Elongation of very long chain fatty acids protein

Overview
NameElongation of very long chain fatty acids protein
Smed IDSMED30033585
Length (bp)1397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongation of very long chain fatty acids protein (SMED30033585) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongation of very long chain fatty acids protein (SMED30033585) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongation of very long chain fatty acids protein (SMED30033585) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongation of very long chain fatty acids protein (SMED30033585) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033585

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033585SMESG000081261.1 Contig4216GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033585SMESG000021565.1 Contig50060uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033585SMESG000021565.1 Contig50060newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033585SMESG000021565.1 Contig7652uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033585SMESG000021565.1 Contig7652newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033585SMESG000021565.1 Contig4216GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30033585SMESG000021565.1 dd_Smed_v6_523_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30033585SMESG000021565.1 dd_Smed_v4_523_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Human
Match: ELOVL3 (ELOVL fatty acid elongase 3 [Source:HGNC Symbol;Acc:HGNC:18047])

HSP 1 Score: 202.986 bits (515), Expect = 1.337e-61
Identity = 100/242 (41.32%), Postives = 156/242 (64.46%), Query Frame = 2
Query:  215 DYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNA-LWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSI--ILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            +YW  S  I+++Y+VLI +G+ YM  R  FNL+ P+ +WS  LAI SI+G  R   ++   +   G   +VC  +F  NS    W ++F++SK +ELGDTAFI+LRK+PLIF+HWYHH TV++Y    +      G +F  +N+GVHAIMYTYY+LK+  +  PK +P+++TS+Q+ QM VG+I  IL+Y++    +   C  T   L+    +Y++YF+LFAH+F   Y + K  ++ +++
Sbjct:   32 EYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWR---QDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ 270          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Human
Match: ELOVL6 (ELOVL fatty acid elongase 6 [Source:HGNC Symbol;Acc:HGNC:15829])

HSP 1 Score: 181.03 bits (458), Expect = 3.691e-53
Identity = 99/267 (37.08%), Postives = 152/267 (56.93%), Query Frame = 2
Query:  134 LDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            ++ +V  L   E     + N   + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM++G ++ +Y+    ++ D C    + ++    MYLSY VLF H+F+ AY  GK     +AE
Sbjct:    1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVV-NYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYI-GKMRKTTKAE 265          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Human
Match: ELOVL6 (ELOVL fatty acid elongase 6 [Source:HGNC Symbol;Acc:HGNC:15829])

HSP 1 Score: 181.03 bits (458), Expect = 3.691e-53
Identity = 99/267 (37.08%), Postives = 152/267 (56.93%), Query Frame = 2
Query:  134 LDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            ++ +V  L   E     + N   + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM++G ++ +Y+    ++ D C    + ++    MYLSY VLF H+F+ AY  GK     +AE
Sbjct:    1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVV-NYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYI-GKMRKTTKAE 265          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Human
Match: ELOVL6 (ELOVL fatty acid elongase 6 [Source:HGNC Symbol;Acc:HGNC:15829])

HSP 1 Score: 85.8853 bits (211), Expect = 1.641e-19
Identity = 47/135 (34.81%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  134 LDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQ 535
            ++ +V  L   E     + N   + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ
Sbjct:    1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQ 135          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Human
Match: ELOVL4 (ELOVL fatty acid elongase 4 [Source:HGNC Symbol;Acc:HGNC:14415])

HSP 1 Score: 73.559 bits (179), Expect = 9.141e-14
Identity = 79/284 (27.82%), Postives = 136/284 (47.89%), Query Frame = 2
Query:  230 SIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYN-------SNALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYFY--VINYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQ--MVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVL--TNGKKR 1030
            ++ IS LY++ ++LG  +M  R  F +R+ + I++  + ++++   +R    L     + G+ Y +C    Y N       + ALW +   +SK VE  DT F +LRK+   + FLH YHH T+    ++   +  A G  F+   +N  +H IMY+YY L +    + K++     +T +QL Q  + +G        AL L  D C     + +  +A  +S+  LF +++   Y         +     K+A     +NG+SANG+  S   L   NGKK+
Sbjct:   49 TLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLF-IFRE---LFMGSYNAGYSY-ICQSVDYSNNVHEVRIAAALWWYF--VSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGI-KWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHT------ALSLYTD-CPFPKWMHWALIAYAISFIFLFLNFYIRTY------KEPKKPKAGKTA-----MNGISANGVSKSEKQLMIENGKKQ 306          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Celegans
Match: elo-3 (Putative fatty acid elongation protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P49191])

HSP 1 Score: 206.453 bits (524), Expect = 1.200e-62
Identity = 114/263 (43.35%), Postives = 165/263 (62.74%), Query Frame = 2
Query:  122 KLGLLDYNVKDLHPMEL-YGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYG--FMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            K GL +Y++    P E  +    S  W +   ++W+ SI  SV+YV +I+ GK  M     F L  P+ +W+S LAI SI+G  R     + +    G  F YS+CH  +       W   F +SK  EL DT FIVLRK+PLIFLHWYHH+TVMIY + ++ +H+A G +F  +NYGVHA+MY+YY+L+SL+  +PK + ++VT++QL+QMV+G II   VY +K  G+ CQ T   L +   +Y +YF+LFA++FY+AY K
Sbjct:    9 KYGLENYSI--FLPFETSFDAFRSTTWMQ---NHWYQSITASVVYVAVIFTGKKIMEKYKPFQLDTPLFVWNSFLAIFSILGFLRMTPEFVWSWSAEGNSFKYSICHSSYAQGVTGFWTEQFAMSKLFELIDTIFIVLRKRPLIFLHWYHHVTVMIYTWHAYKDHTASGRWFIWMNYGVHALMYSYYALRSLKFRLPKQMAMVVTTLQLAQMVMGVIIGVTVYRIKSSGEYCQQTWDNLGLCFGVYFTYFLLFANFFYHAYVK 266          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Celegans
Match: elo-9 (Elongation of very long chain fatty acids protein [Source:UniProtKB/TrEMBL;Acc:Q9NAC6])

