SNLQVTLIPTHDTEVMREWYQQTHEKQQELNIMVLAS---SSTVVMQDESFPA---------CKIEF 2601          
BLAST of Microtubule-associated protein 1A vs. Ensembl Cavefish
Match: map1sb (microtubule-associated protein 1S-like [Source:NCBI gene;Acc:103035879])

HSP 1 Score: 67.3958 bits (163), Expect = 2.633e-10
Identity = 104/445 (23.37%), Postives = 191/445 (42.92%), Query Frame = 3
Query:  243 LSVQILIQPT----YKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLN--ETSWIEKYSMESASPINILTPKNSAHW-NKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFD--QEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTE-------NKEE-----LSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHK---ILRQIKALDIPLLQMSR--DAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKES---KCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLE-----EFSKINPVCN 1475
            LS ++++ P+    Y E++  I+     ++ + K +V  G      + + +L+ G FS +         E   +   +  S  P   L+   +  W N +L     K + QD +       +I +    +    + +++F+  L +  +     + +L     +G L+L       YIF  G G  +  A++GFN+L++ G      FW  ++ L+++D++++T     NL G+ SL + K    E       NK+E     L  P L   V    PN +K+ +        + N+   S +    LR ++ L I   Q+ R  +  + P  L+ K+G GCL+ + L P   + S   + ++  W + S   K   I  + LV   A   LL+W+ +     S +E+   + R+L   S  +  +L  LE     EF K   VC+
Sbjct:   91 LSSRVVVNPSGELLYSEIRSLIL-----DSSQHKLLVLAG-QSLEDTGDIILQTGYFSPNHFAQIFEDEEVQSVLNAASASGKPSLTLSCPKTGKWKNSVLG----KHSIQDVI-------DIKVNPLMVLPKMEGLQEFTDHLSQTLEPQSPFD-LLEPPSTVGFLKLCRP--CCYIFPGGRGDCAFFAVNGFNVLVNGGADARSCFWKLVRHLDRVDSVLLTHAGTDNLPGINSLFERKVAELEEDDSSNFNKKEKWLKNLISPELGV-VFFNAPNRLKKLQG-------DPNVLKSSDQAALTLRHLENLKISPEQLLRNSNGSIEPVILFQKMGVGCLELYVLNPI--KRSKEFEAFMHSWPESSPNLKGSEIPLNCLVSICA---LLVWHPA-----SPHEK---IIRVLFPGSTPQGKILDGLEKLKHLEFLKKPVVCS 494          
BLAST of Microtubule-associated protein 1A vs. Ensembl Cavefish
Match: map1sb (microtubule-associated protein 1S-like [Source:NCBI gene;Acc:103035879])

HSP 1 Score: 67.0106 bits (162), Expect = 2.797e-10
Identity = 104/445 (23.37%), Postives = 191/445 (42.92%), Query Frame = 3
Query:  243 LSVQILIQPT----YKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLN--ETSWIEKYSMESASPINILTPKNSAHW-NKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFD--QEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTE-------NKEE-----LSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHK---ILRQIKALDIPLLQMSR--DAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKES---KCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLE-----EFSKINPVCN 1475
            LS ++++ P+    Y E++  I+     ++ + K +V  G      + + +L+ G FS +         E   +   +  S  P   L+   +  W N +L     K + QD +       +I +    +    + +++F+  L +  +     + +L     +G L+L       YIF  G G  +  A++GFN+L++ G      FW  ++ L+++D++++T     NL G+ SL + K    E       NK+E     L  P L   V    PN +K+ +        + N+   S +    LR ++ L I   Q+ R  +  + P  L+ K+G GCL+ + L P   + S   + ++  W + S   K   I  + LV   A   LL+W+ +     S +E+   + R+L   S  +  +L  LE     EF K   VC+
Sbjct:   57 LSSRVVVNPSGELLYSEIRSLIL-----DSSQHKLLVLAG-QSLEDTGDIILQTGYFSPNHFAQIFEDEEVQSVLNAASASGKPSLTLSCPKTGKWKNSVLG----KHSIQDVI-------DIKVNPLMVLPKMEGLQEFTDHLSQTLEPQSPFD-LLEPPSTVGFLKLCRP--CCYIFPGGRGDCAFFAVNGFNVLVNGGADARSCFWKLVRHLDRVDSVLLTHAGTDNLPGINSLFERKVAELEEDDSSNFNKKEKWLKNLISPELGV-VFFNAPNRLKKLQG-------DPNVLKSSDQAALTLRHLENLKISPEQLLRNSNGSIEPVILFQKMGVGCLELYVLNPI--KRSKEFEAFMHSWPESSPNLKGSEIPLNCLVSICA---LLVWHPA-----SPHEK---IIRVLFPGSTPQGKILDGLEKLKHLEFLKKPVVCS 460          
BLAST of Microtubule-associated protein 1A vs. Ensembl Cavefish
Match: map1b (microtubule associated protein 1B [Source:NCBI gene;Acc:103047754])

HSP 1 Score: 66.2402 bits (160), Expect = 5.640e-10
Identity = 25/66 (37.88%), Postives = 44/66 (66.67%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF 941
            YIF  G G S+L A++GFN+L++ G  R   FW  ++ L+++D++++T   + NL G+ S+L+ K 
Sbjct:  267 YIFPGGRGDSALFAVNGFNMLVNGGSNRKACFWKLVRHLDRVDSILLTHIGDDNLPGINSMLQRKI 332          

HSP 2 Score: 58.9214 bits (141), Expect = 1.065e-7
Identity = 38/135 (28.15%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 7398 LPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFE-----VLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF*LCNIEF 7787
             P  Y+D+ YIP     + +   V   FF RIR+  Y++ G +   +     VL+  L  +++W   D  M+V LIP   +E +R+W  E   +   LNI + A+    S  +  D + P+         C IE 
Sbjct: 2070 CPPMYMDLVYIP----NHCSAKNVDAEFFKRIRSSYYVVSGNDQTAQEPSKTVLDALLEGKEQW---DTNMQVTLIPTHDSEVMREWYQETHEKQQNLNIMVLAS---SSTVVMQDESFPA---------CKIEL 2185          
BLAST of Microtubule-associated protein 1A vs. Ensembl Medaka
Match: map1ab (microtubule-associated protein 1A [Source:NCBI gene;Acc:101157288])

HSP 1 Score: 76.2554 bits (186), Expect = 6.384e-13
Identity = 53/168 (31.55%), Postives = 89/168 (52.98%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IGPNPVKEKEKLDI-KSYLEINIEMESHKI-LRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G +R   FW  ++ L++ID++++T     NL G+  LL+ K    E  EE S  ++N        + P +G       EKL + +S L++   +E   + L+ +  L +   PL ++  +  + P  L+ K+G G LD + L P
Sbjct:  286 YIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSMLLTHIGADNLPGINGLLQRKI--AEQDEEHSQGSMNCSDWMKNLISPELGVVFFNVPEKLRMPESNLKVKRSIEEASLTLQYLSKLGVKPEPLFRVVSNT-IEPITLFHKMGVGRLDMYVLNP 450          
BLAST of Microtubule-associated protein 1A vs. Ensembl Medaka
Match: map1ab (microtubule-associated protein 1A [Source:NCBI gene;Acc:101157288])

HSP 1 Score: 75.8702 bits (185), Expect = 6.925e-13
Identity = 53/168 (31.55%), Postives = 89/168 (52.98%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYC------VLP-IGPNPVKEKEKLDI-KSYLEINIEMESHKI-LRQIKALDI---PLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G +R   FW  ++ L++ID++++T     NL G+  LL+ K    E  EE S  ++N        + P +G       EKL + +S L++   +E   + L+ +  L +   PL ++  +  + P  L+ K+G G LD + L P
Sbjct:  171 YIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSMLLTHIGADNLPGINGLLQRKI--AEQDEEHSQGSMNCSDWMKNLISPELGVVFFNVPEKLRMPESNLKVKRSIEEASLTLQYLSKLGVKPEPLFRVVSNT-IEPITLFHKMGVGRLDMYVLNP 335          
BLAST of Microtubule-associated protein 1A vs. Ensembl Medaka
Match: ENSORLT00000035838.1 (microtubule-associated protein 1S [Source:NCBI gene;Acc:101168906])

