GCR064

Overview
NameGCR064
Smed IDSMED30033587
Length (bp)1463
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR064 (SMED30033587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR064 (SMED30033587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033587SMESG000014669.1 SmedASXL_007301SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033587SMESG000014669.1 SmedASXL_007302SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033587SMESG000014669.1 dd_Smed_v6_18560_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30033587SMESG000014669.1 dd_Smed_v6_44348_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30033587SMESG000014669.1 dd_Smed_v6_71823_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR064 vs. Ensembl Human
Match: GALR1 (galanin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4132])

HSP 1 Score: 138.658 bits (348), Expect = 3.489e-36
Identity = 96/280 (34.29%), Postives = 144/280 (51.43%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL---LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            K R++TN+ I +L+IADL ++ FCIPF   +Y    W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  RN  LGV  +W L      P+  + G+   R  ++  C            W    D      +  K +    F+F Y LPLL+I   Y K+L   LH +   M++   +  SKK+    V++V+V F   WLP   + L     ++       LFR   I ++CLAY+NS VNPI+YAFLSENFR++++ +  C 
Sbjct:   65 KPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFC------------WEQWPDP-----RHKKAYVVCTFVFGYLLPLLLICFCYAKVLNH-LHKKLKNMSKK--SEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFR---ITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCH 321          
BLAST of GCR064 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 138.658 bits (348), Expect = 9.989e-36
Identity = 108/349 (30.95%), Postives = 175/349 (50.14%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTR-RQSKNDGNDMKTSSMRAIETTQNDVLINCNST 1387
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++      K R+ S ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E +           NS + R   R   +  N +  ++ + I+  Q   L+NC  T
Sbjct:   90 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMF-MATTKYRQGS-IDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSNIEQQ-----------NSTRIRQNTRDHPSTANTVDRTNHQKIDLFQKSSLLNCEHT 404          
BLAST of GCR064 vs. Ensembl Human
Match: GALR2 (galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4133])

HSP 1 Score: 137.117 bits (344), Expect = 2.434e-35
Identity = 101/310 (32.58%), Postives = 169/310 (54.52%), Query Frame = 2
Query:  287 SIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMW---ILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRT---IHIFSNCLAYANSMVNPILYAFLSENFRRSFRDL 1195
            +++VP+LF LI ++G  GN +VL V++   +  ++TN+ I +L +ADL FI  C+PF   IY   GW  G   C+   FLI++T + S +TL  +  DR+LA+ +P+ S  +R+ RN    + ++W   +LF+G  L           R+    N  V + ++           +  +DI          F+F+Y LP+L++ L Y + L R L      +A  + A ++K++VT M++IV   F  CW+P  ++ L   + +F    PL R    + I S+ ++YANS VNPI+YA +S++FR+ FR +
Sbjct:   25 AVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYY--------RQSQLANLTVCHPAW-------SAPRRRAMDI--------CTFVFSYLLPVLVLGLTYARTL-RYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQF----PLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTI 306          
BLAST of GCR064 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 134.035 bits (336), Expect = 3.916e-34
Identity = 103/330 (31.21%), Postives = 165/330 (50.00%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYE---------KTHFSHNRGGSNSFKGRTRRQSKN 1306
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++      K R+ S ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E +         + H S       +   R RRQ  +
Sbjct:   90 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMF-MATTKYRQGS-IDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQRERRQKSD 396          
BLAST of GCR064 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 133.65 bits (335), Expect = 5.386e-34
Identity = 98/323 (30.34%), Postives = 164/323 (50.77%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKT----HFSHNRGGSNSFKGRTRRQS 1300
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++  +      ++  ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E + +      + +   + +   RT  QS
Sbjct:   90 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMA--TTKYRQGSIDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQS 389          
BLAST of GCR064 vs. Ensembl Celegans
Match: npr-9 (Galanin-like G-protein coupled receptor npr-9 [Source:UniProtKB/Swiss-Prot;Acc:Q23497])

HSP 1 Score: 154.066 bits (388), Expect = 2.102e-41
Identity = 106/342 (30.99%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  350 VLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGV-----IKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRL-----------LHGRT-------SKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFD-----VGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSF------------RDLLCCQATQSRVEYEKTHFSHN 1255
            ++V++ F ++MRNSTN LI  LAI+DL F+  C+PFT V Y    W   E  C +  F  + +AYCSV+TL LM  DR+LAVV+P+ S  +R+ RNT + +  ++I+   + +P+    G+     I  ++ +        C+ L +     T           + +F +F +F Y LPL +  +LYG +L +L           + GR        S + +  EA  +K++VT +V+ V++ +A CWLP+   F +    +        G +   + I S  LAY NS +NPILYA +S++FR  F            R   C    +S +  E TH++  
Sbjct:   63 LVVIVAFGRQMRNSTNTLIIGLAISDLMFLLLCVPFTAVDYAAPTWIFPEWTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVESMTLRTPRNTVIALCFIYIIIIASQIPVGRMHGIYVYDFIMEKRST--------CAILTIATAEATP-------TMARTYFMTFNVFGYVLPLGISVVLYGLMLRKLWDMPRPGNSQSVGGRNLTNRDSGSSIRRRPEATAAKRKVTRLVLCVLITWALCWLPLNVCFFMSGLAYPEPLVISHGVIMVIVQIASQVLAYTNSCLNPILYALMSQSFREGFIRVMKMLINKLSRGRFCTNYRRSALRTELTHYNQT 389          
BLAST of GCR064 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 106.686 bits (265), Expect = 9.291e-25
Identity = 93/334 (27.84%), Postives = 163/334 (48.80%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFT---GVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSN------EALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEF--DV---GGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSF-----RDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTR 1291
            +V++VI++ K++R +TNILI +LA+ADL    FCIPF+    +IY  Q W  G   C +  FL  +  + S +TLV++ FDR++A++  ++ ++  + R     V   WI      LPLL  +   +  ++   NC   +  +       D+ +Q        K + +   I  Y +P  ++ + Y  +  ++ + R   M          +  +S K++  MV+++   FA CWLP+  + +  I EF  D+   G  L+  +  F++ LA ++SMVNPI+Y   +  FR  F     + L C    + R+  + T        S SF+ R+R
Sbjct:   70 LVILVIVYFKRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFED-QDGLPNCGENWTYF------GDSGEQ------VRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLPLL-ILINVIPEFYPDINSWGYILY--LWWFAHGLAMSHSMVNPIIYFIRNARFREGFCFFSSKLLPCISFKELRLLTDNT--------SRSFRNRSR 379          
BLAST of GCR064 vs. Ensembl Celegans
Match: npr-24 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q23033])

HSP 1 Score: 103.99 bits (258), Expect = 4.363e-24
Identity = 82/293 (27.99%), Postives = 143/293 (48.81%), Query Frame = 2
Query:  350 VLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQ-GWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKV---NCVVYYCSYLPLVRWNDTTDQYVVDIK----FGKRFFTSF-FIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSV-FLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLL 1198
            VL  I++ + MR  +NI I +LA+ADL F+   IP +        GW  G   C++Y     V+ + S   + ++ FDR+LAV  PI S   R+ +  F   V  WI+      PL L   +IK     +    +C+++  +   L    +  +  + +I+      +RFF S+ F  +Y +PL+ +   Y K++ ++   +     +     K   +VTIM + +++++  CWLP   V + ++   F+    L      F+  L Y NS  NP LY FLS++F+++ + LL
Sbjct:   39 VLAAIVYFRDMRTISNIYIFNLAVADLLFLC-GIPVSLFAQSSHDGWIWGPIMCKLYISGNAVSQFASAVFIAILSFDRYLAVCRPIQSKSFRTTQAAFALSVAAWIMVILEMTPLFLFVKLIKSSSAGEARGGSCMLFVGNVTVLESATEMNETLLNEIEQNMLASRRFFISYTFALSYLIPLVAVWYFYFKIILKMCQRKRQMQTKRTATKKRTTKVTIMGLAIVISYTHCWLPFWIVQWSIEANLFEKSKYLLFCCTHFAFALQYINSAANPFLYVFLSDSFQKNIQKLL 330          
BLAST of GCR064 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 103.99 bits (258), Expect = 6.209e-24
Identity = 90/336 (26.79%), Postives = 161/336 (47.92%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFT---GVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSN------EALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEF--DV---GGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSF-----RDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQ 1297
            +V++VI++ K++R +TNILI +LA+ADL    FCIPF+    +IY  Q W  G   C +  FL  +  + S +TLV++ FDR++A++  ++ ++  + R     V   WI      LPLL  +   +  ++   NC   +  +       D+ +Q        K + +   I  Y +P  ++ + Y  +  ++ + R   M          +  +S K++  MV+++   FA CWLP+  + +  I EF  D+   G  L+  +  F++ LA ++SMVNPI+Y   +  FR  F     + L C    + R+  + T   H     +  +  T + 
Sbjct:   70 LVILVIVYFKRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFED-QDGLPNCGENWTYF------GDSGEQ------VRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLPLL-ILINVIPEFYPDINSWGYILY--LWWFAHGLAMSHSMVNPIIYFIRNARFREGFCFFSSKLLPCISFKELRLLTDNTSRRHRLRDIHEVESLTGKH 389          
BLAST of GCR064 vs. Ensembl Celegans
Match: npr-15 (Neuropeptide receptor 15 [Source:UniProtKB/Swiss-Prot;Acc:Q09638])

HSP 1 Score: 96.2857 bits (238), Expect = 1.205e-21
Identity = 90/321 (28.04%), Postives = 157/321 (48.91%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNST-NILIASLAIADLTFIAFCIP--FTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGK----LLCR----------LLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYE-KTHFSHN 1255
            +V+  I  ++ MR S  NIL+ +LA+ADL  + F IP     V +    W      C + ++L  V  + S+ T +++C +R++A+V P+ +  + S RN  + V+V WI       P  +   V    K+   N + +      L + + T    V    + + +  + F+  YF+P  +I+++Y K    L C+           L  ++S  ++S++AL++++ V  M++  +  +  C+ PIQ +FL +        P +  I +  N LA   S  NP+LY   S+ FRR  RD+L C    S VE E KT++S N
Sbjct:   26 IVIYAIAGDRNMRKSVMNILLLNLAVADLANLIFTIPEWIPPVFFGSTDWLFPSFLCPVCRYLECVFLFASISTQMIVCIERYIAIVLPMQARQLCSRRNVLITVLVDWIFVACFASPYAVWHSV--KTKDRNTNSLRF-----KLFQLSATCSNTVGKSTWWQGYKLTEFLAFYFVPCFIITVVYTKVAKCLWCKDPTLQCETRSCLDNKSS--SRSSDALRTRRNVVKMLIACVAVYFVCYSPIQVIFLSKAVLNVTIHPPYDFI-LLMNALAMTCSASNPLLYTLFSQKFRRRLRDVLYC---PSDVENETKTYYSIN 333          
BLAST of GCR064 vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0333798)