HSP 1 Score: 172.555 bits (436), Expect = 3.542e-50
Identity = 92/232 (39.66%), Postives = 138/232 (59.48%), Query Frame = 2
Query:  200 HELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            H    ++W  S+++S  Y++   L + YM SR   ++R  +  W+  LA+ SI+GTWR        +   GF+ S+C      + +A W  +F +SK  E GDT F+VLRK+P+IFLHWYHH  V+I  + +  E +APG +F  +NY VH+IMYTYY++ S+   +PK V + VT +Q  QM++G  I   V  LKL G+ CQ +   L +   +Y S+ VLF+ +F NAY
Sbjct:   42 HTFFKNHWFKSVYLSAAYIIATNLLQRYMESRKPKSMRPLLLAWNGFLAVFSIMGTWRFGIEFYDAVFRRGFIDSICLAVNPRSPSAFWACMFALSKIAEFGDTMFLVLRKRPVIFLHWYHHAVVLILSWHAAIELTAPGRWFIFMNYLVHSIMYTYYAITSIGYRLPKIVSMTVTFLQTLQMLIGVSISCIVLYLKLNGEMCQQSYDNLALSFGIYASFLVLFSSFFNNAY 273          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Celegans
Match: elo-4 (Putative fatty acid elongation protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q03574])

HSP 1 Score: 165.236 bits (417), Expect = 2.831e-47
Identity = 96/240 (40.00%), Postives = 148/240 (61.67%), Query Frame = 2
Query:  179 ISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGD-TCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            ++   YW  L   YW++SI ISVLY +LI + + +M +R  F L+ P+ +W+  LA  SII T R +   L ++   GF  ++C+     +  A W F F +SK VELGDT FI+LRK+PLIFLH+YHH  V+IY   S  EH+A G ++ ++NY  H++MYTYY++ ++   +PK+V + VT++Q +QM+ G  I   VY +K      CQ +   LY+   +Y+++ +LF  +F  AY
Sbjct:   38 VADPQYWTILFQKYWYHSITISVLYFILIKVIQKFMENRKPFTLKYPLILWNGALAAFSIIATLRFSIDPLRSLYAEGFYKTLCYSCNPTDVAAFWSFAFALSKIVELGDTMFIILRKRPLIFLHYYHHAAVLIYTVHSGAEHTAAGRFYILMNYFAHSLMYTYYTVSAMGYRLPKWVSMTVTTVQTTQMLAGVGITWMVYKVKTEYKLPCQQSVANLYLAFVIYVTFAILFIQFFVKAY 277          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Celegans
Match: elo-6 (Elongation of very long chain fatty acids protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q20303])

HSP 1 Score: 156.762 bits (395), Expect = 2.703e-44
Identity = 88/236 (37.29%), Postives = 140/236 (59.32%), Query Frame = 2
Query:  239 ISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKG---KYWSRARAES 934
            IS+ YVV+I+  K  M++R  F+L  P+N+W++ LAI S +G+  +   LL      GF  S  H   +YN  + ++ ++FV+SK  E GDT FI+LRK+PL+FLHWYHH+  M Y F+SF  +     +   +N+ VH+IMY YY L+S  + +P ++   +T++Q+ Q V+   IL +V  L + G +   T    +  L M +SY VLF +++Y +Y KG   K+ +  + E 
Sbjct:   36 ISMAYVVVIFGLKAVMTNRKPFDLTGPLNLWNAGLAIFSTLGSLATTFGLLHEFFSRGFFESYIHIGDFYNGLSGMFTWLFVLSKVAEFGDTLFIILRKKPLMFLHWYHHVLTMNYAFMSFEANLGFNTWITWMNFSVHSIMYGYYMLRSFGVKVPAWIAKNITTMQILQFVITHFILFHVGYLAVTGQSVDSTPGYYWFCLLMEISYVVLFGNFYYQSYIKGGGKKFNAEKKTEK 271          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Celegans
Match: elo-2 (Elongation of very long chain fatty acids protein [Source:UniProtKB/TrEMBL;Acc:Q9XVQ9])

HSP 1 Score: 152.91 bits (385), Expect = 6.976e-43
Identity = 82/240 (34.17%), Postives = 134/240 (55.83%), Query Frame = 2
Query:  230 SIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYN--SNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDT---CQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAES 934
            S  I + Y+V IY G+  M+ R  F+L+  + +W+   ++ S I  ++    L       GF+ S C    YY   S   WG+ FV+SK  ELGDT F+VLRK+P+IF+HWYHH    +Y  +++ EH A   +   +N  VH +MY Y+++++L I  P+ V   +T+IQ+ Q V+   I  ++  +K   D+   C ++  +L +G  MY+SY  LFA +FY AY + +  ++   + 
Sbjct:   36 SYKIMIGYLVTIYFGQKLMAHRKPFDLQNTLALWNFGFSLFSGIAAYKLIPELFGVFMKDGFVASYCQNENYYTDASTGFWGWAFVMSKAPELGDTMFLVLRKKPVIFMHWYHHALTFVYAVVTYSEHQAWARWSLALNLAVHTVMYFYFAVRALNIQTPRPVAKFITTIQIVQFVISCYIFGHLVFIK-SADSVPGCAVSWNVLSIGGLMYISYLFLFAKFFYKAYIQKRSPTKTSKQE 274          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Fly
Match: Baldspot (gene:FBgn0260960 transcript:FBtr0075355)