HSP 1 Score: 73.559 bits (179), Expect = 3.563e-12
Identity = 101/429 (23.54%), Postives = 181/429 (42.19%), Query Frame = 3
Query:  243 LSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINI-------LTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLP-IG------PNPVKEKEKL--DIKSYLEINIEMESHKILRQIKALDIPLLQMSR--DAKLNPHQLYFKLGQGCLDAFPLWPC--SPETSGYSKRYIEEWEKES--KCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKIN 1463
            L +Q+LI PT ++    +  L   E+   K ++  G   A  S + L   G FSA  +   L E    +   +ES+   ++        +  N   W K   TL    + Q  + +     E+    ES+     + F+ SL         +  +L    ++G L+L+      Y+F  GCG  +  A++GF +L+D G      FW  ++ L+++D +++T     NL GV S L+ K    E   EL   +    + P +G      P+ ++E+++   D+     +    ++   L+ +  LDI    M R     + P  L+ K+G G LD + L P   SPE     + ++  W   +  K Q +    L    A   LL+W+ +       +E+   + R+L      +  LL+ LE+   ++
Sbjct:   98 LDIQVLISPTQEQACSEVFALLSRESA-HKLLILAGLT-AEESGDLLFHKGRFSARQLTQILTE----QLLDLESSGSSHLHSKISLTFSCPNVGQWKK---TLLANPSLQGPITLRINPPEVLPAMESL-----QGFT-SLISSTLCPASSFDLLPPPSSVGFLKLSRP--CCYVFPAGCGDCAFFAINGFTVLVDGGSDSQACFWKLVRHLDRVDAVLLTHTGTENLPGVISFLQRKVGEKELTSELKEDSSKKLISPELGVLFFNAPSRLQEEQQCVDDV-----LKSTQQAALTLQLLNKLDIKPQPMFRPQGVPIKPLTLFQKMGVGQLDLYILSPGKNSPEY----ETFMHSWPDGAPLKGQNLPLPVLASVTA---LLVWHPA-----CPHEK---VVRVLFPGVTPQEKLLQGLEKLKGLD 489          
BLAST of Microtubule-associated protein 1A vs. Ensembl Medaka
Match: map1b (microtubule associated protein 1B [Source:NCBI gene;Acc:101156753])

HSP 1 Score: 72.0182 bits (175), Expect = 1.098e-11
Identity = 67/283 (23.67%), Postives = 126/283 (44.52%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKE-ELSHPNLNYCVLPIGPNP----VKEKEKLD-IKSYLEINIEMESHKILRQIKA---LDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWE--------------KESKCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKIN----PVCNTLSGKACEKKIP 1511
            YIF  G G S+L A++GFN+LI+ G  R   FW  ++ L+++D++++T     NL G+ S+L+ K    E ++ + S  N ++    I P+     V   E LD  +    +   +E   + +Q  +   L I  LQ      + P  L+ K+G G LD + L P   + S   + +++ W               KES+    Y   +      + L++W+ +  T        + + R+L   + ++ ++   LE+   ++    PV    S  +  + +P
Sbjct:  259 YIFPGGRGDSALFAVNGFNMLINGGSDRKSCFWKLVRHLDRVDSILLTHIGSDNLPGINSMLQRKIAELEEEQSQGSTANSDWVKNMISPDLGVVFVNFPENLDKPEPNYRVCRTVEEAALTQQFLSRLNLRIEPLQRPVGNTIEPVVLFQKMGVGKLDMYVLNPS--KNSKEMQHFMKHWTGKEKDAISILLPNGKESEFPLSYLTSI------SSLIVWHPANPT--------DKVVRVLFPGNANQDHIFDGLEKLKHLDFLKQPVVTQKSMSSSVQSVP 525          

HSP 2 Score: 57.7658 bits (138), Expect = 2.205e-7
Identity = 32/105 (30.48%), Postives = 52/105 (49.52%), Query Frame = 3
Query: 7398 LPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPG-----LEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAA 7697
             P  Y+D+ YIP     + +   V   FF R+R+  Y++ G      E +  VL+  L  + +W   DN M+V LIP   T+ +R+W  +   +   LNI + A+
Sbjct: 1850 CPPMYMDLVYIP----NHCSAKNVDVEFFKRVRSSYYVVSGSDQMGQEPSRAVLDALLEGKAQW---DNSMQVTLIPTHDTDVMREWYQDSHDKQQELNIMVLAS 1947          
BLAST of Microtubule-associated protein 1A vs. Ensembl Medaka
Match: map1aa (microtubule associated protein 1A [Source:NCBI gene;Acc:101165625])

HSP 1 Score: 69.3218 bits (168), Expect = 7.868e-11
Identity = 52/174 (29.89%), Postives = 83/174 (47.70%), Query Frame = 3
Query:  744 YIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF--------------DSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDI-KSYLEINIEMESHKI-LRQIKALDIPLLQMSRDAK--LNPHQLYFKLGQGCLDAFPLWP 1211
            YIF  G G S+L A++GFN+L+D G +R   FW  ++ L++ID++++T     NL G+  L + K                S+E  + L  P L      +        EKL + +S L++   +E   + L+ +  L I    + R A   + P  L+ KLG G LD + L P
Sbjct:   41 YIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLFQRKVAEREEEKNRGSGSCSSSEWMKNLISPELGIVFFNV-------PEKLRMPESTLKVKRSIEEASLTLQYLNKLGITPEPLHRAASNTIEPITLFHKLGVGKLDMYVLNP 207          
BLAST of Microtubule-associated protein 1A vs. Planmine SMEST
Match: SMESG000014298.1 (SMESG000014298.1)