HSP 1 Score: 203.756 bits (517), Expect = 1.798e-60
Identity = 118/288 (40.97%), Postives = 176/288 (61.11%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGV--IKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC 1204
            +V++V++ N++MR++TN+LI +LA++D+ F+ FC+PFT   YV   WP G  +C+  Q++I VT +CSVYTLVLM FDRFLAVVHP++S  +R++RN  L ++  WI    T +P+ L+  V   +    +   CV              +T++ +  +     F  SFF+ +Y  PL +I  LY  +L RL          S E+ K K+RVT MVV+V++AFA CWLPI  + +L+      G  L   I I S+ +AY NS +NPILYAFLS+NFR++FR ++ C
Sbjct:   94 LVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVF-------------STEEEIWSL---VGFQVSFFLSSYVAPLTLICFLYMGMLARLWK-SAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of GCR064 vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0070575)

HSP 1 Score: 203.756 bits (517), Expect = 1.798e-60
Identity = 118/288 (40.97%), Postives = 176/288 (61.11%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGV--IKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC 1204
            +V++V++ N++MR++TN+LI +LA++D+ F+ FC+PFT   YV   WP G  +C+  Q++I VT +CSVYTLVLM FDRFLAVVHP++S  +R++RN  L ++  WI    T +P+ L+  V   +    +   CV              +T++ +  +     F  SFF+ +Y  PL +I  LY  +L RL          S E+ K K+RVT MVV+V++AFA CWLPI  + +L+      G  L   I I S+ +AY NS +NPILYAFLS+NFR++FR ++ C
Sbjct:   94 LVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVF-------------STEEEIWSL---VGFQVSFFLSSYVAPLTLICFLYMGMLARLWK-SAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of GCR064 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0085316)

HSP 1 Score: 195.282 bits (495), Expect = 1.577e-57
Identity = 116/290 (40.00%), Postives = 183/290 (63.10%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFF-TSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFR-TIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQA 1210
            +V++V++FN  MR++TN++I +LA ADL F+  CIPFT   Y+   WP G  +CR  Q+LI VTA+ S+YTLVLM  DRFLAVVHPI S ++R++  T + +V +WI+    ++P+     V+    ++K N     C++        TT+ ++     G R +  +FFI +Y LPL++IS LY +++ RL    T  +  S E+ + +KRVT +VV+V++AFA+ WLP+Q + LL+  +      L +  I + +  LAY++S +NP+LYAFLSENFR++F   + C +
Sbjct:   58 LVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVD-YDAKKNITYGMCTF--------TTNDFL-----GPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTG-VRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSS 332          
BLAST of GCR064 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0336790)

HSP 1 Score: 195.282 bits (495), Expect = 1.577e-57
Identity = 116/290 (40.00%), Postives = 183/290 (63.10%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFF-TSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFR-TIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQA 1210
            +V++V++FN  MR++TN++I +LA ADL F+  CIPFT   Y+   WP G  +CR  Q+LI VTA+ S+YTLVLM  DRFLAVVHPI S ++R++  T + +V +WI+    ++P+     V+    ++K N     C++        TT+ ++     G R +  +FFI +Y LPL++IS LY +++ RL    T  +  S E+ + +KRVT +VV+V++AFA+ WLP+Q + LL+  +      L +  I + +  LAY++S +NP+LYAFLSENFR++F   + C +
Sbjct:   58 LVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVD-YDAKKNITYGMCTF--------TTNDFL-----GPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTG-VRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSS 332          
BLAST of GCR064 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0308641)

HSP 1 Score: 194.512 bits (493), Expect = 1.853e-57
Identity = 121/308 (39.29%), Postives = 187/308 (60.71%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFF-TSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFR-TIHIFSNCLAYANSMVNPILYAFLSENFRRSF------RDLLCCQATQSRVEYEKTHF 1246
            +V++V++FN  MR++TN++I +LA ADL F+  CIPFT   Y+   WP G  +CR  Q+LI VTA+ S+YTLVLM  DRFLAVVHPI S ++R++  T + +V +WI+    ++P+     V+    ++K N     C++        TT+ ++     G R +  +FFI +Y LPL++IS LY +++ RL    T  +  S E+ + +KRVT +VV+V++AFA+ WLP+Q + LL+  +      L +  I + +  LAY++S +NP+LYAFLSENFR++F        L     T   V  EKT +
Sbjct:   58 LVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVD-YDAKKNITYGMCTF--------TTNDFL-----GPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTG-VRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKGLQSNRLGMWTTTHQDVSSEKTTY 350          
BLAST of GCR064 vs. Ensembl Zebrafish
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 155.221 bits (391), Expect = 1.655e-42
Identity = 99/300 (33.00%), Postives = 162/300 (54.00%), Query Frame = 2
Query:  347 MVLVVI--IFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL-LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEK 1237
            +V+VVI  I +++ R++TNI I +L+IADL+F+ FC+PF   IY    W  G   C+   + + V+   S++TLV M  DR++AVV    S  +R+ RN  +GV V+W+L     +P+  +  +    K         +C  +    W +   ++   +        +  +  Y LPLL+I+  Y K+L  L H +   M++ +E  +SK++    V++V+ AF  CW+P   + + ++  +F +    F    I S+CLAY NS VNPILYAFLSENFR++ + +  C+   S    EK
Sbjct:   53 LVMVVIGKIKSRRSRSTTNIFILNLSIADLSFLLFCVPFQATIYSLPEWIFGAFLCKFVHYFVMVSMLVSIFTLVAMSVDRYIAVVLSKKSPCIRNRRNALIGVCVIWMLSFIFAVPVAQHQILTDHPKAPNST----FCWEI----WTERVAKHTYKV--------TILVIGYLLPLLLITCCYAKVLYHL-HKKIKNMSKKSE--RSKRKTAQTVLLVVAAFLICWMPHHIIAMWVEFGQFPLNDASF-AFRIISHCLAYGNSCVNPILYAFLSENFRKACKQVFTCRFFYSPPPVEK 332          
BLAST of GCR064 vs. Ensembl Zebrafish
Match: galr1a (galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-290])

HSP 1 Score: 142.124 bits (357), Expect = 9.277e-38
Identity = 92/278 (33.09%), Postives = 153/278 (55.04%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL-LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            + R++TNI I +L++ADL+++ FCIPF   +Y+   W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  R+  +GV+V+W+L      P+    G+++    S       +C  +    W D   +        K +    F+F Y LPL++IS  Y K+L   LH +   +++   +  SKK+    V++V+V F   WLP   V L ++   F +    F  + + ++CLAY+NS VNP++YAFLSENFR++++ +  CQ
Sbjct:   64 QQRSTTNIFILNLSVADLSYLLFCIPFQSTVYMLPTWILGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYIAIVHCRKSSSIRVARHALIGVLVIWVLSFAMATPVAYYQGIVESEDNST------FCWEV----WPDHDRR--------KIYVVCTFVFGYVLPLILISFCYAKVLNH-LHKKLRNVSKK--SEASKKKTAQTVLVVVVVFCLSWLPHHVVHLWVEFGSFPLNQASF-VLRVAAHCLAYSNSSVNPVIYAFLSENFRQAYKQVFRCQ 319          
BLAST of GCR064 vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 142.124 bits (357), Expect = 2.190e-37
Identity = 105/335 (31.34%), Postives = 177/335 (52.84%), Query Frame = 2
Query:  347 MVLVVIIFNKKMR-NSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFK-GRTRRQSKNDGNDMKTSS 1333
            +VL V++ + ++  N+TN+ I +L++AD  FI FC+PF   IY  +GW  G   C++  F I +T Y S +TL  +  DR+LA+ +P+ S  +R+  N  + +VV+W L           S V  G   S  + + +  S + +  W +  ++ V+D        T  F+F Y +P+L++SL Y + + + L      +   +E+ ++K++VT M++IV V F  CWLP   V L  +Y +F    P  +T + F   S+C+AYANS +NPI+YA +S++FR+ F+ +  C    S+    K H  +       F+ G T     N+ N  +  S
Sbjct:   46 LVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGL-----------SLVFAGPYLSYYDLIDFENSNVCVPGWEE-HNRKVLD--------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDF----PFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC--ILSKKGRNKVHVVNVANTVPGFEAGSTEVSQMNEENARQNES 353          
BLAST of GCR064 vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 142.124 bits (357), Expect = 2.190e-37
Identity = 105/335 (31.34%), Postives = 177/335 (52.84%), Query Frame = 2
Query:  347 MVLVVIIFNKKMR-NSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFK-GRTRRQSKNDGNDMKTSS 1333
            +VL V++ + ++  N+TN+ I +L++AD  FI FC+PF   IY  +GW  G   C++  F I +T Y S +TL  +  DR+LA+ +P+ S  +R+  N  + +VV+W L           S V  G   S  + + +  S + +  W +  ++ V+D        T  F+F Y +P+L++SL Y + + + L      +   +E+ ++K++VT M++IV V F  CWLP   V L  +Y +F    P  +T + F   S+C+AYANS +NPI+YA +S++FR+ F+ +  C    S+    K H  +       F+ G T     N+ N  +  S
Sbjct:   46 LVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGL-----------SLVFAGPYLSYYDLIDFENSNVCVPGWEE-HNRKVLD--------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDF----PFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC--ILSKKGRNKVHVVNVANTVPGFEAGSTEVSQMNEENARQNES 353          
BLAST of GCR064 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 139.813 bits (351), Expect = 1.154e-36
Identity = 109/355 (30.70%), Postives = 166/355 (46.76%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRN-STNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTT---DQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC-------------QATQSRVEYEKTHFSHNRGGSNSFKGRTR-RQSKNDGNDMKTSSMRAIETT 1354
            +VL V+I N +M   STN+ I +L +ADL FI FC+P    IY    W  G   C+   F+IY+T Y S++TL  +  DR+LA+ +P+ S   R+ RN    + ++W L    + P                     Y SY   +  + TT     + V  +      T  FIF Y +P+L++ + Y + + R L      M   +E+ K+K++VT M++IV V F  CWLP   V L   +  F +    +  + I S+ +AYANS +NPI+YA +S++FR+ F+ +  C             Q  Q+    E      +  GSN   G TR R        M TS+      T
Sbjct:   38 LVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSP---------------------YLSYYQQMDLDGTTVCIPAWSVHHRQAMDICT--FIFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTY-VLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGCAFRNRVVNRIHTVQPAQTVSLMEAA----SSEGSNHCDGSTRGRLWSKSSKKMMTSAFMTFNVT 363          
BLAST of GCR064 vs. Ensembl Xenopus
Match: lmod3 (leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414])