HSP 1 Score: 218.009 bits (554), Expect = 5.679e-67
Identity = 117/280 (41.79%), Postives = 178/280 (63.57%), Query Frame = 2
Query:  209 LLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSN--ALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYA-LKLRG-DTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK-GKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 1033
            +L+ W +  +   +Y+++I+ G+ +M +RP F LR P+ IW+++LA+ SI+G  R+A  L+  +R YG  +SVC P +         W ++FV+SK  ELGDT FIVLRKQPLIFLHWYHHITV+IY + S+ E+++   +F V+NY VH++MY+YY+LK+ R   P+F+ +I+TS+QL+QM++G  I  +    LK  G  +C I+ R + + +AMY SYFVLFA +FY AY   G + SR  A S+   A  N +    S      S+  +  G+ + 
Sbjct:   31 MLENWTWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQPLIFLHWYHHITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYLAPGGHKSRRMAASL---AAQNVVKQSSSPQQASESSKFIGAGEDQA 307          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Fly
Match: Baldspot (gene:FBgn0260960 transcript:FBtr0075356)

HSP 1 Score: 218.009 bits (554), Expect = 5.679e-67
Identity = 117/280 (41.79%), Postives = 178/280 (63.57%), Query Frame = 2
Query:  209 LLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSN--ALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYA-LKLRG-DTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK-GKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 1033
            +L+ W +  +   +Y+++I+ G+ +M +RP F LR P+ IW+++LA+ SI+G  R+A  L+  +R YG  +SVC P +         W ++FV+SK  ELGDT FIVLRKQPLIFLHWYHHITV+IY + S+ E+++   +F V+NY VH++MY+YY+LK+ R   P+F+ +I+TS+QL+QM++G  I  +    LK  G  +C I+ R + + +AMY SYFVLFA +FY AY   G + SR  A S+   A  N +    S      S+  +  G+ + 
Sbjct:   31 MLENWTWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQPLIFLHWYHHITVLIYSWFSYTEYTSSARWFIVMNYCVHSVMYSYYALKAARFNPPRFISMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYLAPGGHKSRRMAASL---AAQNVVKQSSSPQQASESSKFIGAGEDQA 307          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Fly
Match: bond (gene:FBgn0260942 transcript:FBtr0084263)

HSP 1 Score: 64.6994 bits (156), Expect = 3.433e-11
Identity = 77/276 (27.90%), Postives = 127/276 (46.01%), Query Frame = 2
Query:  260 LIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSV----CHPHFYYNSN-----ALWGFIFVISKPVELGDTAFIVLRKQP--LIFLHWYHH-ITVMI-YVFLSFHEHSAPGHYFYVI---NYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKY---WSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGK 1024
            ++ +G  YM +R   +L+  M  +++   + SI   W    +   +I++   M S+    C  +     N       W + F  SK ++L DT F VLRK+   + FLH YHH ITV+  + +L +    APG    +I   N GVH IMY YY + ++     K++     +TSIQL Q V   +IL Y+  +  +G  C +   L +  +   + +  LF +++   Y K K     SR    S+++SA       G     +     +L NG+
Sbjct:   46 VLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI---W----MCRTSIQESNVMASIFSKKCEINRTREQNLTLYSGAWFYFF--SKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKY----APGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFV---LILGYMLTVGAKG--CNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQSALRAAGGMGCMPQTMNAGKHLLQNGQ 303          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Fly
Match: bond (gene:FBgn0260942 transcript:FBtr0084261)

HSP 1 Score: 64.6994 bits (156), Expect = 3.433e-11
Identity = 77/276 (27.90%), Postives = 127/276 (46.01%), Query Frame = 2
Query:  260 LIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSV----CHPHFYYNSN-----ALWGFIFVISKPVELGDTAFIVLRKQP--LIFLHWYHH-ITVMI-YVFLSFHEHSAPGHYFYVI---NYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKY---WSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGK 1024
            ++ +G  YM +R   +L+  M  +++   + SI   W    +   +I++   M S+    C  +     N       W + F  SK ++L DT F VLRK+   + FLH YHH ITV+  + +L +    APG    +I   N GVH IMY YY + ++     K++     +TSIQL Q V   +IL Y+  +  +G  C +   L +  +   + +  LF +++   Y K K     SR    S+++SA       G     +     +L NG+
Sbjct:   46 VLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI---W----MCRTSIQESNVMASIFSKKCEINRTREQNLTLYSGAWFYFF--SKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKY----APGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFV---LILGYMLTVGAKG--CNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQSALRAAGGMGCMPQTMNAGKHLLQNGQ 303          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Fly
Match: bond (gene:FBgn0260942 transcript:FBtr0084262)