HSP 1 Score: 3148.61 bits (8162), Expect = 0.000e+0
Identity = 1778/1867 (95.23%), Postives = 1805/1867 (96.68%), Query Frame = 3
Query:   42 MTNFNSCLIVVNNILRELDDNFPKYLSQGLEKLSEILPSIIPTIKNSKNIGWDNHKKKIDIADKETNLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKINPVCNTLSGKACEKKIPEKKSNVSEKKSTVPLGDKVSTAKKSPPVIDKNKEVNKDIQNKSAEKKPLSAXXXXXXXXXXXXSETVTQNASEEKVKQSIEKKAAPKTPVTNVTKKPLNDKLDVCEXXXXXXXXXXXXXXXXXXXXXTAKKTVDKISDKKSELQENKIIKKTLLNEKVVDTNDTKKPLKKSVVNXXXXXXXXXXXXXXXXXXTEKNGETQEIKKTTKKPLHNEKPIEIHEAKKDLKKPSAGKNSEAEPKKIAKKPLPTDKSSEHDANKSTKKTVSSDKAPISDLKKTLKPVKDEALDHKKVPKRPTSDKVSDKLVSNKKPATAKSDIEPKKAKDTKVISKPVKKSDLVHGDKDNIKVVGEVTINKNDLESDLEKVEVVCQPSISLNTDDTLNNIDTSELLGKIEAIGSDSNHIEDEQLLITGEKYDLQSTPLSDMITDSPEHPKTEEDVEALKTDALSIDQDLLMTNEEFPEDDKAAHFLNDGILECNVKNKVDDNSVGELNEFLVNENLKQYGIYEDGEFEDEHNFGHLDDSHGMHDGISEIEKERINLGNVAGNIDEINESRHQDNILTLDNEEFVSENIDISEDSIKESENEVIQHSPVNENENVHDSNLLLEEINKLEQFEQQNINPDENNKESFESHNEKDEDESKMXXXXXXXXXXXXXKEMLKIDHINEKINEETSDPYLESDENLIDNENTIHGVHELKESEKDCDEQEIVNQNDQIEEVILENSADLENDDLEIQTQLSEHKVSGEYSEEYLNNDFNENAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRIQLQQKYXXXXXXXXXXXXXXXXVDFQESVNDEKADNANVEEGISSXXXXXXXXXXXXXXXXXYKFRDNVIFDDHNVHKEENAENLHEKNNEEITNEYDIHKNLEEIESGNEMKMQKHQMEEFLNEEIQNTNDLEDDVHDSENNYSDNDHENLKHEVPLEMEAKEFEYPIEIDNIKDITYDDGEDDGKLDINFINKDNFIGNLTENDDIENEDIIHKDYVVQSENEIQLLDENSDVKNEIKFSENNELKNKEFDQGVLDDYSEDNKYLNEDHGDNFEIXXXXXXXXXXXXXXXXXXQIPEYKLKLEDQKEIHDGNLLEDHPIIDLDFNEENSMKEYKNDFDENNLFTPDFKLQVDENNYSEINDSEKVVFHDLLKDFEPENKIKSDEENLEHLKYNLEDEKIYEKSSEDVESEIEMEKIKPVESFEKDYYHSENEDNGETYAKASEDVESKVEMEEIKPVESFEKDNYHSDNEDIEY-----KESEAEIDHNFKEEVEKADEIKTDKIDSEEESDDHKSFDDDIESESK--ISFQETNIF----EIEFEKGN--KENLKVEDNFSVENVESGDTEVNYFLKEDN 5603
            MTNFNSCLIVVNNILRELDDNFPKYLSQGLEKLSEILPSIIPTIKNSKNIGWDNHKKKIDIADKETNLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPI EESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKINPVCNTLSGKACEKKIPEKKSNVSEKKSTVPLGDKVSTAKKS PVIDKNKEVNKDIQNKSAEKKPLSAKVKVLDKKDEKKSETVTQNASEEKVKQSIEKKAAPKTPVTNVTKKPLNDKLDVCEPKKPIKKSLSSEKSSNL EAKTAKKTVDKISDKKSELQENKIIKKTL NEKVVDTNDTKKPLKKSVVNDKHSDISDPKKPSKKSLDTEKNGETQEIKKTTKKPLHNEKPIEIHEAKKDLKKPSAGK+SEAEPKKIAKKPLPTDKSSEHDANKSTKKTVSSDKAPISDLKKTLKPVKDEALDHKKVPKRPTSDKVSDKLVSNKKPATAKSDIEPKKAKDTKVISKPVKKSDLVHGDKDNIKVVGEVTINKNDLESDLEKVEVVCQPSISLNTDDTLNNIDTSELLGKIEAIGSDSNHIEDEQLLITGEKYDLQSTPLSDMITDSPEHPKTEEDVEALKTDALSIDQDLLMTNEEFPEDDK AHFLNDGILECNVKNKVDDNSVGELNEFLVNENLKQYGIYEDGEFEDEHNFGHLDDSHGMHDGISEIEKERINLGNVA NIDEINESRHQDNILTLDNEEFVSENIDISEDSIKESENEVIQHSPVNENENVHDSNLLLEEINKLEQFEQQNIN DENNKESFESHNEKDEDESKMEIDNEIIQDIIDNKEMLKIDHINEKINEETSDPYLESDENLIDNENTIHGVHELKESEKDCDEQEIVNQNDQIEEVILENS DLENDDLEIQTQLSEHKVSGEYSEEYLNNDFNENAVSNDNLELLE+EVKKEKFDEKEIEKDFEIDSENRIQLQQKYIEESSNEEIENKNNLEVDFQESVNDEKADNANVEEGISSDLNEEHEDNLDEVLHDEYKFRDNVIFDDHNVHKEENAENLHEKNNEEITNEYDIHKNLEEIESGNEMKMQKHQMEEFLNEEIQNTNDLEDDVHDSENNYSDNDHENLKHEVPLEMEAKEFEYPIEIDNIKDITYDDGEDDGKLDINFINKDNFIGNLTENDDIENED IHKDYVVQSENEIQLLDENSDVKNEIKFSENNELKNKEFDQGVLDDYSEDNKYLNED GDNFEIEKELENSNKDSKNNS+DDQIPEYKLKLEDQKEIHDGNLLEDHPIIDLDFNEENSMKEYKNDFDENNLFTPDFKLQVDENNYSEINDSEKVVFHDLLKDFEPENKIKSDEENLEHLKYNLEDEKIYEKSSEDVESEIEMEKIKPVESFEKDYYHSENEDNGETYAKASEDVE KVEMEEIKPVESFEKD YHSDNEDIEY     KES+ EID NFKEE+   D  + D   S+ E  ++K  D+ I+   K   +F++ N      +IE++K +  + N +++DNF  E V++ + +  +   EDN
Sbjct:    1 MTNFNSCLIVVNNILRELDDNFPKYLSQGLEKLSEILPSIIPTIKNSKNIGWDNHKKKIDIADKETNLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIDEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKINPVCNTLSGKACEKKIPEKKSNVSEKKSTVPLGDKVSTAKKSAPVIDKNKEVNKDIQNKSAEKKPLSAKVKVLDKKDEKKSETVTQNASEEKVKQSIEKKAAPKTPVTNVTKKPLNDKLDVCEPKKPIKKSLSSEKSSNLTEAKTAKKTVDKISDKKSELQENKIIKKTLPNEKVVDTNDTKKPLKKSVVNDKHSDISDPKKPSKKSLDTEKNGETQEIKKTTKKPLHNEKPIEIHEAKKDLKKPSAGKSSEAEPKKIAKKPLPTDKSSEHDANKSTKKTVSSDKAPISDLKKTLKPVKDEALDHKKVPKRPTSDKVSDKLVSNKKPATAKSDIEPKKAKDTKVISKPVKKSDLVHGDKDNIKVVGEVTINKNDLESDLEKVEVVCQPSISLNTDDTLNNIDTSELLGKIEAIGSDSNHIEDEQLLITGEKYDLQSTPLSDMITDSPEHPKTEEDVEALKTDALSIDQDLLMTNEEFPEDDKVAHFLNDGILECNVKNKVDDNSVGELNEFLVNENLKQYGIYEDGEFEDEHNFGHLDDSHGMHDGISEIEKERINLGNVADNIDEINESRHQDNILTLDNEEFVSENIDISEDSIKESENEVIQHSPVNENENVHDSNLLLEEINKLEQFEQQNINTDENNKESFESHNEKDEDESKMEIDNEIIQDIIDNKEMLKIDHINEKINEETSDPYLESDENLIDNENTIHGVHELKESEKDCDEQEIVNQNDQIEEVILENSTDLENDDLEIQTQLSEHKVSGEYSEEYLNNDFNENAVSNDNLELLEDEVKKEKFDEKEIEKDFEIDSENRIQLQQKYIEESSNEEIENKNNLEVDFQESVNDEKADNANVEEGISSDLNEEHEDNLDEVLHDEYKFRDNVIFDDHNVHKEENAENLHEKNNEEITNEYDIHKNLEEIESGNEMKMQKHQMEEFLNEEIQNTNDLEDDVHDSENNYSDNDHENLKHEVPLEMEAKEFEYPIEIDNIKDITYDDGEDDGKLDINFINKDNFIGNLTENDDIENEDNIHKDYVVQSENEIQLLDENSDVKNEIKFSENNELKNKEFDQGVLDDYSEDNKYLNEDDGDNFEIEKELENSNKDSKNNSMDDQIPEYKLKLEDQKEIHDGNLLEDHPIIDLDFNEENSMKEYKNDFDENNLFTPDFKLQVDENNYSEINDSEKVVFHDLLKDFEPENKIKSDEENLEHLKYNLEDEKIYEKSSEDVESEIEMEKIKPVESFEKDYYHSENEDNGETYAKASEDVERKVEMEEIKPVESFEKDYYHSDNEDIEYKKSDIKESDEEIDDNFKEEI--VDNFEKDNCHSDNEDIEYKKSDEVIDDNLKEVDNFEKDNCHSDNEDIEYKKSDIKESNEEIDDNFKEEGVDNSEKDNRHSKNEDN 1865          