HSP 1 Score: 153.68 bits (387), Expect = 8.627e-42
Identity = 103/290 (35.52%), Postives = 157/290 (54.14%), Query Frame = 2
Query:  347 MVLVVIIFNK--KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            +V+ V+  NK  K R++TNI I +L+IADL ++ FCIPF   +YV   W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  RN  +GV+V+WIL      P+  N G++    ++       +C       W +   + +        +    F+F Y LPLL+IS  Y K+L   LH +   M++   +  SKK+    V++V+V F   WLP   + L   Y  F +    F    I ++CLAY+NS VNPI+YAFLSENFR++++ +  CQ
Sbjct:   57 LVITVLARNKPGKPRSTTNIFILNLSIADLAYLLFCIPFQSTVYVLPTWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYVAIVHSRRSSAIRVSRNALVGVIVIWILSIAMASPVAYNQGLVYKNNQT-------FC----WESWPNAQQKRI--------YVVCTFVFGYLLPLLLISFCYAKVLNH-LHKKLRNMSKK--SEASKKKTAQTVLVVVVVFGISWLPHHVIHLWVEYGSFPLTQASF-VFRIVAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQ 323          
BLAST of GCR064 vs. Ensembl Xenopus
Match: lmod3 (leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414])

HSP 1 Score: 153.68 bits (387), Expect = 8.768e-42
Identity = 103/290 (35.52%), Postives = 157/290 (54.14%), Query Frame = 2
Query:  347 MVLVVIIFNK--KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            +V+ V+  NK  K R++TNI I +L+IADL ++ FCIPF   +YV   W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  RN  +GV+V+WIL      P+  N G++    ++       +C       W +   + +        +    F+F Y LPLL+IS  Y K+L   LH +   M++   +  SKK+    V++V+V F   WLP   + L   Y  F +    F    I ++CLAY+NS VNPI+YAFLSENFR++++ +  CQ
Sbjct:   55 LVITVLARNKPGKPRSTTNIFILNLSIADLAYLLFCIPFQSTVYVLPTWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYVAIVHSRRSSAIRVSRNALVGVIVIWILSIAMASPVAYNQGLVYKNNQT-------FC----WESWPNAQQKRI--------YVVCTFVFGYLLPLLLISFCYAKVLNH-LHKKLRNMSKK--SEASKKKTAQTVLVVVVVFGISWLPHHVIHLWVEYGSFPLTQASF-VFRIVAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQ 321          
BLAST of GCR064 vs. Ensembl Xenopus
Match: lmod3 (leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414])

HSP 1 Score: 153.295 bits (386), Expect = 1.193e-41
Identity = 103/290 (35.52%), Postives = 157/290 (54.14%), Query Frame = 2
Query:  347 MVLVVIIFNK--KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            +V+ V+  NK  K R++TNI I +L+IADL ++ FCIPF   +YV   W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  RN  +GV+V+WIL      P+  N G++    ++       +C       W +   + +        +    F+F Y LPLL+IS  Y K+L   LH +   M++   +  SKK+    V++V+V F   WLP   + L   Y  F +    F    I ++CLAY+NS VNPI+YAFLSENFR++++ +  CQ
Sbjct:   55 LVITVLARNKPGKPRSTTNIFILNLSIADLAYLLFCIPFQSTVYVLPTWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYVAIVHSRRSSAIRVSRNALVGVIVIWILSIAMASPVAYNQGLVYKNNQT-------FC----WESWPNAQQKRI--------YVVCTFVFGYLLPLLLISFCYAKVLNH-LHKKLRNMSKK--SEASKKKTAQTVLVVVVVFGISWLPHHVIHLWVEYGSFPLTQASF-VFRIVAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQ 321          
BLAST of GCR064 vs. Ensembl Xenopus
Match: ENSXETT00000041298.1 (galanin receptor 3 [Source:NCBI gene;Acc:100488248])