HSP 1 Score: 64.6994 bits (156), Expect = 3.433e-11
Identity = 77/276 (27.90%), Postives = 127/276 (46.01%), Query Frame = 2
Query:  260 LIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSV----CHPHFYYNSN-----ALWGFIFVISKPVELGDTAFIVLRKQP--LIFLHWYHH-ITVMI-YVFLSFHEHSAPGHYFYVI---NYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKY---WSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGK 1024
            ++ +G  YM +R   +L+  M  +++   + SI   W    +   +I++   M S+    C  +     N       W + F  SK ++L DT F VLRK+   + FLH YHH ITV+  + +L +    APG    +I   N GVH IMY YY + ++     K++     +TSIQL Q V   +IL Y+  +  +G  C +   L +  +   + +  LF +++   Y K K     SR    S+++SA       G     +     +L NG+
Sbjct:   46 VLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSI---W----MCRTSIQESNVMASIFSKKCEINRTREQNLTLYSGAWFYFF--SKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKY----APGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLIQFV---LILGYMLTVGAKG--CNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQSALRAAGGMGCMPQTMNAGKHLLQNGQ 303          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Zebrafish
Match: zgc:92749 (zgc:92749 [Source:ZFIN;Acc:ZDB-GENE-040718-309])

HSP 1 Score: 201.06 bits (510), Expect = 4.866e-61
Identity = 101/228 (44.30%), Postives = 141/228 (61.84%), Query Frame = 2
Query:  221 WHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            W YS  +S  Y VLI+LG M+M  R   +LR P+ +WS  LA+ SI+GT R+   +   +   GF  SVC   FY    +  W F F ISK  ELGDT F+VLRKQ LIFLHWYHHITV++Y + S+ +H A G +F  +N+ VHA MY+YY+ K+  + +P+   +++T +Q+SQM  G  +L  VY+ K     C+ TD  +  G AMY SY +LF  +FY +Y +
Sbjct:   27 WGYSFVLSGTYAVLIFLGHMFMKDRQKLDLRAPLVLWSMSLAVFSIVGTLRTGWYMFNVVCSEGFRQSVCDTDFYSAPVSKFWAFAFAISKAPELGDTVFVVLRKQRLIFLHWYHHITVLLYSWFSYKDHVAGGGWFMSMNFTVHAFMYSYYTAKAAGVRVPRAFAMLITVLQISQMAAGLTVLGLVYSWK-HEQHCKSTDNNIIFGSAMYFSYLLLFCAFFYQSYIR 253          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Zebrafish
Match: elovl6l (ELOVL family member 6, elongation of long chain fatty acids like [Source:ZFIN;Acc:ZDB-GENE-031110-3])

HSP 1 Score: 176.792 bits (447), Expect = 8.546e-52
Identity = 102/249 (40.96%), Postives = 148/249 (59.44%), Query Frame = 2
Query:  203 ELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKS 946
            E + D W  S     +YVVL++ G+ +M  R   +LR  + +WS  LAI SIIG  R+   +L  +   GF  SVC   FYY   +  W   FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+ ++  + +PK   I++TS Q++QM +G  + + VY     GD     D +++    MYLSY +LF+ +FY +Y K      ++ ES+ + 
Sbjct:   26 EWMQDNWKKSFLFGAVYVVLVFGGQHFMKDRQRLDLRKVLMMWSLSLAIFSIIGAVRTGCFMLYILSTSGFKQSVCDQSFYYGPISKFWACAFVLSKAPELGDTMFIVLRKQRLIFLHWYHHITVLVYSWYSYKDQVAGGGWFMTMNYTVHALMYSYYAARAAGLRVPKPCAILITSSQIAQMAMGLAVSALVYRWMQDGDCPSYLDNIVW-ASLMYLSYLLLFSSFFYQSYMKS-----SKPESIKRE 268          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Zebrafish
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:317738])

HSP 1 Score: 176.022 bits (445), Expect = 1.603e-51
Identity = 95/247 (38.46%), Postives = 138/247 (55.87%), Query Frame = 2
Query:  209 LLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKS 946
            + + W  S   S LY   I  G+  M  R  F LR P+ +WS  LA  SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QMV+G ++   VY    +G  C    + +     MYLSYFVLF  +F+ AY      ++ ++ +  KS
Sbjct:   24 MQENWKKSFLFSALYAACILGGRHVMKQREKFELRKPLVLWSLTLAAFSIFGAIRTGGYMVNILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFKISRKFAMFITLTQITQMVMGCVVNYLVYLWMQQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAYI-----TKRKSNAAKKS 265          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Zebrafish
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:317738])

HSP 1 Score: 172.555 bits (436), Expect = 3.409e-50
Identity = 94/240 (39.17%), Postives = 135/240 (56.25%), Query Frame = 2
Query:  230 SIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKS 946
            S   S LY   I  G+  M  R  F LR P+ +WS  LA  SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QMV+G ++   VY    +G  C    + +     MYLSYFVLF  +F+ AY      ++ ++ +  KS
Sbjct:   21 SFLFSALYAACILGGRHVMKQREKFELRKPLVLWSLTLAAFSIFGAIRTGGYMVNILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFKISRKFAMFITLTQITQMVMGCVVNYLVYLWMQQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAYI-----TKRKSNAAKKS 255          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Zebrafish
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:317738])