HSP 2 Score: 1566.21 bits (4054), Expect = 0.000e+0
Identity = 854/871 (98.05%), Postives = 861/871 (98.85%), Query Frame = 3
Query: 5154 VESFEKDYYHSENEDNGETYAKASEDVESKVEMEEIKPVESFEKDNYHSDNEDIEYKESEAEIDHNFKEEVEKADEIKTDKIDSEEESDDHKSFDDDIESESKISFQETNIFEIEFEKGNKENLKVEDNFSVENVESGDTEVNYFLKEDNKIDSICFGKTEELEENAKEFVEHVKSEIEHEQADESNFSPKPFHDYDTFEDNNESELRSNQNQRDDNQLDIFENNEINSTDVIHPXXXXXXXXXXXXXXXXXXXXXXHDVENSEEMDYIKECDEKDELSENKNASEDGDSEGIEEKFENGNLQSNILNQHEIEHNSEQLDNDFDDYGNQITTDELENEIVKSHNEEENLESKYDETEVNVPDEKSNRHSSTSLNDENHNSPLDTDIADTNLIERPNSLVVDNFQNLEDLVNVQADSASSENHLETDRIMPDSESNDSDLSVDIVKDHTSDGAKDSEQSTFTQPMSALDDIIEDYSPVSPLLHENTELHTHDLDTTMQESPVEEDTYVGKELDNSHPDKEFDSTNLNITPDILRGLKHLNLSEPTXXXXXXXXXXXXXXNYQTSNVLDSDEMSPPETTAAPYGISGRDSVTSGESVHALSPTENIDEEHINKSYKPDHDNLIGSVNGNHHYEQYPESNSTSTSHWNEPLGLPMPTLLNSKPSTKPPADKNSSHITSAKLKSTHATPPKVNGTQSNNVSASAHKATDSHKGVXXXXXXXXXXXXXXXXTGIXXXXXXXXXXXXEIIDQSKLPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 7766
            VE+FEKD Y SEN+DN E Y K++EDVESKVEMEEIKPVESFEKDNYHSDNEDIEYKESEAEIDHNFKEEVEKADEIKTDKIDSEEESDDHKSFDDDIESESKISFQETNIFEIEFEKGNKENLKVEDNFSVENVESGDTEVNYF+KEDNKIDSICFGKTEELEENAKEFVEHVKSEIEHEQADESNFSPKPFHDYD FEDNNESELRSNQNQRDDNQLDIFENNEINSTDVIHPSDSKNDSDIENNDDENDGEMIIHDVENSEEMD +KEC+EKDELSENKNASEDGDSEGIEEKFENGNLQSNILNQHEIEHNSEQLDNDFDDYGNQITTDELENEIVKSHNEEENLESKYDETEVNVPDEKSNRHSSTSLNDENHNSPLDTDIADTNLIERPNSLVVDNFQNLEDLVNVQADSASSENHLETDRIMPDSESNDSDLSVDIVKDHTSD AKDSEQSTFTQPMSALDDIIEDYSPVSPLLHENTELHTHDLDTTMQESPVEEDTYVGKELDNSHPDKEFDSTNLNITPDILRGLKHLNLSEPTEVEVEQVIEDEEIINYQTSNVLDSDEM PPETTAAPYGISGRDSVTSGESVHALSPTENIDEEHINKSYKPDHDNLIGSVNGNHHYEQYPESNSTSTSHWNEPLGLPMPTLLNSKPSTKPPADKNSSHITSAKLKSTHATPPKVNGTQSNNVSASAHKATDS KGVSSPHHSLPPKPSAPKSTGISKSTPTKPAKKPEIIDQSKLPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF
Sbjct: 1987 VENFEKDNYDSENDDNEENYDKSAEDVESKVEMEEIKPVESFEKDNYHSDNEDIEYKESEAEIDHNFKEEVEKADEIKTDKIDSEEESDDHKSFDDDIESESKISFQETNIFEIEFEKGNKENLKVEDNFSVENVESGDTEVNYFVKEDNKIDSICFGKTEELEENAKEFVEHVKSEIEHEQADESNFSPKPFHDYDKFEDNNESELRSNQNQRDDNQLDIFENNEINSTDVIHPSDSKNDSDIENNDDENDGEMIIHDVENSEEMDSLKECEEKDELSENKNASEDGDSEGIEEKFENGNLQSNILNQHEIEHNSEQLDNDFDDYGNQITTDELENEIVKSHNEEENLESKYDETEVNVPDEKSNRHSSTSLNDENHNSPLDTDIADTNLIERPNSLVVDNFQNLEDLVNVQADSASSENHLETDRIMPDSESNDSDLSVDIVKDHTSDAAKDSEQSTFTQPMSALDDIIEDYSPVSPLLHENTELHTHDLDTTMQESPVEEDTYVGKELDNSHPDKEFDSTNLNITPDILRGLKHLNLSEPTEVEVEQVIEDEEIINYQTSNVLDSDEMFPPETTAAPYGISGRDSVTSGESVHALSPTENIDEEHINKSYKPDHDNLIGSVNGNHHYEQYPESNSTSTSHWNEPLGLPMPTLLNSKPSTKPPADKNSSHITSAKLKSTHATPPKVNGTQSNNVSASAHKATDSPKGVSSPHHSLPPKPSAPKSTGISKSTPTKPAKKPEIIDQSKLPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRIDF 2857          
BLAST of Microtubule-associated protein 1A vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 158.688 bits (400), Expect = 5.074e-38
Identity = 126/472 (26.69%), Postives = 229/472 (48.52%), Query Frame = 3
Query:  117 LSQGLEKLSEILPSIIPTIKNSKNIGWDNHKKKID------IADKETNLSVQILIQPTYKELKEAIIYLTDSENIKEKYIVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEI--------PIGEESI-FDQEIEDF-SKSLYEKFQSML-VNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLTRILISSSCHESYLLKSLEEFSKINPVCNTL 1481
            LS    +L +I+ +++  IK S ++ ++ + + ++      +   E+N  VQ+L++PTY+ +  AI  +  +  + E +++Y+G   +  S+ W   DGIFS  +M   L          M     ++++  + S  W +  S     +  QD  + F+FS            +G+  + F   IED    S+ + +  +L + N V++ + N   L L+N+           G SSL++++GFNL+ID     +P  +N+ + L KIDT ++TSWN  N FG  ++LK    S+          + Y +LP        K ++   +   +++    ++I+ Q+K  D  L Q   + K   ++L++KLG G L  F ++P + +     K   + WE   +     F++L+ D++ A L IW        S++++   L RIL+SS CHE  L+KSL  FSK + + NT 
Sbjct:   14 LSPDNSELRKIIKNVLSHIKISCDLSFEEYSQSVNSNENSVLWTSESN-EVQLLLRPTYQNVASAIYRMFSNRFLHEIHLIYIGITISESSNYWAFPDGIFSTFSMENILENIRQTVPEKMSKNVHMHLI--EKSKCWTEFSS-----KNHQD--KDFNFSVNFQFHDHEKKTLGKSDVNFITVIEDLIVSSMNQNYPELLSIANNVMSNNPNQINLLLSNQ---------LMGSSSLISVAGFNLVIDCPNFSSPFCYNYFKNLPKIDTFVLTSWNFKNTFGFYNMLKCNLMSS----------IGYFILPPANQKPYTKSEITPNNLFSVDMRNMINEIMIQVKKSDSSLSQPLAEVK-KSYKLFYKLGAGTLQMFCIFPPTKDLYKPLKSLYDAWENNKETS--LFEKLLCDSSLASLFIW--------SSDDKQKPL-RILVSSCCHELTLIKSLANFSKTDSLLNTF 444          