HSP 1 Score: 153.295 bits (386), Expect = 1.473e-41
Identity = 111/326 (34.05%), Postives = 174/326 (53.37%), Query Frame = 2
Query:  272 EFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMR-NSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMW---ILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSV---FLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVE 1228
            E     I+VP++F LI  LG  GN +VL V++ N + + N+TN+ I +L +ADL FI  C+PF   IY   GW  G   C+   F IY++ Y S +TL  +  DR+LA+ +P+ S  +R+ RN    + V+W   ILF G  L              S  + ++Y    + +  W D   + ++D+        S F+F Y LP+L++ L Y + +C  L      +  ++E+ K+K +VT M++IV V F  CWLP   V   F    + F+     FR +   S+C++YANS +NPI+YA +S++FR+ F+ +  C  TQ R  
Sbjct:   12 ELPPGGIIVPVVFSLIFALGTVGNGLVLAVLLRNGQTKYNTTNLFILNLGVADLCFILLCVPFQATIYTLDGWLFGAFLCKAVHFSIYLSMYASSFTLAAVSVDRYLAIRYPLKSRDLRTSRNALAAIGVIWALSILFAGPYL--------------SYYHIILYNQVPICIPNWEDRRRK-IMDV--------STFVFGYLLPVLILGLSYARTIC-FLWTSVDPVKTASESRKAKHKVTKMIIIVAVLFCICWLPHHLVILCFWFGHFPFNKATYAFRLV---SHCMSYANSCLNPIVYALISKHFRKRFKQVFTCLLTQKRAH 310          
BLAST of GCR064 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 149.443 bits (376), Expect = 4.330e-40
Identity = 114/363 (31.40%), Postives = 194/363 (53.44%), Query Frame = 2
Query:  242 PCNVSTVNIYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVII-FNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY---EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC-QATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGN 1315
            P N S +++  F   SIVVP++F LI +LG  GN +VL V++   ++  N+TN+ I +L++AD++FI FC+PF   IY  + W  G   C+   F IY+T Y S +TL  +  DR+LA+ +P+ S  +R+  N    + ++W L           S V  G   S  + + Y  S++ +  W + T + ++D        T  FI  Y +P+L++SL Y + + + L      +   +E+ K+K++VT M++IV V F  CWLP   V +  +Y    F+     FR   + S+C+AYANS +NPI+YA +S++FR+ F+ +  C    + R +    + +H   G ++        + ++G 
Sbjct:   13 PWNSSDLSL--FSPASIVVPVIFSLIFLLGTVGNSLVLAVLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGL-----------SVVFAGPYLSYYDLMDYESSHICMPGWKERTRK-IMD--------TGTFIVGYVIPVLIVSLSYTRTI-KYLWTAVDPLEDMSESKKAKRKVTKMIIIVTVLFCLCWLPHHVVVMCYLYGDFPFNQATYAFR---LLSHCMAYANSCLNPIVYALVSKHFRKGFQKVFSCLLRKKGRNKVHVVNAAHAEPGFDAASSEMSHINDDNGK 349          
BLAST of GCR064 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 136.346 bits (342), Expect = 2.101e-35
Identity = 107/369 (29.00%), Postives = 182/369 (49.32%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTR-RQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL 1447
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++  +      ++  ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E +           NS + R   R+  +  N +  ++ +  E T+        S  ++ + KE   +  ET+L +
Sbjct:   24 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATT--KYRQGSIDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSTIEQQ-----------NSARIRQNTREHPSTANTVDRTNHQKQEKTKTK------SAWEIWEQKEHTLLLGETHLTI 352          
BLAST of GCR064 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 133.65 bits (335), Expect = 1.310e-34
Identity = 98/333 (29.43%), Postives = 164/333 (49.25%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRA 1342
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++  +      ++  ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E + +  +  R  +           + +    K  S R 
Sbjct:   24 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATT--KYRQGSIDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVRM--LSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSTIEQQNS--ARIRQNTREHPSTANTVDRTNHQKKKLDSQRG 331          
BLAST of GCR064 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 134.035 bits (336), Expect = 2.867e-34
Identity = 102/343 (29.74%), Postives = 172/343 (50.15%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQNDVLI 1372
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++  +      ++  ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E + +     R   N+ +  +   + +  N  K    RA+ T +  + I
Sbjct:   88 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMA--TTKYRQGSIDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSTIEQQNSA----RIRQNTREHPSTANTVDRTNHQKLLMWRAMPTFKRHLAI 403          
BLAST of GCR064 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 134.42 bits (337), Expect = 3.109e-34
Identity = 105/352 (29.83%), Postives = 175/352 (49.72%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTR-RQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKL 1396
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++  +      ++  ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E +           NS + R   R+  +  N +  ++ +A +  Q  +   C S T L
Sbjct:   88 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMA--TTKYRQGSIDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVRM--LSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSTIEQQ-----------NSARIRQNTREHPSTANTVDRTNHQAHQKPQECLKCRCLSLTIL 405          
BLAST of GCR064 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 133.65 bits (335), Expect = 3.967e-34
Identity = 97/329 (29.48%), Postives = 165/329 (50.15%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTS 1330
            +V+ VI+   KM+ +TNI I +LA+AD       +PF  V Y+   WP G   C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP++  +      ++  ++C + +    P   W +     V             FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  ++++      +    F+T+   F   L Y NS +NP+LYAFL ENF+R FR+   C  T S +E + +         +     T  ++ +  N+  +S
Sbjct:   88 LVMYVIVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMA--TTKYRQGSIDCTLTFSH--PTWYWENLLKICV-------------FIFAFIMPVLIITVCYGLMILRLKSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH-IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF--CIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQRNEEPSS 393          
BLAST of GCR064 vs. UniProt/SwissProt
Match: sp|Q8WPA2|AR_BOMMO (Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=AR PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 8.058e-57
Identity = 121/293 (41.30%), Postives = 178/293 (60.75%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFT-SFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQ------IYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC 1204
            +V++V+  N  MR++TN+LI +LA+ADL F+ FC+PFT   YV   WP G+ +C++ Q+ I VTA+ SVYTLVLM  DRF+AVVHPI+S  +R+++N  L +  +W++   T +P+    G+  G +E          SY      N ++  ++ +  + K  F  SFF+ +Y +PL +IS+LY  +L RL          S E+ + +K+VT MVV+V+V FA CW PIQ + L++      I  F V      T  I S+ LAY NS VNP+LYAFLSENFR +FR ++ C
Sbjct:   62 LVVLVVAANPGMRSTTNLLIINLAVADLLFVIFCVPFTATDYVMPRWPFGDWWCKVVQYFIVVTAHASVYTLVLMSLDRFMAVVHPIASMSIRTEKNALLAIACIWVVILTTAIPV----GICHGEREY---------SYF---NRNHSSCVFLEERGYSKLGFQMSFFLSSYVIPLALISVLYMCMLTRLWKSAPGGRV-SAESRRGRKKVTRMVVVVVVVFAVCWCPIQIILLVKALNKYHITYFTV------TAQIVSHVLAYMNSCVNPVLYAFLSENFRVAFRKVMYC 331          
BLAST of GCR064 vs. UniProt/SwissProt
Match: sp|Q23497|NPR9_CAEEL (Galanin-like G-protein coupled receptor npr-9 OS=Caenorhabditis elegans OX=6239 GN=npr-9 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.674e-40
Identity = 106/342 (30.99%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  350 VLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGV-----IKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRL-----------LHGRT-------SKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFD-----VGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSF------------RDLLCCQATQSRVEYEKTHFSHN 1255
            ++V++ F ++MRNSTN LI  LAI+DL F+  C+PFT V Y    W   E  C +  F  + +AYCSV+TL LM  DR+LAVV+P+ S  +R+ RNT + +  ++I+   + +P+    G+     I  ++ +        C+ L +     T           + +F +F +F Y LPL +  +LYG +L +L           + GR        S + +  EA  +K++VT +V+ V++ +A CWLP+   F +    +        G +   + I S  LAY NS +NPILYA +S++FR  F            R   C    +S +  E TH++  
Sbjct:   63 LVVIVAFGRQMRNSTNTLIIGLAISDLMFLLLCVPFTAVDYAAPTWIFPEWTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVESMTLRTPRNTVIALCFIYIIIIASQIPVGRMHGIYVYDFIMEKRST--------CAILTIATAEATP-------TMARTYFMTFNVFGYVLPLGISVVLYGLMLRKLWDMPRPGNSQSVGGRNLTNRDSGSSIRRRPEATAAKRKVTRLVLCVLITWALCWLPLNVCFFMSGLAYPEPLVISHGVIMVIVQIASQVLAYTNSCLNPILYALMSQSFREGFIRVMKMLINKLSRGRFCTNYRRSALRTELTHYNQT 389          
BLAST of GCR064 vs. UniProt/SwissProt
Match: sp|E7F7V7|GAL2B_DANRE (Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr2b PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.654e-36
Identity = 105/335 (31.34%), Postives = 177/335 (52.84%), Query Frame = 2
Query:  347 MVLVVIIFNKKMR-NSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFK-GRTRRQSKNDGNDMKTSS 1333
            +VL V++ + ++  N+TN+ I +L++AD  FI FC+PF   IY  +GW  G   C++  F I +T Y S +TL  +  DR+LA+ +P+ S  +R+  N  + +VV+W L           S V  G   S  + + +  S + +  W +  ++ V+D        T  F+F Y +P+L++SL Y + + + L      +   +E+ ++K++VT M++IV V F  CWLP   V L  +Y +F    P  +T + F   S+C+AYANS +NPI+YA +S++FR+ F+ +  C    S+    K H  +       F+ G T     N+ N  +  S
Sbjct:   46 LVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGL-----------SLVFAGPYLSYYDLIDFENSNVCVPGWEE-HNRKVLD--------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDF----PFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC--ILSKKGRNKVHVVNVANTVPGFEAGSTEVSQMNEENARQNES 353          
BLAST of GCR064 vs. UniProt/SwissProt
Match: sp|F1R332|GAL2A_DANRE (Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr2a PE=2 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 8.711e-36
Identity = 109/355 (30.70%), Postives = 166/355 (46.76%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRN-STNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTT---DQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC-------------QATQSRVEYEKTHFSHNRGGSNSFKGRTR-RQSKNDGNDMKTSSMRAIETT 1354
            +VL V+I N +M   STN+ I +L +ADL FI FC+P    IY    W  G   C+   F+IY+T Y S++TL  +  DR+LA+ +P+ S   R+ RN    + ++W L    + P                     Y SY   +  + TT     + V  +      T  FIF Y +P+L++ + Y + + R L      M   +E+ K+K++VT M++IV V F  CWLP   V L   +  F +    +  + I S+ +AYANS +NPI+YA +S++FR+ F+ +  C             Q  Q+    E      +  GSN   G TR R        M TS+      T
Sbjct:   38 LVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSP---------------------YLSYYQQMDLDGTTVCIPAWSVHHRQAMDICT--FIFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTY-VLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGCAFRNRVVNRIHTVQPAQTVSLMEAA----SSEGSNHCDGSTRGRLWSKSSKKMMTSAFMTFNVT 363          
BLAST of GCR064 vs. UniProt/SwissProt
Match: sp|P47211|GALR1_HUMAN (Galanin receptor type 1 OS=Homo sapiens OX=9606 GN=GALR1 PE=1 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 1.675e-35
Identity = 96/280 (34.29%), Postives = 144/280 (51.43%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL---LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            K R++TN+ I +L+IADL ++ FCIPF   +Y    W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  RN  LGV  +W L      P+  + G+   R  ++  C            W    D      +  K +    F+F Y LPLL+I   Y K+L   LH +   M++   +  SKK+    V++V+V F   WLP   + L     ++       LFR   I ++CLAY+NS VNPI+YAFLSENFR++++ +  C 
Sbjct:   65 KPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFC------------WEQWPDP-----RHKKAYVVCTFVFGYLLPLLLICFCYAKVLNH-LHKKLKNMSKK--SEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFR---ITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCH 321          
BLAST of GCR064 vs. TrEMBL
Match: A0A193KUP0 (GCR064 OS=Schmidtea mediterranea OX=79327 GN=gcr064 PE=2 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 2
Query:  209 MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL 1447
            MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL
Sbjct:    1 MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL 413          
BLAST of GCR064 vs. TrEMBL
Match: A0A193KUR9 (GCR304 OS=Schmidtea mediterranea OX=79327 GN=gcr304 PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 7.437e-119
Identity = 210/412 (50.97%), Postives = 282/412 (68.45%), Query Frame = 2
Query:  212 INNKTFLFSPPCNVSTVNIYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSM-RAIETT---QNDVLINCNSTTKLNDNKEEITVFLET 1435
            I N T L    C  +T   Y  +LTS+ VPILFGLI+++G  GN++V+VVII N +MRN+TNILI SLA+ADL FI FC+PFT V+YV  GWPLG   C+IYQ++ Y+TAYCSVYTLVLM  DR+LAVVHPI S  +R+ RNT + V  +W LF  +NLPLL+NS +I+G ++   +C+V YC+Y P ++WN T  +Y  D  FGK ++T FF+  Y  P+++IS+LYG L+ RLL GR+SK++ SN+A+ +KKRVT MV++VIV F  CW PIQ++F++Q+Y  D GG LFRTIH+ SNCLAY+NSMVNP LYAFLSENFRR+F +LLCC+  +S   +        RG +N          +   N + TS + R  E+T   Q   LINC++  KL     E  +  +T
Sbjct:   12 ILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVVGFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKS---FATGTIRDRRGITN----------ECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQT 410          
BLAST of GCR064 vs. TrEMBL
Match: A0A193KUH5 (GCR032 OS=Schmidtea mediterranea OX=79327 GN=gcr032 PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 4.960e-92
Identity = 175/365 (47.95%), Postives = 247/365 (67.67%), Query Frame = 2
Query:  272 EFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVV-YYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQ-SRVEYEKTHFSHNRGGSN---SFKGRTRRQ------SKNDGNDMKTSS 1333
            E ++T +V P +FG+I++ G FGN++V++V+  NK++RN TNILIASLAIAD+TFI FC+P T  I++K+GW LG   C+IYQF  Y+TAY SVYTLVLM  DR+LAVVHPI+S  +R+++N    V+  W++F   N PLL NSGV      + +N    +YC+Y+P VR+N+T   Y+ + +FG+ +   F IFAY LPL  I LLY  L+ +LL    S+++QS++AL+SKKRVT MVVIV+V FA CW+PIQ VF++Q    +     F+  H+F++ LAY+NSM+NPILYAF S NFR +F+ +L CQ    S  ++EKT+ + NR  S    S K  T++       S N  N + +SS
Sbjct:    7 ESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGV--AYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTCLIWKLLFNSESRISQSDKALQSKKRVTRMVVIVVVIFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSSS 369          
BLAST of GCR064 vs. TrEMBL
Match: A0A504Z9V0 (Allatostatin-A receptor OS=Fasciola gigantica OX=46835 GN=FGIG_10718 PE=3 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 5.365e-78
Identity = 148/333 (44.44%), Postives = 204/333 (61.26%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVN-CVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRA 1342
            +V++V++ N +MR+STNILI SLA+ADL FI  CIP T VIY+  GWP+G + C++Y +L+YVTA+CSVYTLVLM  DRFLAVV+P+ S   R+  NT   V+  W +    NLPLL+N+ +++G  +   + C   YC+Y  LV  ++ T     +    + FF  FF+F Y LP + I  LY  L+CRL   R+  + QS E+ +SKKRVT++VV V+V F   WLPI  VFL+Q +  D     FR + I SN LAY NS +NPILYAFLS NFR++F DL   +  Q+RV     H        +S       Q    GND+  +S ++
Sbjct:  101 LVIIVVLVNAQMRDSTNILILSLAVADLAFIVICIPLTTVIYIVGGWPMGVALCKVYFYLMYVTAFCSVYTLVLMSLDRFLAVVYPMRSIQWRNQANTVRIVLFTWSVVLIANLPLLINAVIVRGPVDGGDSACYTEYCTYAWLVTVDEKTQTARDNYDKARPFFLIFFLFGYLLPFVGICFLYISLICRLRCRRSPNIKQSAESRRSKKRVTVLVVTVVVVFGISWLPIHIVFLIQYFVGDPNTDFFRIVQILSNSLAYGNSSINPILYAFLSVNFRKAFIDLFHGRRKQTRVANGSPHLLEGMRLLSS-------QITATGNDVNNASTQS 426          
BLAST of GCR064 vs. TrEMBL
Match: A0A0R3SUJ3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9171 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 6.374e-78
Identity = 163/381 (42.78%), Postives = 229/381 (60.10%), Query Frame = 2
Query:  239 PPCNVSTVNIYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGV---IKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSR-VEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSS-MRAIETTQNDV 1366
            P C  +    Y  +L   VVPILFG++ ++G  GN++V++VI     MRNSTNILI SLA+ADL+FI  C+PFT ++Y  + WPL + FC+IY F  +++AYCSVYTLVLM  DRFLAVV P+ S L R+ +NT + +++MWI+    NLP+ + S     I+  +ES     + + S++  + +ND      ++ +  K F+T FF+  Y  PL +I L Y  LL  LL GR SKM++S EA K K++ T +V+IVI  FAACWLPIQ +F+ Q +  D     FR  HI  N LAYANS VNPILYAF S+ FR  F  L+C   ++ R V YE            +   R    S  + + MK S+  R+++  Q +V
Sbjct:   13 PNCPANEPVDYLIILQRYVVPILFGIVDLIGFTGNLLVIIVIAGYSTMRNSTNILILSLALADLSFIICCVPFTAMVYALEIWPLPDFFCKIYNFTTFLSAYCSVYTLVLMSLDRFLAVVFPLRSRLWRTTKNTVITLIIMWIILIAANLPIPILSRTFYWIESDQESGCKRRMCHISWMVQLTYNDVPIN--INQENSKFFYTVFFVLGYAFPLALICLFYSVLLKELLCGRVSKMSKSVEAHKGKRKATKLVIIVISVFAACWLPIQVIFMYQSFYSDSSTMTFRVFHIMGNVLAYANSCVNPILYAFFSDTFRAGFASLICMDKSKMRDVHYESNADQTEMLTVRNHTIRMPATSVQEKSPMKASANNRSMKVHQKEV 391          
BLAST of GCR064 vs. Ensembl Cavefish
Match: GALR1 (galanin receptor type 1 [Source:NCBI gene;Acc:103047815])