HSP 1 Score: 129.413 bits (324), Expect = 1.885e-35
Identity = 64/135 (47.41%), Postives = 85/135 (62.96%), Query Frame = 2
Query:  284 MSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKS 685
            M  R  F LR P+ +WS  LA  SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++
Sbjct:    1 MKQREKFELRKPLVLWSLTLAAFSIFGAIRTGGYMVNILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRA 135          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Xenopus
Match: ENSXETT00000040168.1 (ELOVL fatty acid elongase 3 [Source:NCBI gene;Acc:100497108])

HSP 1 Score: 189.504 bits (480), Expect = 2.281e-56
Identity = 108/273 (39.56%), Postives = 156/273 (57.14%), Query Frame = 2
Query:   98 ELDGETVSKLGLLDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGT----WRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            ELDG  +S + L +Y+ +       +    +  W +   + W  S   S+LY  LI+ G+  M  R  F LR P+ +WS  LA+ SIIG     W   N+L+      GF  SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + ++ +  A G +F  +NY VHA MY+YY+L++  I +P+   + +T  Q+ QMV+G ++ + VY+ +  G     T+ + +  L MY SYF+LF  +FY AY K
Sbjct:    3 ELDGHNLSVVLLQEYDFE-----RRFDDQGAIQWMQ---ENWSKSFFFSLLYAALIFGGQRMMKERRRFELRRPLVLWSFTLAVFSIIGAVRTGWFMGNILITN----GFKQSVCDRAFYSGPVSKFWAYAFVLSKVPELGDTLFIVLRKQKLIFLHWYHHITVLLYTWYTYKDTVAGGGWFMTMNYTVHAFMYSYYTLRAAGIRVPRPCAMFITFTQILQMVMGIVVNALVYSWRQDGSCLSTTENIFWSCL-MYFSYFILFCSFFYKAYLK 262          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Xenopus
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:550011])

HSP 1 Score: 183.726 bits (465), Expect = 3.261e-54
Identity = 93/232 (40.09%), Postives = 140/232 (60.34%), Query Frame = 2
Query:  203 ELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            + + + W  S   S LY   I+ G+  M  R  F LR P+ +WS  LA+ SI G  R+   +L  +   G   SVC   FYY   +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   +++T  Q++QM++G ++   V++   +G        +++  + MYLSYFVLF H+F+ AY
Sbjct:   24 QWMQENWKKSFLFSALYAAFIFGGRHLMKQREKFELRKPLILWSLSLAVFSIFGAVRTGAYMLYILMTKGLKQSVCDQSFYYGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMLITLSQITQMIIGCVVNYLVFSWMQQGQCPSHVQNIVWSSI-MYLSYFVLFCHFFFEAY 254          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Xenopus
Match: ENSXETT00000024129.1 (elongation of very long chain fatty acids protein 6-like [Source:NCBI gene;Acc:101731836])

HSP 1 Score: 149.058 bits (375), Expect = 2.540e-41
Identity = 81/187 (43.32%), Postives = 115/187 (61.50%), Query Frame = 2
Query:  347 IISIIGT-WRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            II  + T W   N+L+      GF  SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + ++ +  A G +F  +NY VHA MY+YY+L++  I +P+   + +T  Q+ QMV+G ++ + VY+ +  G     T+ + +  L MY SYF+LF  +FY AY K
Sbjct:   61 IIGAVRTGWFMGNILITN----GFKQSVCDRAFYSGPVSKFWAYAFVLSKVPELGDTLFIVLRKQKLIFLHWYHHITVLLYTWYTYKDTVAGGGWFMTMNYTVHAFMYSYYTLRAAGIRVPRPCAMFITFTQILQMVMGIVVNALVYSWRQDGSCLSTTENIFWSCL-MYFSYFILFCSFFYKAYLK 242          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Xenopus
Match: abtb2 (ankyrin repeat and BTB domain containing 2 [Source:Xenbase;Acc:XB-GENE-984511])

HSP 1 Score: 68.9366 bits (167), Expect = 1.885e-12
Identity = 72/236 (30.51%), Postives = 114/236 (48.31%), Query Frame = 2
Query:  233 IHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSN-------ALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYV--INYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            I I  +Y+VL+ LG   M  R AF LR  + I++  LA++ +        ++ + +  Y ++   C P  Y +S          W F F  SK +EL DT F ++RK+   + FLH YHH T MI+ + +  ++ A G  F++  +N  VH  MY YY L  L   + K++     +T +QL+Q   G+I L   Y L      C   D       A  +S  +LF +++Y  Y +
Sbjct:   48 ILIFAVYLVLVALGPRLMDKREAFTLRSVLLIYN--LALVGLSAYMFYEFLVTSVLAGYSYL---CQPVDYTDSQLGLRMARVCWWFFF--SKVIELLDTIFFIMRKKFNQISFLHVYHHAT-MIFNWWAGVKYVAGGQAFFIGMLNSFVHIFMYLYYGLAVLGPKVQKYLWWKRYLTLLQLTQF--GAIALHSGYNLV---TDCPFPDGFNAAVFAYIVSLIILFLNFYYQTYLR 270          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Xenopus
Match: abtb2 (ankyrin repeat and BTB domain containing 2 [Source:Xenbase;Acc:XB-GENE-984511])