HSP 2 Score: 107.842 bits (268), Expect = 1.267e-22
Identity = 47/119 (39.50%), Postives = 73/119 (61.34%), Query Frame = 3
Query: 7404 AFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEVLETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIGAAVEHCSVSLGGDNTMPSIAHRI 7760
             +YLD+AY+PVD  GNV  +RVS+ FF+++RA  YILPGLEH+ +VL + +  + KW   D +M+  +I +  T  L+KW  E+A +LS LNI       H  ++   +N + ++   I
Sbjct: 3971 GYYLDIAYVPVDITGNVDSSRVSDRFFSKVRANCYILPGLEHDAKVLNSIIIGKSKWNNKDKQMKTHIIVMNNTSELKKWLLENAVKLSELNI-------HFDITTEQENGLTNVCKHI 4082          
BLAST of Microtubule-associated protein 1A vs. Planmine SMEST
Match: SMESG000030021.1 (SMESG000030021.1)

HSP 1 Score: 71.633 bits (174), Expect = 7.468e-12
Identity = 91/378 (24.07%), Postives = 165/378 (43.65%), Query Frame = 3
Query:  285 KEAIIYLTDSENIKEKYIV--YVGSHGAGYSSNWLLEDGIFSAHTMLTTLN-ETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQL---TNKNGSFYIF-DEGCGQS-SLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLP-----IGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDA------------KLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKD--NASAFLLIW 1337
            K+ II   D E +K   ++  YVG     +   W+L DGIF+++ + + LN +   IE+        + ++TP     W  I       E KQ  +  FS       G E     E + F   +     ++L   ++     N G  QL   T +  S Y+F D+G     +LL L GF ++ + G+ R  E+  +++  ++ID  +M+     NL G+++     + STE   ++    +N+  +P     I   P   + +    +   +++  +   +L Q+KA     +Q+S  A            ++ P QL+ K+G G L+  PL  C  E     K++ ++W+K   C     D L K   +++  L++W
Sbjct:   70 KDGIINSID-EGLKSDNLILLYVGEVTVPFG-QWILHDGIFNSNNLHSILNGDHQKIERN-------VVLVTPLPCEDWQVI-------EKKQ--LPYFSL-----CGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDA-----YASTE--RDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGA--MQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPL--CPFEEDVEMKKFHDDWKKSKYCN----DSLAKSLPSSATVLMVW 409          
The following BLAST results are available for this feature:
BLAST of Microtubule-associated protein 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP1B3.402e-1126.74microtubule associated protein 1B [Source:HGNC Sym... [more]
MAP1B3.773e-1126.74microtubule associated protein 1B [Source:HGNC Sym... [more]
MAP1B3.890e-1126.56microtubule associated protein 1B [Source:HGNC Sym... [more]
MAP1A1.528e-1031.21microtubule associated protein 1A [Source:HGNC Sym... [more]
MAP1A1.719e-1031.21microtubule associated protein 1A [Source:HGNC Sym... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
futsch1.318e-1924.23gene:FBgn0259108 transcript:FBtr0307597[more]
futsch1.318e-1924.23gene:FBgn0259108 transcript:FBtr0307598[more]
futsch1.318e-1924.23gene:FBgn0259108 transcript:FBtr0112628[more]
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1ab1.066e-1325.89microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1ab1.066e-1325.89microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1ab1.384e-1332.37microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1ab1.421e-1332.37microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1ab1.421e-1332.37microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MAP1A1.773e-1131.21microtubule associated protein 1A [Source:NCBI gen... [more]
MAP1A1.826e-1131.21microtubule associated protein 1A [Source:NCBI gen... [more]
pcbp22.618e-1125.99poly(rC) binding protein 2 [Source:Xenbase;Acc:XB-... [more]
MAP1S6.628e-824.49microtubule associated protein 1S [Source:NCBI gen... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Map1b1.941e-1127.94microtubule-associated protein 1B [Source:MGI Symb... [more]
Map1a3.364e-1030.81microtubule-associated protein 1 A [Source:MGI Sym... [more]
Map1a4.151e-1030.81microtubule-associated protein 1 A [Source:MGI Sym... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W596|FUTSC_DROME1.321e-1824.23Microtubule-associated protein futsch OS=Drosophil... [more]
sp|P14873|MAP1B_MOUSE1.358e-1027.94Microtubule-associated protein 1B OS=Mus musculus ... [more]
sp|P14401|ENP2_TETCF1.614e-1028.57Electromotor neuron-associated protein 2 (Fragment... [more]
sp|P46821|MAP1B_HUMAN1.634e-1026.74Microtubule-associated protein 1B OS=Homo sapiens ... [more]
sp|P15205|MAP1B_RAT1.998e-1027.05Microtubule-associated protein 1B OS=Rattus norveg... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4VRG55.289e-2724.94Putative microtubule-associated protein futsch (Fr... [more]
A0A182Q9U61.618e-2625.69Uncharacterized protein OS=Anopheles farauti OX=69... [more]
A0A182PJ461.696e-2625.69Uncharacterized protein OS=Anopheles epiroticus OX... [more]
A0A3S3P7D43.183e-2624.95Microtubule-associated protein futsch-like protein... [more]