HSP 1 Score: 155.606 bits (392), Expect = 8.017e-43
Identity = 101/284 (35.56%), Postives = 152/284 (53.52%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQS 1219
            + R++TNI I +L++ADL+++ FC+PF   +YV   W LG   C+   +   V+   S++TL  M  DR++A+V   SSS VR  RN  L VV +W+L      P+  +  +I+    +       YC  L    W     +        K +    F+F Y LPLL+IS  Y ++L   L  +   M++ +EA  SK++    V++V+V F   WLP   V L    EF    PL +   IF   ++CLAY+NS VNPI+YAFLSENFR++++ +  CQ T  
Sbjct:   54 RARSTTNIFILNLSVADLSYLLFCVPFQATVYVLPTWVLGAFACKFVHYFFTVSMLVSIFTLSAMSVDRYVAIVRARSSSSVRVARNALLAVVAIWLLSLAMAAPVAYHQRIIEREDNAT------YCWEL----WPQAHHR--------KIYVVCTFVFGYVLPLLLISFCYARVLNH-LRKKLKNMSKKSEA--SKRKTAQTVLVVVVVFCLSWLPHHVVHLW--VEFG-SFPLNQASFIFRVAAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQITSE 313          
BLAST of GCR064 vs. Ensembl Cavefish
Match: ENSAMXT00000006013.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:4195125:4261560:1 gene:ENSAMXG00000005876.2 transcript:ENSAMXT00000006013.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 1.323e-40
Identity = 96/288 (33.33%), Postives = 152/288 (52.78%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL-LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            MV++  I + + R++TNI I +L+IADL+F+ FC+PF   IY    W  G   C+   + + VT   S++TLV M  DR++AVV    S  +R+ RN  LGV ++W+L     +P+  +  V                         D  D    +  F    + +  +  Y LPL++I+  Y K+L  L H +   M++ +E  +SK++    V++V+ AF  CW+P   + + ++  +F +    F    I S+CLAY NS VNPILYAFLSENFR++ R +  C+
Sbjct:   56 MVVLGRIKSGRSRSTTNIFILNLSIADLSFLLFCVPFQATIYSLPEWIFGAFLCKSVHYFVTVTMLVSIFTLVAMSVDRYVAVVLSKKSPCIRNRRNALLGVWIIWLLSLVFAVPVAQHQVV------------------------TDHPDA--PNSSFCWEIWVTILVIGYLLPLVLITCCYAKVLYHL-HKKIKNMSKKSE--RSKRKTAQTVLLVVAAFLLCWMPHHIIAMWVEFGDFPLNDASF-AFRIVSHCLAYGNSCVNPILYAFLSENFRKACRQVFTCR 313          
BLAST of GCR064 vs. Ensembl Cavefish
Match: galr2b (galanin receptor type 2-like [Source:NCBI gene;Acc:103040671])

HSP 1 Score: 142.51 bits (358), Expect = 1.086e-37
Identity = 101/344 (29.36%), Postives = 179/344 (52.03%), Query Frame = 2
Query:  347 MVLVVIIFNKKMR-NSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQND 1363
            +VL V++ + ++  N+TN+ I +L++AD  FI FC+PF   IY  +GW  G   C++  F I +T Y S +TL  +  DR+LA+ +P+ S  +R+  N  + +V++W L           S +  G   S  + + +  S + +  W +  ++ V+D        T  F+F Y +P+L++SL Y + + + L      +   +E+ ++K++VT M++IV V F  CWLP   V L  +Y +F    P  +T + F   S+C+AYANS +NPI+YA +S++FR+ F+ +  C    S+    K H  H       F+G +   S  +  + + +    +     +
Sbjct:   46 LVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVIIWGL-----------SLIFAGPYLSYYDLIDFENSNVCVPGWEE-HNRKVLD--------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDVMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDF----PFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC--ILSKKGRNKVHVVHVANTVPGFEGGSTEVSHMNEENGRQNEREMVNRPHAE 362          
BLAST of GCR064 vs. Ensembl Cavefish
Match: oprm1 (delta-type opioid receptor [Source:NCBI gene;Acc:103040064])

HSP 1 Score: 142.51 bits (358), Expect = 1.455e-37
Identity = 101/323 (31.27%), Postives = 162/323 (50.15%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSY-LPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQAT----QSRVEYEKTHFSHNRGGSNSFKGRTRRQ 1297
            +V+ VII   KM+ +TNI I +LA+AD       +PF  V Y+   WP G+  C+I   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  V  WIL +   LP+++ +     R + + N +   C+   P   W            +        FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+  F  CW PI  +F++      +   L +TI   F   L Y NS +NP+LYAFL ENF+R FR+      +    Q+ +   +T        S+    RT RQ
Sbjct:   72 LVMYVIIRYTKMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGDVLCKIVMSIDYYNMFTSIFTLTTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMVMASTTAARVDFRGNTMDIDCTLEFPHPSW-----------YWENLLKICVFIFAFIMPVLIITVCYGLMILRLRSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIICWTPIH-IFVIIKALATIPNSLLQTITWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPSPSVLDLQNSMRSTRTRNPQREAHSSLTVDRTNRQ 379          
BLAST of GCR064 vs. Ensembl Cavefish
Match: galr1a (galanin receptor type 1 [Source:NCBI gene;Acc:103037936])

HSP 1 Score: 141.354 bits (355), Expect = 1.464e-37
Identity = 98/282 (34.75%), Postives = 154/282 (54.61%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQ--YVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL---LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ 1207
            + R++TN+ I +L+IADL+++ FCIPF   +Y+   W  GE  C+   +   V+   S++TL  M  DR++A+VH   SS +R  R+   GV V+W L      P+  +  +++ +  S       +C  +    W + T +  YVV        FT  FIF Y LPL++IS  Y K+L   LH +   +++   +  SKK+    V++V+V F   WLP   V L      +  +    LFR   + ++CLAY+NS VNPI+YAFLSENFR++++ +  CQ
Sbjct:   57 QQRSTTNVFILNLSIADLSYLLFCIPFQSTVYMMPSWIFGEFICKFVHYFFTVSMLVSIFTLSAMSVDRYVAIVHCRKSSSIRVVRHALAGVAVIWALSLAMAAPVAHHQSIVESKDNST------FCWEV----WPNHTRRKIYVV--------FT--FIFGYLLPLILISFCYAKVLNH-LHKKLRNVSKK--SEASKKKTAQTVLVVVVVFCLSWLPHHVVHLWVEFGSFPLNQASFLFR---VAAHCLAYSNSSVNPIIYAFLSENFRQAYKQVFRCQ 312          
BLAST of GCR064 vs. Ensembl Sea Lamprey
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 147.902 bits (372), Expect = 1.248e-40
Identity = 112/336 (33.33%), Postives = 168/336 (50.00%), Query Frame = 2
Query:  284 TSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKK---MRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQ--------ATQSRVEYEKTHFSHN 1255
            T I+VP +FG+I +LG  GN +VLVV++  K     RN+TN  I +L++ADLTF+  C+PF   IYV   W  G   C+   + + V    S++TL  M  +R++AVVH   S ++R+ RN   GV V+W L     +P   N  ++ G   S      ++C       W     +        + + T  FIF Y LPLL+IS  Y  +L  L     +   +S  + K   +    V++V+  F   WLP   + +  +Y  F +    F    I S+CL+Y NS  NPI+YAFLSENFR+++R +  CQ        A  +R+  E    +H 
Sbjct:   28 TGIIVPAVFGVIFLLGVLGNTLVLVVLLCRKSRRVQRNTTNTFILNLSVADLTFLMVCVPFQSTIYVLPTWVFGAFLCKAVHYFVTVFMLVSIFTLAAMSVERYIAVVHSHRSPVLRTTRNALAGVAVIWALSVVAAIPCAQNRMLVDGVNYSHPG--QFFC-------WEAEASKR-------RAYITGIFIFGYLLPLLLISCCYISVLTHLQRKVRNISKKSQRSKKKTAQ---TVLVVVAVFCISWLPHHVIHMWVLYGSFPLTSASF-AFRIVSHCLSYGNSCANPIIYAFLSENFRKAYRQVFSCQLPVSSSLKAKSTRIRLENFSSTHT 343          
BLAST of GCR064 vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 130.568 bits (327), Expect = 9.400e-35
Identity = 94/307 (30.62%), Postives = 153/307 (49.84%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSK-MAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRR 1294
            KM+ +TN  I +LA+AD T +   +PF    Y+   WP GE  C++   + Y   + S++TL +M  DR++AV HP+ +   R+     L  + +WIL +   +P+++  G  K ++E  + C++ +    P V+W +     V             FIFA+ LP+L+I + Y  ++ RL   RT + ++ S E  ++ +R+T MV+IV+  F  CW PI    +++        P           L Y NS +NP+LYAFL ENF+R F++  C  A           F  +  GS+   GR  R
Sbjct:    5 KMKTATNTYIFNLALAD-TLVTTTLPFQSADYLMGSWPFGEVICKVVMSIDYYNMFTSIFTLTIMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPVIV-MGTAK-KEEGIIECILDFPH--PAVKWENLLKICV-------------FIFAFILPVLIIVVCYSLMVLRL---RTVRLLSGSKEKDRNLRRITRMVLIVVAIFVICWTPIHLFVIIKSRVSISDTPTVSAAWYICVALGYTNSCLNPVLYAFLDENFKRCFKE-FCFPAA----------FRRDLQGSSRVGGRPNR 279          
BLAST of GCR064 vs. Ensembl Sea Lamprey
Match: oprm1 (opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-010125-1])