HSP 1 Score: 68.9366 bits (167), Expect = 1.897e-12
Identity = 72/236 (30.51%), Postives = 114/236 (48.31%), Query Frame = 2
Query:  233 IHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSN-------ALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYV--INYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            I I  +Y+VL+ LG   M  R AF LR  + I++  LA++ +        ++ + +  Y ++   C P  Y +S          W F F  SK +EL DT F ++RK+   + FLH YHH T MI+ + +  ++ A G  F++  +N  VH  MY YY L  L   + K++     +T +QL+Q   G+I L   Y L      C   D       A  +S  +LF +++Y  Y +
Sbjct:   36 ILIFAVYLVLVALGPRLMDKREAFTLRSVLLIYN--LALVGLSAYMFYEFLVTSVLAGYSYL---CQPVDYTDSQLGLRMARVCWWFFF--SKVIELLDTIFFIMRKKFNQISFLHVYHHAT-MIFNWWAGVKYVAGGQAFFIGMLNSFVHIFMYLYYGLAVLGPKVQKYLWWKRYLTLLQLTQF--GAIALHSGYNLV---TDCPFPDGFNAAVFAYIVSLIILFLNFYYQTYLR 258          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Mouse
Match: Elovl3 (elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 [Source:MGI Symbol;Acc:MGI:1195976])

HSP 1 Score: 182.57 bits (462), Expect = 7.540e-54
Identity = 102/261 (39.08%), Postives = 162/261 (62.07%), Query Frame = 2
Query:  164 MELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNAL---WGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSI--ILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYF--KGKYWSRAR 925
            M+ Y           L +YW  S  I V+Y++LI +G+ YM +R +F+L+ P+ +WS  LAI SI+GT R    +   +   G   +VC     Y  +A+   W F+F++SK VELGDTAFI+LRK+PLIF+HWYHH TV+++    +      G +F  +N+GVH++MYTYY++K+ ++  P  +P+++TS+Q+ QMV+G+I  IL+Y++    +   C  T    +    +Y +YF+LFAH+F+ AY   KGK  S+++
Sbjct:   16 MQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFA--IYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWR---QEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ 271          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Mouse
Match: Elovl6 (ELOVL family member 6, elongation of long chain fatty acids (yeast) [Source:MGI Symbol;Acc:MGI:2156528])

HSP 1 Score: 180.259 bits (456), Expect = 5.011e-53
Identity = 101/268 (37.69%), Postives = 151/268 (56.34%), Query Frame = 2
Query:  134 LDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYA-LKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            ++ +V  L   E     + N   + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+   +L  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM++G +I   V+  ++   D C    + ++    MYLSY VLF H+F+ AY  GK     +AE
Sbjct:    1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYI-GKVKKATKAE 267          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Mouse
Match: Elovl6 (ELOVL family member 6, elongation of long chain fatty acids (yeast) [Source:MGI Symbol;Acc:MGI:2156528])

HSP 1 Score: 180.259 bits (456), Expect = 5.011e-53
Identity = 101/268 (37.69%), Postives = 151/268 (56.34%), Query Frame = 2
Query:  134 LDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYA-LKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            ++ +V  L   E     + N   + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+   +L  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM++G +I   V+  ++   D C    + ++    MYLSY VLF H+F+ AY  GK     +AE
Sbjct:    1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYI-GKVKKATKAE 267          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Mouse
Match: Elovl3 (elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 [Source:MGI Symbol;Acc:MGI:1195976])

HSP 1 Score: 178.718 bits (452), Expect = 1.115e-52
Identity = 91/225 (40.44%), Postives = 145/225 (64.44%), Query Frame = 2
Query:  272 GKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNAL---WGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSI--ILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYF--KGKYWSRAR 925
            G+ YM +R +F+L+ P+ +WS  LAI SI+GT R    +   +   G   +VC     Y  +A+   W F+F++SK VELGDTAFI+LRK+PLIF+HWYHH TV+++    +      G +F  +N+GVH++MYTYY++K+ ++  P  +P+++TS+Q+ QMV+G+I  IL+Y++    +   C  T    +    +Y +YF+LFAH+F+ AY   KGK  S+++
Sbjct:   29 GQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFA--IYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWR---QEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ 248          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Mouse
Match: Elovl6 (ELOVL family member 6, elongation of long chain fatty acids (yeast) [Source:MGI Symbol;Acc:MGI:2156528])