A0A182JSF93.315e-2625.46Uncharacterized protein OS=Anopheles christyi OX=4... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1ab5.166e-1432.37microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1aa4.624e-1229.95microtubule-associated protein 1Aa [Source:ZFIN;Ac... [more]
map1sb2.633e-1023.37microtubule-associated protein 1S-like [Source:NCB... [more]
map1sb2.797e-1023.37microtubule-associated protein 1S-like [Source:NCB... [more]
map1b5.640e-1037.88microtubule associated protein 1B [Source:NCBI gen... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1ab6.384e-1331.55microtubule-associated protein 1A [Source:NCBI gen... [more]
map1ab6.925e-1331.55microtubule-associated protein 1A [Source:NCBI gen... [more]
ENSORLT00000035838.13.563e-1223.54microtubule-associated protein 1S [Source:NCBI gen... [more]
map1b1.098e-1123.67microtubule associated protein 1B [Source:NCBI gen... [more]
map1aa7.868e-1129.89microtubule associated protein 1A [Source:NCBI gen... [more]
back to top
BLAST of Microtubule-associated protein 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014298.10.000e+095.23SMESG000014298.1[more]
SMESG000064314.15.074e-3826.69SMESG000064314.1[more]
SMESG000030021.17.468e-1224.07SMESG000030021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033594 ID=SMED30033594|Name=Microtubule-associated protein 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=7984bp
TTTAGTCAAACAATTCAACTGAGAAGCATCATTGTTTAAAAATGACTAAT
TTCAATTCATGTCTAATAGTAGTTAACAATATTTTACGAGAACTTGATGA
TAATTTTCCAAAGTATTTGTCACAAGGTTTAGAGAAACTGTCGGAAATTT
TACCAAGCATCATTCCAACAATAAAAAATTCAAAAAATATTGGTTGGGAC
AATCACAAAAAAAAAATCGACATCGCTGATAAAGAAACAAATCTCAGTGT
TCAAATTTTAATACAGCCGACATATAAAGAACTGAAAGAGGCGATTATTT
ATCTCACAGACAGTGAAAATATCAAAGAAAAGTATATTGTTTATGTCGGT
AGCCATGGAGCGGGCTATTCTTCGAATTGGTTATTGGAAGATGGTATTTT
TTCAGCTCATACCATGCTCACTACTCTAAATGAAACTTCGTGGATCGAAA
AATATTCCATGGAATCTGCATCACCAATTAACATTCTAACTCCTAAAAAT
TCTGCTCACTGGAATAAAATTCTATCGACATTGAAAATAAAAGAAACAAA
ACAAGACACAGTTCGAGTGTTTTCATTTTCATCCGAAATTCCAATTGGTG
AAGAATCGATATTTGATCAAGAAATAGAAGATTTCAGTAAATCACTATAT
GAAAAGTTTCAGTCAATGTTAGTTAATAACGCTGTTCTCAACTGTTCCCA
AAATATTGGAACTCTTCAGTTAACCAATAAAAACGGATCATTTTATATTT
TTGACGAAGGGTGTGGTCAGAGTAGTTTGCTGGCACTAAGTGGATTTAAC
CTATTAATCGACACTGGTTACAAAAGAACTCCTGAATTCTGGAATTTCCT
GCAAAAACTAGAAAAAATCGATACATTAATGATGACATCATGGAACGAAT
TTAATCTTTTTGGAGTGGAAAGTTTATTGAAATTCAAATTCGATTCTACT
GAAAATAAAGAGGAACTTAGCCATCCCAATCTAAATTATTGTGTCTTACC
GATTGGTCCCAATCCTGTTAAAGAAAAAGAAAAATTGGATATCAAATCTT
ATCTTGAAATTAATATTGAAATGGAATCCCACAAAATTCTCAGACAAATA
AAGGCTTTAGATATACCGCTTTTACAGATGTCTCGTGATGCAAAGTTAAA
TCCACACCAATTGTATTTTAAATTAGGCCAAGGTTGTCTAGATGCCTTTC
CATTGTGGCCTTGCAGTCCTGAAACTTCAGGATATTCTAAAAGATATATC
GAAGAATGGGAAAAAGAATCAAAATGTCAGCCTATTTATTTCGATGAACT
AGTCAAAGATAATGCTAGTGCTTTCTTGCTCATTTGGAATGGATCGAAAG
TAACGACGGAATCTACAAATGAAGAATCAAATTTGCTTACTAGAATTCTA
ATCAGTAGTAGCTGTCACGAGTCATATTTATTAAAGTCCTTGGAAGAATT
TTCAAAAATTAATCCTGTTTGCAATACTCTTTCAGGAAAAGCATGTGAAA
AGAAAATTCCAGAAAAAAAATCAAATGTTTCTGAAAAGAAAAGTACAGTT
CCATTAGGTGATAAAGTAAGCACAGCGAAAAAGTCGCCACCGGTGATCGA
TAAAAATAAAGAAGTAAATAAAGATATTCAAAACAAATCAGCTGAAAAAA
AGCCACTTTCTGCGAAAGTAAAGGTATTGGATAAAAAGGATGAAAAGAAA
AGTGAAACTGTTACACAAAATGCTTCAGAAGAAAAAGTGAAACAAAGCAT
TGAAAAGAAAGCTGCTCCTAAAACTCCTGTAACAAATGTCACAAAGAAAC
CATTAAATGACAAACTAGATGTATGCGAACCCAAAAAACCAATCAAAAAA
TCTCTTTCGTCGGAAAAAAGTTCAAATTTAGCAGAAGCTAAAACTGCGAA
AAAAACCGTTGATAAAATATCTGATAAAAAATCCGAATTACAAGAAAACA
AAATTATTAAGAAAACTTTGCTAAATGAGAAAGTTGTTGATACAAATGAT
ACGAAGAAACCATTGAAGAAATCAGTGGTAAATGACAAGCATTCAGACAT
TAGCGATCCAAAGAAACCTTCCAAAAAATCTTTAGACACTGAGAAAAACG
GTGAAACACAAGAAATCAAGAAAACAACAAAGAAGCCTTTACATAATGAA
AAACCAATTGAAATACACGAAGCTAAAAAGGACCTCAAAAAGCCTTCGGC
CGGTAAAAATTCAGAGGCAGAACCTAAAAAGATTGCAAAAAAGCCATTGC
CTACCGACAAAAGTTCAGAGCATGATGCTAACAAATCTACAAAAAAGACC
GTTTCAAGTGATAAGGCTCCTATCTCTGATTTGAAAAAAACACTCAAGCC
AGTCAAAGATGAGGCATTAGATCATAAAAAAGTACCCAAACGACCTACAT
CAGACAAAGTATCCGATAAGCTTGTTTCAAATAAAAAGCCTGCTACTGCA
AAATCAGATATTGAACCTAAAAAAGCTAAAGATACTAAGGTAATATCAAA
ACCTGTTAAAAAGAGTGATTTAGTTCATGGTGATAAGGATAATATTAAAG
TTGTTGGCGAAGTAACTATAAACAAAAATGATCTGGAAAGTGATTTGGAA
AAAGTCGAAGTTGTATGTCAGCCTTCTATTAGTTTAAATACGGATGATAC
TCTGAATAATATTGACACTTCGGAATTACTTGGTAAAATAGAAGCCATTG
GATCCGATAGTAATCACATTGAAGACGAACAATTATTAATAACCGGTGAA
AAATATGATCTTCAAAGCACTCCATTATCAGATATGATTACTGATAGTCC
TGAGCATCCTAAAACGGAAGAAGACGTCGAAGCATTGAAAACAGATGCCC
TATCCATTGATCAAGATTTATTAATGACAAATGAAGAATTTCCCGAAGAC
GATAAGGCCGCTCATTTCCTCAATGATGGTATCTTAGAATGTAATGTAAA
AAATAAAGTTGATGATAACAGCGTTGGAGAATTAAACGAATTTTTAGTGA
ATGAAAATTTGAAACAGTATGGCATATATGAAGATGGTGAATTTGAGGAT
GAACATAATTTTGGACATTTAGATGATTCTCATGGTATGCACGATGGAAT
TTCTGAAATCGAGAAAGAGAGAATAAATCTAGGAAATGTTGCTGGTAACA
TAGATGAAATAAATGAAAGTCGTCATCAAGATAACATTTTAACATTGGAC
AATGAAGAATTTGTTTCCGAAAACATTGATATTAGTGAAGATAGTATAAA
GGAATCAGAGAATGAAGTAATTCAACATTCACCTGTCAATGAAAATGAAA
ATGTTCACGATTCCAATTTATTATTAGAAGAAATCAATAAGTTAGAACAA