HSP 1 Score: 123.25 bits (308), Expect = 4.935e-32
Identity = 89/275 (32.36%), Postives = 143/275 (52.00%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQ-SVFLLQIYEFDVGGPLFRTIHIFSNCLA--YANSMVNPILYAFLSENFRRSFRD 1192
            KM+ +TNI I +LA+AD T     +PF  V Y    WP G   C++   + Y   + S++TL +M  DR++AV HP+ +   R+     L  + +W L +   LP+++   V K  K   V+C + +  Y     W++                T  F+FA+F+P+ +I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+ AF  CW PI   V +  I        +  + H+   C+A  Y NS +NP LYAFL ENF+R FR+
Sbjct:   11 KMKTATNIYIFNLALAD-TLATSTLPFQIVNYFMSTWPFGRVLCKLIISIDYYNMFTSIFTLTMMSIDRYIAVCHPVRALDFRTPVKAKLVNICIWSLSSAIGLPVMI-IAVTKQDKNGNVDCTLEFPIY-----WDNMLK-------------TCVFVFAFFIPVCVITVCYGLMITRLRSVRV--LSGSKEKDRTMRRITRMVLVVVAAFVVCWTPIHLYVIVRAIVRIPESAVVTVSWHV---CIALGYVNSSMNPFLYAFLDENFKRCFRE 260          
BLAST of GCR064 vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 119.398 bits (298), Expect = 2.229e-30
Identity = 98/312 (31.41%), Postives = 166/312 (53.21%), Query Frame = 2
Query:  287 SIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNS---TNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMW---ILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSF-FIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRD 1192
            S+ VP++F LI +LGAFGN +V++V++ + +  +S   TNI I +L++ADL FI FC+PF   IY   GW  G   C+   F+I++T + S +TL  +  DR+LA+ +P+ S  +R+ R     +  +W   ++F G                         Y SY   V + + +    V  K  ++      F+  Y +P+ ++ L Y   L + L      + + +E+ ++K++VT M++IV   F ACWLP     +L +Y +    PL    + F   S+C++YANS +NP++YA +S++FR+ FR 
Sbjct:   25 SVTVPVVFLLIFLLGAFGNSLVIIVLLCSGQRGSSNTTTNIFILNLSVADLCFILFCVPFQATIYTLDGWIFGSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGP------------------------YLSYYQAVTFQNMSMCMPVWAKEPRKLMDMVTFVCGYLVPVSVLGLAYAFTL-KYLWTAVDPLEEMSESKRAKRKVTTMILIVAGLFCACWLPHH---VLILYFWFGHFPLTHATYAFRLLSHCMSYANSCLNPLVYALVSKHFRKGFRK 308          
BLAST of GCR064 vs. Ensembl Sea Lamprey
Match: sstr1a (somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-090429-1])

HSP 1 Score: 119.783 bits (299), Expect = 2.579e-30
Identity = 91/315 (28.89%), Postives = 153/315 (48.57%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTR 1291
            MV+ VI+   KM+ +TNI I +LA+AD  F+   +PF         WP G S CR+   +  +  + SV+ L ++ FDR++AVVHPI ++  R           +W L     LP+++ +   +   +  V C + +    P   W+               F    F   + LP+  I L Y  ++ ++     +  A   +  +S+++VT+MV +V+  F ACW+P   V L+ ++E   G     T++  +  L YANS  NPILY FLS++FR SF+ +LC       V + + + + + G   +   R+R
Sbjct:   33 MVIYVILRYAKMKTATNIYILNLAVADELFM-MSVPFLATSTALHHWPFGSSLCRLVLSVDGINMFTSVFCLTVLTFDRYVAVVHPIKAARYRRPSVAKTINAAVWALSMVIILPIVVYADT-RVNADGTVVCNLLW----PRPEWSAA-------------FVVYTFTVGFLLPVAAICLCYALIVAKMRA--VALRAGWQQRKRSERKVTLMVTMVVAVFVACWMPFYVVQLVNVFEGQQGA----TVNQLAVILGYANSCANPILYGFLSDSFRHSFQRVLC-------VRWAERYGADDPGDYYATAVRSR 315          
BLAST of GCR064 vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 119.013 bits (297), Expect = 2.818e-30
Identity = 99/296 (33.45%), Postives = 147/296 (49.66%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYV-KQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSF-FIFAYFLPLLMISLLYGKLLCRLLHG----RTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPL--FRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQA 1210
            +V +VI     MRN+ N LI +LAIAD+T    CIPF  VI V    W LG + C++    +   A CS  TL  + FDR+ AVVHP    L  S R T   +V  W++     LP +L  G + G                     +  T+ ++ DI   ++ +T F F+FAY LPL++I+  Y ++  +L         +K+A    +      +T M+V V++ +A C LP Q ++L    EF  G       T+  F+  L Y NS+VNP LYA L++ F++ F  LLCC+ 
Sbjct:   15 LVCLVIFKTPNMRNTRNYLIVNLAIADITVALVCIPFDVVIRVYGDTWVLGAAMCKMVWPSMTFVATCSAATLAAISFDRYRAVVHPWKPRL--SMRQTLAVIVSTWLVSFLVVLPYILVLG-MDG---------------------HSCTEFWLKDIH--RQLYTVFLFVFAYALPLVIIAFAYSRVALKLREQSNRIEKNKLASGIPSSSKYNWITKMLVTVVLIYALCLLPNQVLWLWM--EFGTGNEFEHMNTLLTFTGMLVYINSIVNPFLYAGLNDEFKKGFARLLCCKG 282          
BLAST of GCR064 vs. Ensembl Nematostella
Match: EDO43123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM3])

HSP 1 Score: 107.457 bits (267), Expect = 3.374e-26
Identity = 84/278 (30.22%), Postives = 140/278 (50.36%), Query Frame = 2
Query:  383 RNSTNILIASLAIADLTFIAFCIPFTGV-IYVKQGW---PLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYG----KLLCRLLHGRTSKMAQSNEAL--KSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSF 1186
            R  TN+LIA++AIADL    F +P + V +Y++  W     G   C++  F ++V+   SV+T+V +  +RF+AV  P+   L++  +   L  V++W +     LP L    V    +  +  CVV +        W D  +     ++   RFFT  F+F Y  P+L +++LY     KL  R + G  +   QSN     + +K+V  ++++V+  FA CW P   +    +Y+ +    L       S  +++ANS +NPILY  L+E FR+ F
Sbjct:   30 RMVTNLLIANMAIADLLVCVFSMPASVVHLYIRNKWLPGTFGIFLCKMVSFSMFVSLAASVFTIVFISVERFIAVFFPLRCELLKRPK---LLTVMIWAISALVMLPSLFLFTVWTDERHGEHYCVVSW-------PWGDDGET----LRVLGRFFTLTFVFMYCCPVLFLAILYTMIARKLWVRAIPGNDT---QSNRGATQRCRKKVIKLLMVVVALFAVCWFPTHVMHYFLVYDSNRFYHLSDETKFLSFFVSHANSSINPILYILLNEGFRKDF 290          
BLAST of GCR064 vs. Ensembl Nematostella
Match: EDO36473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH8])

HSP 1 Score: 103.99 bits (258), Expect = 5.023e-25
Identity = 89/292 (30.48%), Postives = 134/292 (45.89%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQG---WPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMA-------QSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFL-LQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFR 1189
            MV  +I+  KKM+  TN  I +LA+ADL     CIPF   I V++    WP G   C++   L  +T + SVYTL  +   R+ A+VHP+   L  S   + L +  +W+   G+ +P                  V  Y + L   R   T ++Y    K  + F    F+F Y LPL +I   Y  +   L   + +K         Q+ EA    ++V  M+ +V + FA C LP   ++L L   + D     F  I  F N + +ANS  NP+ Y  L+E +RR F+
Sbjct:   27 MVCAIIVRRKKMKTVTNYFILNLAVADLALTCICIPFD--IPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVGLTRYWAIVHPMKRQL--SITQSKLVIAFIWL---GSVVP------------------VFPYANSLKFTRETHTCEEYWSSKKVREIFTAVIFVFQYVLPLGVIGTAYAAIGRELRRRKATKSGNHKLRHLQAQEA----RKVVNMLSVVTMVFAICVLPNNIMWLWLDFGDADQKVEYFWEIVAFCNVVTFANSAANPVCYTALNETYRREFK 289          
BLAST of GCR064 vs. Ensembl Nematostella
Match: EDO50023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF33])

HSP 1 Score: 103.99 bits (258), Expect = 1.605e-24
Identity = 90/296 (30.41%), Postives = 148/296 (50.00%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFT--GVIYVKQGWPLGE---SFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIK-GRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYG----KLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCC 1204
            +V+V ++ N++MR  TN LI ++A+ADL    F +P T   VI     W  GE   + C++  F+  V+   SV  +  +  DRF AVV P+   +  +    ++ +  +W++  G + P L    VI       KV C         +  W    +Q +++I   K F    F+  Y LPL+++S+LY     KL  R L G+ S++ Q   A +SKK+V  M++IV++ FA CWLP+     +  +      P+   I      L+  NS +NP +Y   +E++R+ F  L+CC
Sbjct:   40 LVIVTVVTNRRMRTVTNYLIVNMAVADLLLTVFNMPSTTSTVISPSYFWYTGEFWIAMCKLLPFIQSVSVASSVLNMTAIAVDRFFAVVLPLRRYI--TFNVAYIMMAAVWVVAIGVSAPFLYAQNVISFPGMPGKVAC---------METWKHPIEQ-LMEISEPKDFTVVLFVVFYVLPLIVMSVLYSVVIYKLWIRKLPGQRSELNQ-QRADRSKKKVLRMLLIVLLLFALCWLPVHVTSFILFFGTCSPPPILTWIGYL---LSQGNSAINPCIYVIFNESYRQGFARLVCC 319          
BLAST of GCR064 vs. Ensembl Nematostella
Match: EDO47650 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLR5])

HSP 1 Score: 103.605 bits (257), Expect = 1.791e-24
Identity = 90/330 (27.27%), Postives = 157/330 (47.58%), Query Frame = 2
Query:  362 IIFNKKMRN--STNILIASLAIADLTFIAFCIPFT-GVIYVKQGWPLGESF---CRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNE---ALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRD----LLCCQA--------TQSRVEYEKTHFSHNRGGSNSFKGRT 1288
            IIF +  +   STN+LI ++A+ADL    F +P + G +Y +  W  G      C++ QF   V+   S+ TL+ +  +RF A+ +P+ +  +R  +   +   V+W+L      P L +  V       +     YYC    +V W D  + Y    +  + ++   F+F Y LPLL+I+LLY  +  +L + +      +     A+ +K+R+  +++++++ F  CWLP   +     Y+      +   + + S  + ++NS +NP +Y  LSENFRR F      L+C +A        ++SR    K   S    GS    GRT
Sbjct:   22 IIFKRSSKGNASTNVLIGNMALADLLVTLFAMPHSVGFLYYQNKWIGGIIGEIGCKLAQFPFVVSIAASILTLLAISVERFWAIYYPLRARKLRKPK---VLSSVIWLLAISVFCPYLFSYTV------KRTASGQYYC----VVEWGDIEETY----RTQRLYYLMIFVFLYALPLLVITLLYTLIGVKLWYRKQPGQENARSRRTAIVAKRRILRLLIVLVLVFTVCWLPAHLMHYYMYYDLKAWFNIPVAVKLLSFWICHSNSAINPGIYILLSENFRREFLKTTLGLVCSKAPSLPRTSSSKSRKTGRKATLSSRLFGSRR-GGRT 333          
BLAST of GCR064 vs. Ensembl Medaka
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:101155603])