HSP 1 Score: 157.147 bits (396), Expect = 4.467e-45
Identity = 83/200 (41.50%), Postives = 121/200 (60.50%), Query Frame = 2
Query:  284 MSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYA-LKLRGDTCQITDRLLYMGLAMYLSYFVLFAH 877
            M+ R  F LR P+ +WS  LA+ SI G  R+   +L  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM++G +I   V+  ++   D C    + ++    MYLSY VLF H
Sbjct:    1 MNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCH 200          
BLAST of Elongation of very long chain fatty acids protein vs. UniProt/SwissProt
Match: sp|P49191|ELO3_CAEEL (Putative fatty acid elongation protein 3 OS=Caenorhabditis elegans OX=6239 GN=elo-3 PE=1 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 1.526e-61
Identity = 114/263 (43.35%), Postives = 165/263 (62.74%), Query Frame = 2
Query:  122 KLGLLDYNVKDLHPMEL-YGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYG--FMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            K GL +Y++    P E  +    S  W +   ++W+ SI  SV+YV +I+ GK  M     F L  P+ +W+S LAI SI+G  R     + +    G  F YS+CH  +       W   F +SK  EL DT FIVLRK+PLIFLHWYHH+TVMIY + ++ +H+A G +F  +NYGVHA+MY+YY+L+SL+  +PK + ++VT++QL+QMV+G II   VY +K  G+ CQ T   L +   +Y +YF+LFA++FY+AY K
Sbjct:    9 KYGLENYSI--FLPFETSFDAFRSTTWMQ---NHWYQSITASVVYVAVIFTGKKIMEKYKPFQLDTPLFVWNSFLAIFSILGFLRMTPEFVWSWSAEGNSFKYSICHSSYAQGVTGFWTEQFAMSKLFELIDTIFIVLRKRPLIFLHWYHHVTVMIYTWHAYKDHTASGRWFIWMNYGVHALMYSYYALRSLKFRLPKQMAMVVTTLQLAQMVMGVIIGVTVYRIKSSGEYCQQTWDNLGLCFGVYFTYFLLFANFFYHAYVK 266          
BLAST of Elongation of very long chain fatty acids protein vs. UniProt/SwissProt
Match: sp|Q9HB03|ELOV3_HUMAN (Elongation of very long chain fatty acids protein 3 OS=Homo sapiens OX=9606 GN=ELOVL3 PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 6.419e-61
Identity = 100/242 (41.32%), Postives = 156/242 (64.46%), Query Frame = 2
Query:  215 DYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNA-LWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSI--ILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            +YW  S  I+++Y+VLI +G+ YM  R  FNL+ P+ +WS  LAI SI+G  R   ++   +   G   +VC  +F  NS    W ++F++SK +ELGDTAFI+LRK+PLIF+HWYHH TV++Y    +      G +F  +N+GVHAIMYTYY+LK+  +  PK +P+++TS+Q+ QM VG+I  IL+Y++    +   C  T   L+    +Y++YF+LFAH+F   Y + K  ++ +++
Sbjct:   32 EYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWR---QDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ 270          
BLAST of Elongation of very long chain fatty acids protein vs. UniProt/SwissProt
Match: sp|O35949|ELOV3_MOUSE (Elongation of very long chain fatty acids protein 3 OS=Mus musculus OX=10090 GN=Elovl3 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 5.274e-53
Identity = 102/261 (39.08%), Postives = 162/261 (62.07%), Query Frame = 2
Query:  164 MELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNAL---WGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSI--ILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYF--KGKYWSRAR 925
            M+ Y           L +YW  S  I V+Y++LI +G+ YM +R +F+L+ P+ +WS  LAI SI+GT R    +   +   G   +VC     Y  +A+   W F+F++SK VELGDTAFI+LRK+PLIF+HWYHH TV+++    +      G +F  +N+GVH++MYTYY++K+ ++  P  +P+++TS+Q+ QMV+G+I  IL+Y++    +   C  T    +    +Y +YF+LFAH+F+ AY   KGK  S+++
Sbjct:   16 MQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFA--IYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWR---QEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ 271          
BLAST of Elongation of very long chain fatty acids protein vs. UniProt/SwissProt
Match: sp|Q9H5J4|ELOV6_HUMAN (Elongation of very long chain fatty acids protein 6 OS=Homo sapiens OX=9606 GN=ELOVL6 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.773e-52
Identity = 99/267 (37.08%), Postives = 152/267 (56.93%), Query Frame = 2
Query:  134 LDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            ++ +V  L   E     + N   + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+   ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM++G ++ +Y+    ++ D C    + ++    MYLSY VLF H+F+ AY  GK     +AE
Sbjct:    1 MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVV-NYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYI-GKMRKTTKAE 265          
BLAST of Elongation of very long chain fatty acids protein vs. UniProt/SwissProt
Match: sp|Q5ZJR8|ELOV6_CHICK (Elongation of very long chain fatty acids protein 6 OS=Gallus gallus OX=9031 GN=ELOVL6 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.889e-52
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:  203 ELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            + + + W  S   S LY   I+ G+  M+ R  F LR P+ +WS  LA+ SI G  R+A  +L  +   G   SVC   FY    +  W + FV+SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NYGVHA+MY+YY+L++    + +   + +T  Q++QM+VG +I   V++    G        +++  L MYLSYFVLF H+F+ AY