TTTGAGCAGCAAAATATCAATCCCGATGAAAATAATAAAGAATCTTTTGA
AAGTCACAATGAAAAGGATGAAGATGAAAGTAAAATGGAAATAGACAACG
AAATTATACAGGATATTATTGATAATAAAGAGATGTTGAAAATTGATCAC
ATCAATGAAAAAATTAATGAAGAGACTTCTGATCCTTACTTGGAAAGTGA
CGAAAATCTAATTGATAATGAGAATACGATTCACGGTGTTCATGAATTGA
AAGAGTCTGAAAAAGATTGTGATGAACAAGAAATAGTAAATCAAAATGAT
CAAATAGAGGAAGTTATTTTGGAAAATAGCGCGGATCTTGAGAACGATGA
TTTAGAAATCCAAACGCAATTATCAGAACATAAAGTTTCTGGTGAATATT
CTGAGGAATATTTGAATAACGATTTCAACGAAAATGCTGTATCAAATGAT
AATTTGGAATTACTAGAGGAGGAAGTTAAGAAGGAAAAATTTGATGAAAA
AGAAATAGAAAAAGATTTTGAAATCGACTCTGAAAACAGAATACAATTGC
AACAAAAATATATCGAAGAATCTTCAAATGAAGAGATTGAAAATAAAAAT
AATTTGGAAGTTGATTTTCAAGAAAGTGTGAATGATGAAAAAGCCGACAA
TGCAAATGTTGAAGAAGGAATTTCATCTGATTTGAATGAGGAACATGAAG
ATAATTTAGATGAAGTTCTACACGATGAATATAAATTTCGTGACAATGTA
ATATTCGATGATCACAATGTTCACAAAGAAGAAAATGCTGAAAATCTCCA
TGAAAAAAATAATGAAGAAATAACAAACGAATACGATATTCATAAAAATT
TAGAAGAAATTGAATCCGGAAATGAAATGAAAATGCAAAAACATCAAATG
GAAGAATTTTTAAATGAAGAGATTCAAAATACAAATGATTTGGAAGATGA
TGTTCATGATAGTGAAAATAACTATTCTGATAATGATCATGAAAATCTCA
AACATGAGGTACCATTAGAAATGGAAGCAAAAGAATTCGAATATCCTATT
GAAATTGATAATATTAAAGATATAACTTATGATGATGGTGAGGATGATGG
GAAATTAGATATTAATTTCATTAACAAAGATAACTTTATTGGAAATCTCA
CTGAAAACGATGACATCGAGAATGAAGATATTATTCATAAAGATTATGTG
GTTCAATCAGAAAATGAGATTCAATTACTCGATGAAAATTCAGATGTTAA
AAACGAAATAAAATTTTCTGAAAATAATGAATTAAAAAACAAAGAATTTG
ACCAAGGTGTCCTCGATGATTATTCTGAAGATAATAAATATCTTAATGAG
GATCATGGGGACAATTTTGAAATCGAAAAAGAATTAGAAAATTCGAATAA
AGATTCTAAAAATAATTCCATAGATGATCAAATTCCTGAATATAAACTTA
AATTGGAAGATCAAAAGGAAATTCACGATGGAAATTTATTGGAAGATCAT
CCTATAATAGATTTAGATTTTAACGAAGAAAATTCGATGAAAGAATATAA
AAATGATTTTGACGAGAACAATTTATTTACACCAGATTTTAAATTACAAG
TAGACGAAAACAATTATTCTGAAATAAATGATTCTGAGAAAGTAGTTTTT
CACGATCTTCTAAAAGATTTTGAACCAGAAAATAAAATAAAATCCGACGA
AGAAAATTTAGAACATCTAAAATATAATTTGGAAGATGAGAAGATTTATG
AAAAGTCGTCGGAAGATGTGGAAAGTGAAATCGAGATGGAAAAAATTAAA
CCGGTTGAAAGTTTCGAAAAAGATTATTATCATTCTGAAAATGAAGACAA
TGGAGAGACTTATGCTAAGGCGTCTGAAGATGTGGAAAGTAAAGTCGAGA
TGGAAGAAATAAAACCTGTTGAAAGTTTCGAAAAAGATAATTATCATTCT
GATAATGAAGACATTGAATATAAAGAATCGGAAGCAGAAATAGATCATAA
TTTCAAAGAGGAAGTGGAAAAAGCTGACGAAATTAAAACGGATAAAATTG
ATTCAGAAGAAGAGAGCGATGACCACAAGAGTTTTGATGATGATATTGAA
TCCGAAAGTAAGATATCATTTCAGGAGACAAACATTTTTGAAATTGAATT
TGAAAAAGGAAATAAAGAAAACTTAAAAGTGGAAGATAATTTTTCAGTAG
AAAATGTAGAAAGTGGAGACACGGAGGTCAATTATTTTCTGAAAGAAGAT
AATAAAATCGATTCTATATGTTTTGGAAAAACTGAAGAATTAGAAGAAAA
TGCCAAAGAGTTTGTTGAACACGTAAAGAGTGAAATCGAACATGAACAAG
CTGATGAATCTAATTTTAGTCCAAAACCATTTCACGATTATGACACATTT
GAGGATAATAATGAATCAGAATTAAGGTCGAATCAAAACCAACGTGACGA
TAATCAACTAGATATCTTTGAAAATAACGAAATAAATTCCACAGATGTTA
TACATCCTTCCGATTCGAAAAATGACTCTGATATTGAAAATAATGACGAT
GAAAATGATGGGGAAATGATTATTCATGATGTTGAGAATTCTGAAGAAAT
GGATTATATAAAAGAATGTGATGAAAAGGATGAACTATCTGAAAACAAAA
ATGCCAGTGAAGATGGAGATAGTGAAGGCATTGAAGAAAAATTTGAAAAC
GGTAATTTACAATCTAATATCTTAAATCAACATGAAATAGAACACAATTC
TGAGCAATTAGACAATGATTTTGATGATTACGGAAACCAAATCACAACAG
ATGAATTAGAAAATGAAATTGTCAAAAGTCACAATGAAGAGGAAAATTTA
GAAAGCAAATATGATGAAACTGAAGTAAACGTGCCAGACGAGAAATCAAA
TAGACATAGTAGCACTTCTCTAAATGATGAAAATCACAATAGTCCTTTAG
ACACAGACATTGCTGACACTAATCTTATCGAAAGGCCAAACTCTTTGGTA
GTAGACAATTTTCAAAATCTCGAAGATTTAGTTAATGTTCAAGCGGATTC
TGCTTCTTCAGAAAATCACCTAGAAACTGATCGAATTATGCCAGATTCTG
AAAGCAATGACAGTGATCTTAGTGTAGATATTGTTAAAGATCACACATCC
GATGGGGCTAAAGATTCTGAACAAAGTACTTTCACTCAACCGATGTCCGC
TTTAGACGATATAATTGAAGACTATTCACCCGTTTCTCCTTTATTACACG
AAAATACTGAGTTACACACACACGATTTGGATACAACTATGCAAGAGTCT
CCAGTTGAAGAAGACACATATGTTGGAAAAGAATTAGACAATTCACATCC
CGATAAAGAATTCGATTCGACAAATCTAAATATAACTCCAGACATACTCA
GAGGTTTGAAACATCTTAATTTATCAGAACCGACTGAAGTTGAAGTAGAA
CAAGTCATTGAAGACGAAGAAATAATTAACTATCAAACATCAAACGTTCT
CGATTCTGATGAAATGTCTCCACCAGAAACAACAGCAGCACCTTATGGGA
TTAGTGGCAGGGACAGTGTGACATCAGGAGAATCAGTACATGCTCTTTCA
CCGACAGAAAATATTGATGAGGAACATATAAATAAATCTTATAAACCTGA
CCACGATAATTTAATTGGATCCGTAAACGGTAATCATCATTATGAACAAT
ATCCCGAATCAAATTCAACCTCCACGTCTCACTGGAATGAACCATTAGGT
CTTCCGATGCCGACTTTATTAAACTCTAAACCATCAACAAAACCACCTGC
AGACAAAAACTCATCTCATATTACATCAGCTAAATTAAAGTCTACTCATG
CAACTCCACCGAAAGTCAATGGCACCCAATCAAATAATGTTTCTGCATCA
GCTCACAAAGCTACGGATTCACATAAGGGTGTCTCTAGTCCTCACCATAG
TTTACCTCCTAAACCATCGGCTCCCAAGAGCACTGGCATTTCTAAATCAA
CACCAACTAAACCAGCTAAAAAACCAGAAATTATTGATCAAAGCAAACTT
CCAGCTTTTTACCTGGACGTGGCTTATATTCCAGTGGATCAAGATGGTAA
TGTTACTCTGACTAGAGTCAGTGAAGCATTCTTTACTCGAATTAGAGCTC
GTCAGTACATACTTCCCGGTTTAGAGCATAATTTTGAAGTACTGGAAACC
TTTTTGGCATCAAGAAAAAAATGGGCTGAAAGTGACAATGAAATGGAAGT
GAGACTGATTCCTATCAAAATGACAGAAACGTTGAGAAAATGGGCCGGAG
AACACGCGGCAGAATTGTCATTACTCAATATCAAAATCGGTGCCGCAGTA
GAACACTGCTCCGTTAGCCTGGGCGGTGATAACACTATGCCATCCATCGC
TCATAGAATTGATTTTTAACTGTGCAACATTGAATTTATTTTTTTGAGTT
TTTGTTGTATTAATTTTTTTTTGTCATTTACAATATTTAGTTGATCGAAA
AAATGTTCTTAATTGGGAAAGAATTATCGAATATTTGAATTGTCAGTGAC
ACATCCGTTGATAATTTTTATCAATCTTTCTATTATGTTGTGTGTTTATT
TGTATTAAATTGATTTCAAAACACTAATAGTTAA
back to top