HSP 1 Score: 152.91 bits (385), Expect = 1.929e-41
Identity = 122/377 (32.36%), Postives = 202/377 (53.58%), Query Frame = 2
Query:  233 FSPPCNVSTVN-IYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMR-NSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIF---SNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAI 1345
            FS P  +S V+  Y+   TS++V ++F LI +LG  GN +VL V++ + ++  N+TN+ I +L++AD  FI FC+PF   IY  +GW  G   C++  F I +T Y S +TL  +  DR+LA+ +P+ S  +R+  N  + +VV+W L           S V  G   S  + + Y  S + +  W +  D+ V+D        T  F+F Y +P+L++SL Y + + + L      +   +E+ ++K++VT M++IV V F  CWLP   V L  +Y +F    P  +T + F   S+C+AYANS VNPI+YA +S++FR+ F+ +  C    +     K H  H       F+  +   S+ +  +M+ +    I
Sbjct:    7 FSRPGGLSNVSESYQINPTSVIVSVVFSLIFLLGTIGNSLVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGL-----------SLVFAGPYLSYYDLIDYANSTVCIPGWEE-QDRKVLD--------TCTFLFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDF----PFNQTTYAFRLLSHCMAYANSCVNPIVYALVSKHFRKGFKKVFSCILIAN--GRNKVHVVHVANTGPGFEAASTEVSQMNEENMRQNECEMI 356          
BLAST of GCR064 vs. Ensembl Medaka
Match: galr1a (galanin receptor 1 [Source:NCBI gene;Acc:101159001])

HSP 1 Score: 142.895 bits (359), Expect = 5.167e-38
Identity = 96/282 (34.04%), Postives = 149/282 (52.84%), Query Frame = 2
Query:  377 KMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIY-EFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQS 1219
            K R +TNI I +L+IADL+++ FCIPF   +Y+   W LG   C+   +   V+   S++TL  M  DR++A+VH   SS +R  +   +GVVV+WI+      P++    +              +C  +    W D T +        K +    F+F Y LPLL+IS  Y K+L   LH +   M++   +  SKK+    V++V+V F   WLP   V L   +  F +    F  + + ++CLAY+NS VNP++YAFLSENFR++++ +  CQ   S
Sbjct:   66 KPRGTTNIFILNLSIADLSYLLFCIPFQSTVYILPSWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYIAIVHSRKSSSIRVAKYALIGVVVIWIISLVMAAPIMHYQNIFHSSDNYT------FCWEV----WPDQTQK--------KIYVVCTFVFGYVLPLLLISFCYAKVLNH-LHKKLRNMSKK--SEASKKKTAQTVLVVVVVFCLSWLPHHVVHLWAEFGTFPLNQASF-VLRVAAHCLAYSNSSVNPVIYAFLSENFRKAYKQVFKCQTGAS 325          
BLAST of GCR064 vs. Ensembl Medaka
Match: sstr2b (somatostatin receptor 2 [Source:NCBI gene;Acc:101172660])

HSP 1 Score: 140.969 bits (354), Expect = 3.831e-37
Identity = 103/328 (31.40%), Postives = 162/328 (49.39%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTS 1330
            +V+ VI+   KM+  TNI I +LA+AD+ F+   +PF  +      WP G   CRI   +  +  + S++ L++M  DR+LAVVHPI S+  R  R      V +W +    NLP+++ SG+I             +C+    + W +  + Y     F        FI  +FLPL++I L Y  ++ ++    +     S+   +S+++VT MV IV+  F  CWLP     +  +       P  R+   F   L YANS  NPILYAFLSENF++SF+++LC +      E E++    ++         T  QS     D++TS
Sbjct:   64 LVIYVILRYAKMKTVTNIYILNLAVADVLFM-LGLPFIALQLALVHWPFGPVLCRIVMTVDSLNQFTSIFCLMVMSIDRYLAVVHPIRSTKWRKPRVAKTINVAVWGVSLLVNLPIVIYSGIIMKHDSC-------FCT----IVWPEPQEAYYTAFMFYT------FILGFFLPLMVICLCYLFIIIKV--KSSGIRVGSSMRKRSERKVTRMVSIVVAVFVFCWLPFYVFNVTSVTGTISTTPFLRSTFAFVVVLGYANSCANPILYAFLSENFKKSFQNVLCLKKVGGLDEVERSDSKQDK--PRLMNDPTETQSTLLNGDLQTS 369          
BLAST of GCR064 vs. Ensembl Medaka
Match: oprm1 (delta-type opioid receptor [Source:NCBI gene;Acc:101161184])

HSP 1 Score: 139.813 bits (351), Expect = 8.774e-37
Identity = 103/326 (31.60%), Postives = 169/326 (51.84%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWN-DTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHI-FSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQ-SKNDGN 1315
            +V+ +I+   KM+ +TNI I +LA+AD   +   +PF  V Y+   WP G+  C++   + Y   + S++TL  M  DR++AV HP+ +   R+ RN  +  +  WIL +   LP++  +   K   +  V+C + +    P   W  DT  +  V            FIFA+ +P+L+I++ YG ++ RL   R   ++ S E  K+ +R+T MV++V+  F  CW PI  VF++     ++     +TI   F   L Y NS +NP+LY +L ENF+R FR+   C  + S +E + +    +R G+ S K   R   S N G 
Sbjct:   65 LVMYIIVRYTKMKTATNIYIFNLALAD-ALVTSTLPFQSVNYLMGSWPFGDLLCKMVMSIDYYNMFTSIFTLTTMSIDRYIAVCHPVKALDFRTPRNAKIVNICNWILSSAIGLPVMFMAATAKSHPK-IVDCKLIF----PHPSWYWDTLLKICV------------FIFAFIMPVLIITICYGLMILRLKSVRM--LSGSQEKDKNLRRITRMVLVVVAVFIVCWTPIH-VFVIITALINIPSSTLQTITWHFCIALGYTNSSLNPVLYGYLDENFKRCFREF--CTPSPSVLEIQNS----SRTGATSRKVPKREHNSANTGE 363          
BLAST of GCR064 vs. Ensembl Medaka
Match: oprd1a (delta-type opioid receptor [Source:NCBI gene;Acc:101163183])

HSP 1 Score: 138.272 bits (347), Expect = 3.777e-36
Identity = 94/304 (30.92%), Postives = 158/304 (51.97%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQ-IYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHN 1255
            +V+  ++   KM+ +TNI I +LA+AD       +PF    Y+   WP GE  C++   + Y   + S++TL +M  DR++AV HP+ +   R+     +  +++WIL +   +P+++ + V K    +K  C++ +    P   W DT  +  V            FIFA+ +P+++I++ YG ++ RL   R   ++ S E  ++ +R+T MV++V+ AF  CW PI    +++ + E D   P           L Y NS +NP+LYAFL ENF+R FRD   C   ++RVE        N
Sbjct:   72 LVMYGVVRYTKMKTATNIYIFNLALAD-ALATSTLPFQSAKYLMNTWPFGEFLCKVVIGIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALGFRTPAKAKMINILIWILSSAIGVPIMIMA-VTKVTDTNKTTCMLSFPD--PDWYW-DTVIKICV------------FIFAFVVPVMVITVCYGLMILRLRSVRL--LSGSKEKDRNMRRITRMVLVVVAAFIVCWTPIHIFIIVRTMVEVDTRNPFVVASWHLCIALGYTNSSLNPVLYAFLDENFKRCFRDF--CLPCRTRVEQNSMTSGRN 354          
BLAST of GCR064 vs. Planmine SMEST
Match: SMESG000014669.1 (SMESG000014669.1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 412/413 (99.76%), Postives = 413/413 (100.00%), Query Frame = 2
Query:  209 MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL 1447
            MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSK+DGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL
Sbjct:    1 MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKDDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNKEEITVFLETNLDL 413          
BLAST of GCR064 vs. Planmine SMEST
Match: SMESG000016325.1 (SMESG000016325.1)

HSP 1 Score: 365.54 bits (937), Expect = 2.357e-122
Identity = 210/412 (50.97%), Postives = 282/412 (68.45%), Query Frame = 2
Query:  212 INNKTFLFSPPCNVSTVNIYEFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSM-RAIETT---QNDVLINCNSTTKLNDNKEEITVFLET 1435
            I N T L    C  +T   Y  +LTS+ VPILFGLI+++G  GN++V+VVII N +MRN+TNILI SLA+ADL FI FC+PFT V+YV  GWPLG   C+IYQ++ Y+TAYCSVYTLVLM  DR+LAVVHPI S  +R+ RNT + V  +W LF  +NLPLL+NS +I+G ++   +C+V YC+Y P ++WN T  +Y  D  FGK ++T FF+  Y  P+++IS+LYG L+ RLL GR+SK++ SN+A+ +KKRVT MV++VIV F  CW PIQ++F++Q+Y  D GG LFRTIH+ SNCLAY+NSMVNP LYAFLSENFRR+F +LLCC+  +S   +        RG +N          +   N + TS + R  E+T   Q   LINC++  KL     E  +  +T
Sbjct:   11 ILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVVGFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKS---FATGTIRDRRGITN----------ECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQT 409          
BLAST of GCR064 vs. Planmine SMEST
Match: SMESG000074480.1 (SMESG000074480.1)