protein sequence of SMED30033594-orf-1

>SMED30033594-orf-1 ID=SMED30033594-orf-1|Name=SMED30033594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2576bp
MTNFNSCLIVVNNILRELDDNFPKYLSQGLEKLSEILPSIIPTIKNSKNI
GWDNHKKKIDIADKETNLSVQILIQPTYKELKEAIIYLTDSENIKEKYIV
YVGSHGAGYSSNWLLEDGIFSAHTMLTTLNETSWIEKYSMESASPINILT
PKNSAHWNKILSTLKIKETKQDTVRVFSFSSEIPIGEESIFDQEIEDFSK
SLYEKFQSMLVNNAVLNCSQNIGTLQLTNKNGSFYIFDEGCGQSSLLALS
GFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKF
DSTENKEELSHPNLNYCVLPIGPNPVKEKEKLDIKSYLEINIEMESHKIL
RQIKALDIPLLQMSRDAKLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSK
RYIEEWEKESKCQPIYFDELVKDNASAFLLIWNGSKVTTESTNEESNLLT
RILISSSCHESYLLKSLEEFSKINPVCNTLSGKACEKKIPEKKSNVSEKK
STVPLGDKVSTAKKSPPVIDKNKEVNKDIQNKSAEKKPLSAKVKVLDKKD
EKKSETVTQNASEEKVKQSIEKKAAPKTPVTNVTKKPLNDKLDVCEPKKP
IKKSLSSEKSSNLAEAKTAKKTVDKISDKKSELQENKIIKKTLLNEKVVD
TNDTKKPLKKSVVNDKHSDISDPKKPSKKSLDTEKNGETQEIKKTTKKPL
HNEKPIEIHEAKKDLKKPSAGKNSEAEPKKIAKKPLPTDKSSEHDANKST
KKTVSSDKAPISDLKKTLKPVKDEALDHKKVPKRPTSDKVSDKLVSNKKP
ATAKSDIEPKKAKDTKVISKPVKKSDLVHGDKDNIKVVGEVTINKNDLES
DLEKVEVVCQPSISLNTDDTLNNIDTSELLGKIEAIGSDSNHIEDEQLLI
TGEKYDLQSTPLSDMITDSPEHPKTEEDVEALKTDALSIDQDLLMTNEEF
PEDDKAAHFLNDGILECNVKNKVDDNSVGELNEFLVNENLKQYGIYEDGE
FEDEHNFGHLDDSHGMHDGISEIEKERINLGNVAGNIDEINESRHQDNIL
TLDNEEFVSENIDISEDSIKESENEVIQHSPVNENENVHDSNLLLEEINK
LEQFEQQNINPDENNKESFESHNEKDEDESKMEIDNEIIQDIIDNKEMLK
IDHINEKINEETSDPYLESDENLIDNENTIHGVHELKESEKDCDEQEIVN
QNDQIEEVILENSADLENDDLEIQTQLSEHKVSGEYSEEYLNNDFNENAV
SNDNLELLEEEVKKEKFDEKEIEKDFEIDSENRIQLQQKYIEESSNEEIE
NKNNLEVDFQESVNDEKADNANVEEGISSDLNEEHEDNLDEVLHDEYKFR
DNVIFDDHNVHKEENAENLHEKNNEEITNEYDIHKNLEEIESGNEMKMQK
HQMEEFLNEEIQNTNDLEDDVHDSENNYSDNDHENLKHEVPLEMEAKEFE
YPIEIDNIKDITYDDGEDDGKLDINFINKDNFIGNLTENDDIENEDIIHK
DYVVQSENEIQLLDENSDVKNEIKFSENNELKNKEFDQGVLDDYSEDNKY
LNEDHGDNFEIEKELENSNKDSKNNSIDDQIPEYKLKLEDQKEIHDGNLL
EDHPIIDLDFNEENSMKEYKNDFDENNLFTPDFKLQVDENNYSEINDSEK
VVFHDLLKDFEPENKIKSDEENLEHLKYNLEDEKIYEKSSEDVESEIEME
KIKPVESFEKDYYHSENEDNGETYAKASEDVESKVEMEEIKPVESFEKDN
YHSDNEDIEYKESEAEIDHNFKEEVEKADEIKTDKIDSEEESDDHKSFDD
DIESESKISFQETNIFEIEFEKGNKENLKVEDNFSVENVESGDTEVNYFL
KEDNKIDSICFGKTEELEENAKEFVEHVKSEIEHEQADESNFSPKPFHDY
DTFEDNNESELRSNQNQRDDNQLDIFENNEINSTDVIHPSDSKNDSDIEN
NDDENDGEMIIHDVENSEEMDYIKECDEKDELSENKNASEDGDSEGIEEK
FENGNLQSNILNQHEIEHNSEQLDNDFDDYGNQITTDELENEIVKSHNEE
ENLESKYDETEVNVPDEKSNRHSSTSLNDENHNSPLDTDIADTNLIERPN
SLVVDNFQNLEDLVNVQADSASSENHLETDRIMPDSESNDSDLSVDIVKD
HTSDGAKDSEQSTFTQPMSALDDIIEDYSPVSPLLHENTELHTHDLDTTM
QESPVEEDTYVGKELDNSHPDKEFDSTNLNITPDILRGLKHLNLSEPTEV
EVEQVIEDEEIINYQTSNVLDSDEMSPPETTAAPYGISGRDSVTSGESVH
ALSPTENIDEEHINKSYKPDHDNLIGSVNGNHHYEQYPESNSTSTSHWNE
PLGLPMPTLLNSKPSTKPPADKNSSHITSAKLKSTHATPPKVNGTQSNNV
SASAHKATDSHKGVSSPHHSLPPKPSAPKSTGISKSTPTKPAKKPEIIDQ
SKLPAFYLDVAYIPVDQDGNVTLTRVSEAFFTRIRARQYILPGLEHNFEV
LETFLASRKKWAESDNEMEVRLIPIKMTETLRKWAGEHAAELSLLNIKIG
AAVEHCSVSLGGDNTMPSIAHRIDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026074MAP1
IPR001279Metallo-B-lactamas
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 616..636
NoneNo IPR availableCOILSCoilCoilcoord: 2036..2063
NoneNo IPR availableCOILSCoilCoilcoord: 1407..1427
NoneNo IPR availableCOILSCoilCoilcoord: 1255..1275
NoneNo IPR availableCOILSCoilCoilcoord: 1360..1380
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 803..818
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2364..2446
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2045..2086
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2001..2016
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1918..1939
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2119..2141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1713..1792
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 491..818
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 589..605
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1115..1129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1872..1917
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1955..2000
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2291..2313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1109..1131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 517..572
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1713..1804
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1872..2023
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 614..795
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2364..2415
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2124..2141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2045..2075
NoneNo IPR availablePANTHERPTHR13843:SF12MICROTUBULE-ASSOCIATED PROTEIN FUTSCHcoord: 1899..2568
coord: 33..1432
IPR026074Microtubule associated protein 1PANTHERPTHR13843MICROTUBULE-ASSOCIATED PROTEINcoord: 1899..2568
coord: 33..1432