HSP 1 Score: 232.646 bits (592), Expect = 1.632e-71
Identity = 158/356 (44.38%), Postives = 212/356 (59.55%), Query Frame = 2
Query:  278 VLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIK------GRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRXXXXXXXXXXAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKT 1327
            VLTSI+VP LFG+I ++G  GN +V+ VII N  MRNSTNILI+SLA ADLTFI FCIP T  IY+ QGW      C IYQ+L ++T YCSVYTLVLM  DR+LA+VHPI+S   R+   +   V + WI     NLP L+NS V+          +++ N   YYC    LV +N+  D Y+ D K     + +FF+F + LPL MI +LYG LL R+     ++  QS    +S K+VT +VV VI+AF   WLP+  VFL+Q    D     FR  H+ +N +AY NSM+NPILYAFLSENFR +F+  L C+ +         H S +   + +   + + Q      +M+T
Sbjct:   48 VLTSIIVPALFGIIFVVGLLGNGLVIAVIIRNGHMRNSTNILISSLAFADLTFIVFCIPLTISIYIYQGWIWNNFLCMIYQYLTWLTVYCSVYTLVLMSADRYLAIVHPITSVNWRTRNRSLTAVYISWIALIIINLPFLINSRVLYTIPVKLANNQTRKN---YYCGNKKLVNYNEAMDGYIDDYKALFNHYFTFFLFGFLLPLSMIVILYGLLLYRISQRLNNQ--QSANITRSNKKVTRLVVSVIIAFGVSWLPLHIVFLIQSTYGDPSNVAFRAFHMVANSMAYGNSMINPILYAFLSENFRTAFKKFLTCKIS-------PCHLSSSSEAAANGSNKNQNQELITKCEMET 391          
BLAST of GCR064 vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 172.555 bits (436), Expect = 4.897e-51
Identity = 94/190 (49.47%), Postives = 137/190 (72.11%), Query Frame = 2
Query:  272 EFVLTSIVVPXXXXXXXXXXXXXXXMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVV-YYCSYLPLVRWNDTTDQYVVDIKFGKRFF 838
            E ++T +V P +FG+I++ G FGN++V++V+  NK++RN TNILIASLAIAD+TFI FC+P T  I++K+GW LG   C+IYQF  Y+TAY SVYTLVLM  DR+LAVVHPI+S  +R+++N    V+  W++F   N PLL NSGV      + +N    +YC+Y+P VR+N+T   Y+ + +FG++ +
Sbjct:    7 ESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGV--AYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRQLY 194          
BLAST of GCR064 vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 169.859 bits (429), Expect = 3.993e-50
Identity = 83/165 (50.30%), Postives = 118/165 (71.52%), Query Frame = 2
Query:  347 MVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVV-YYCSYLPLVRWNDTTDQYVVDIKFGKRFF 838
            +V++V+  NK++RN TNILIASLAIAD+TFI FC+P T  I++K+GW LG   C+IYQF  Y+TAY SVYTLVLM  DR+LAVVHPI+S  +R+++N    V+  W++F   N PLL NSGV      + +N    +YC+Y+P VR+N+T   Y+ + +FG++ +
Sbjct:   20 LVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGV--AYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRQLY 182          
The following BLAST results are available for this feature:
BLAST of GCR064 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALR13.489e-3634.29galanin receptor 1 [Source:HGNC Symbol;Acc:HGNC:41... [more]
OPRM19.989e-3630.95opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GALR22.434e-3532.58galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:41... [more]
OPRM13.916e-3431.21opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
OPRM15.386e-3430.34opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of GCR064 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-92.102e-4130.99Galanin-like G-protein coupled receptor npr-9 [So... [more]
npr-229.291e-2527.84Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-244.363e-2427.99NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-226.209e-2426.79Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-151.205e-2128.04Neuropeptide receptor 15 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of GCR064 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AstA-R11.798e-6040.97gene:FBgn0266429 transcript:FBtr0333798[more]
AstA-R11.798e-6040.97gene:FBgn0266429 transcript:FBtr0070575[more]
AstA-R21.577e-5740.00gene:FBgn0039595 transcript:FBtr0085316[more]
AstA-R21.577e-5740.00gene:FBgn0039595 transcript:FBtr0336790[more]
AstA-R21.853e-5739.29gene:FBgn0039595 transcript:FBtr0308641[more]
back to top
BLAST of GCR064 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr1b1.655e-4233.00galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
galr1a9.277e-3833.09galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
galr2b2.190e-3731.34galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr2b2.190e-3731.34galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr2a1.154e-3630.70galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
back to top
BLAST of GCR064 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmod38.627e-4235.52leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414][more]
lmod38.768e-4235.52leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414][more]
lmod31.193e-4135.52leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414][more]
ENSXETT00000041298.11.473e-4134.05galanin receptor 3 [Source:NCBI gene;Acc:100488248... [more]
sp34.330e-4031.40Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of GCR064 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oprm12.101e-3529.00opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm11.310e-3429.43opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm12.867e-3429.74opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm13.109e-3429.83opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm13.967e-3429.48opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of GCR064 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WPA2|AR_BOMMO8.058e-5741.30Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=... [more]
sp|Q23497|NPR9_CAEEL2.674e-4030.99Galanin-like G-protein coupled receptor npr-9 OS=C... [more]
sp|E7F7V7|GAL2B_DANRE1.654e-3631.34Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr... [more]
sp|F1R332|GAL2A_DANRE8.711e-3630.70Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr... [more]
sp|P47211|GALR1_HUMAN1.675e-3534.29Galanin receptor type 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of GCR064 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUP00.000e+0100.00GCR064 OS=Schmidtea mediterranea OX=79327 GN=gcr06... [more]
A0A193KUR97.437e-11950.97GCR304 OS=Schmidtea mediterranea OX=79327 GN=gcr30... [more]
A0A193KUH54.960e-9247.95GCR032 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A504Z9V05.365e-7844.44Allatostatin-A receptor OS=Fasciola gigantica OX=4... [more]
A0A0R3SUJ36.374e-7842.78G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of GCR064 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALR18.017e-4335.56galanin receptor type 1 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000006013.21.323e-4033.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
galr2b1.086e-3729.36galanin receptor type 2-like [Source:NCBI gene;Acc... [more]
oprm11.455e-3731.27delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
galr1a1.464e-3734.75galanin receptor type 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of GCR064 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr1b1.248e-4033.33galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
oprk19.400e-3530.62opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
oprm14.935e-3232.36opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-01... [more]
galr2a2.229e-3031.41galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
sstr1a2.579e-3028.89somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of GCR064 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR064 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496192.818e-3033.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431233.374e-2630.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364735.023e-2530.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500231.605e-2430.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476501.791e-2427.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR064 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2a1.929e-4132.36galanin receptor type 2 [Source:NCBI gene;Acc:1011... [more]
galr1a5.167e-3834.04galanin receptor 1 [Source:NCBI gene;Acc:101159001... [more]
sstr2b3.831e-3731.40somatostatin receptor 2 [Source:NCBI gene;Acc:1011... [more]
oprm18.774e-3731.60delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
oprd1a3.777e-3630.92delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of GCR064 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014669.10.000e+099.76SMESG000014669.1[more]
SMESG000016325.12.357e-12250.97SMESG000016325.1[more]
SMESG000074480.11.632e-7144.38SMESG000074480.1[more]
SMESG000009917.14.897e-5149.47SMESG000009917.1[more]
SMESG000009917.13.993e-5050.30SMESG000009917.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033587 ID=SMED30033587|Name=GCR064|organism=Schmidtea mediterranea sexual|type=transcript|length=1463bp
TGAATTTTTACACTGCGATTTTGAATGTTTTTGATTTATAGTTTGCACCA
GACAACCGATTTCCTTGAACACGAAACTATATCCGACCGATATCGGGAAA
GACAATACGGAAGTTAATTTCTTATCTATGAAAGTTTGATGAAAACTTCC
GTCTGTTTTCATTAAGATTTCATTTAAAATATATAATAAATTTATAGTTA
CCGCAAAGATGATCAACAATAAAACTTTTTTATTTTCCCCCCCTTGCAAC
GTGTCAACCGTCAATATCTATGAATTCGTGTTGACTTCGATTGTCGTTCC
GATTTTGTTCGGACTGATTATCATTCTCGGAGCGTTCGGAAACATTATGG
TTCTTGTCGTGATTATTTTCAATAAAAAGATGAGAAACAGCACGAACATC
CTTATTGCTTCACTGGCAATAGCGGATTTGACTTTCATTGCGTTTTGCAT
CCCATTTACCGGGGTTATCTATGTCAAACAAGGCTGGCCTCTCGGGGAGT
CCTTTTGTCGGATTTATCAATTTCTCATATACGTCACGGCTTATTGTAGC
GTTTATACACTCGTTTTGATGTGTTTTGACAGATTTCTCGCCGTCGTTCA
TCCGATTTCGAGCTCACTGGTTCGTAGCGATCGGAACACTTTTCTTGGAG
TTGTTGTTATGTGGATTCTTTTCACGGGAACAAACTTACCACTGTTGTTG
AATTCTGGAGTGATTAAAGGACGAAAAGAATCGAAAGTTAATTGCGTTGT
ATACTATTGTTCATATCTACCTTTAGTGCGGTGGAATGATACGACGGACC
AATACGTCGTGGACATCAAATTCGGTAAAAGATTCTTTACAAGTTTCTTT
ATTTTCGCCTACTTCTTACCACTGCTAATGATTAGTCTGTTATACGGTAA
GTTATTGTGCCGACTGCTACACGGCAGAACGTCAAAAATGGCGCAATCCA
ACGAAGCTTTGAAATCTAAGAAGCGTGTTACAATCATGGTAGTCATTGTC
ATTGTTGCATTTGCAGCTTGCTGGCTGCCGATTCAGAGTGTTTTTCTACT
TCAAATCTATGAATTTGACGTCGGAGGACCTTTGTTTAGAACAATTCACA
TTTTTAGTAACTGTCTCGCCTATGCGAATAGCATGGTCAATCCGATTTTG
TATGCGTTTTTATCGGAAAACTTTCGCAGATCATTCAGGGATCTGCTTTG
CTGTCAAGCAACCCAGTCTCGGGTCGAATACGAAAAGACTCATTTCAGTC
ACAATCGAGGAGGAAGCAATAGTTTCAAAGGCAGAACTCGAAGACAGAGT
AAAAACGATGGAAATGACATGAAAACGTCGTCGATGAGAGCCATTGAAAC
TACTCAAAATGACGTTTTAATAAACTGCAATTCAACAACCAAGCTAAACG
ACAACAAAGAGGAAATTACAGTGTTTTTAGAAACCAATTTAGATTTGTAA
ATTGATTGTGGAA
back to top

protein sequence of SMED30033587-orf-1

>SMED30033587-orf-1 ID=SMED30033587-orf-1|Name=SMED30033587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MINNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLV
VIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFC
RIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVV
MWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYV
VDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEA
LKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFS
NCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNR
GGSNSFKGRTRRQSKNDGNDMKTSSMRAIETTQNDVLINCNSTTKLNDNK
EEITVFLETNLDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR000405Galanin_rcpt
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000405Galanin receptor familyPRINTSPR00663GALANINRcoord: 93..111
score: 33.68
coord: 135..151
score: 32.94
coord: 76..90
score: 44.67
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 29..53
score: 27.35
coord: 257..281
score: 30.68
coord: 62..83
score: 34.91
coord: 107..129
score: 26.21
coord: 297..323
score: 36.92
coord: 210..233
score: 23.83
coord: 143..164
score: 18.36
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 38..330
e-value: 8.0E-5
score: -38.4
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 44..315
e-value: 1.7E-54
score: 184.9
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 113..129
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 13..371
e-value: 9.1E-84
score: 282.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 359..373
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 350..375
NoneNo IPR availablePANTHERPTHR24230:SF126ALLATOSTATIN A RECEPTOR 2, ISOFORM Acoord: 26..349
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 26..349
NoneNo IPR availableCDDcd150967tmA_AstA_R_insectcoord: 28..326
e-value: 8.08797E-114
score: 332.723
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 9..353
NoneNo IPR availableTMHMMTMhelixcoord: 258..280
NoneNo IPR availableTMHMMTMhelixcoord: 295..317
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 144..163
NoneNo IPR availableTMHMMTMhelixcoord: 101..123
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 44..315
score: 45.568