Sbjct:   24 QWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLSLAVFSIFGAVRTAPYMLYILMTKGLKQSVCDQSFYIGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLVGCVINYLVFSWMQHGQCHSHVQNIIWSSL-MYLSYFVLFCHFFFEAY 254          
BLAST of Elongation of very long chain fatty acids protein vs. TrEMBL
Match: R7UTT0 (Elongation of very long chain fatty acids protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_136876 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 4.833e-79
Identity = 128/259 (49.42%), Postives = 173/259 (66.80%), Query Frame = 2
Query:  185 HSNYWHELLLDY----WHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSA 949
              N+ H+  L++    W +SI  S  YV  I+ GK YM+ RP   LR P+ IWS VL I SI+G  R+   L   IR+YG   S+CHP ++Y   + W ++F ISK  ELGDT FIVLRKQPLIFLHWYHHITV+IYVF S+ +H+APG +F V+NY VH++MY+YY+LK++R  +PK+V +I+TS+QL QMV+G +I   VY  K  G  CQ +   L     MY SYF+LFA++FYNAY K +  + A+   + K+A
Sbjct:    5 EKNFDHDSFLEWIQENWTHSIWYSSFYVAFIFAGKKYMADRPRLTLRYPLAIWSLVLGIFSIMGAVRTIPELAYMIRNYGIEQSICHPSYFYGPTSFWAYMFTISKAYELGDTVFIVLRKQPLIFLHWYHHITVLIYVFYSYTDHTAPGRWFMVMNYTVHSVMYSYYALKAIRFSIPKWVSMIITSLQLLQMVLGVVINVLVYQYKQEGHYCQQSFENLRYCFCMYASYFILFAYFFYNAYLKPRMAAVAKKHGLEKTA 263          
BLAST of Elongation of very long chain fatty acids protein vs. TrEMBL
Match: A0A1I8FXJ4 (Elongation of very long chain fatty acids protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027938g2 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.318e-75
Identity = 119/274 (43.43%), Postives = 180/274 (65.69%), Query Frame = 2
Query:   83 MQYHPELDGETVSKLGLLDY-NVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            ++Y P  D      LG +D  N   ++  E         +       WHY+++IS +YV L++ G+ YM +RP FNLR  +  WS +LAI SI+G +R+   L+ T ++Y F +++CHP+++Y     W   FV+SK  ELGDTAFIVLRKQ L+FLHWYHHITV++YVF S+ EH+APG +F+ +NY VHA MY+YY+L++++   P++  + +TS+Q+ QM++G ++ +YV   K  G  CQ++D     G  MYLSYF+LFA++FY++Y K
Sbjct:    3 IRYSPVDDVVNSGALGQMDSPNFTFVYDFEKLSTGLEEDFRAWTERNWHYTVYISAIYVALVFYGQRYMKNRPPFNLRPMLAAWSGILAIFSIMGAYRTLPELIHTWQNYSFHHTICHPNYFYGVTGFWSICFVLSKAYELGDTAFIVLRKQNLMFLHWYHHITVLMYVFQSYSEHTAPGRWFFAMNYTVHAFMYSYYALRAMQFRPPRWTSMCITSMQIVQMIIGCLVFAYVQWTKRAGLPCQVSDANALSGSIMYLSYFLLFANFFYHSYMK 276          
BLAST of Elongation of very long chain fatty acids protein vs. TrEMBL
Match: A0A1I8GA74 (Elongation of very long chain fatty acids protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027938g1 PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 4.630e-75
Identity = 118/274 (43.07%), Postives = 180/274 (65.69%), Query Frame = 2
Query:   83 MQYHPELDGETVSKLGLLDY-NVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            ++Y P  D      LG +D  N   ++  E         +       WHY+++IS +YV +++ G+ YM +RP FNLR  +  WS +LAI SI+G +R+   L+ T ++Y F +++CHP+++Y     W   FV+SK  ELGDTAFIVLRKQ L+FLHWYHHITV++YVF S+ EH+APG +F+ +NY VHA MY+YY+L++++   P++  + +TS+Q+ QM++G ++ +YV   K  G  CQ++D     G  MYLSYF+LFA++FY++Y K
Sbjct:    3 IRYSPVDDVVNSGALGQMDSPNFTFVYDFEKLSTGLEEDFRAWTERNWHYTVYISAIYVAMVFYGQHYMKNRPPFNLRPMLAAWSGILAIFSIMGAYRTLPELIHTWQNYSFHHTICHPNYFYGVTGFWSICFVLSKAYELGDTAFIVLRKQNLMFLHWYHHITVLMYVFQSYSEHTAPGRWFFAMNYTVHAFMYSYYALRAMQFRPPRWTSMCITSMQIVQMIIGCLVFAYVQWTKRAGLPCQVSDANALSGSIMYLSYFLLFANFFYHSYMK 276          
BLAST of Elongation of very long chain fatty acids protein vs. TrEMBL
Match: A0A2T7PWR7 (Elongation of very long chain fatty acids protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00442 PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.499e-72
Identity = 115/233 (49.36%), Postives = 168/233 (72.10%), Query Frame = 2
Query:  200 HELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQIT-DRLLYMGLAMYLSYFVLFAHYFYNAY 895
            ++ +++ W  S   + +YVV+++ G++YM +RP ++LR  + IWS VL I SI+GT R+   LL  I  YG  YSVC P ++      W F+F +SK  ELGDT FI+LRKQPLIFLHWYHH+TV++YV+ S+ +H+APG +F V+NY VH+IMY+YY+L+++R  +PK V I+VTS+QL+QM++G +I  ++Y +K RG+ CQ + D L Y  + MY SYF+LFAH+FY  Y
Sbjct:   27 NKYMVERWTDSFVYAAIYVVIVFGGQVYMRTRPRYDLRPALAIWSGVLGIFSIMGTIRTVPELLTAINKYGLQYSVCVPTYFQGVPGFWSFMFTVSKVYELGDTVFIILRKQPLIFLHWYHHVTVLLYVWYSYPDHTAPGRWFMVMNYLVHSIMYSYYALRAMRFNIPKAVNILVTSLQLAQMIIGVLINIWIYQIKGRGEFCQQSYDNLRYSSI-MYFSYFILFAHFFYTTY 258          
BLAST of Elongation of very long chain fatty acids protein vs. TrEMBL
Match: A0A2C9KEA4 (Elongation of very long chain fatty acids protein OS=Biomphalaria glabrata OX=6526 GN=106078479 PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.727e-72
Identity = 120/257 (46.69%), Postives = 172/257 (66.93%), Query Frame = 2
Query:  197 WHE-----LLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAH 952
            WHE      +L+ W  S   S +Y+++++ G+  M  RP ++LR  + IWS VLAI SI+G  R+   L++ + ++G  YSVC P ++    + W F+F +SK  ELGDT FIVLRKQPLIFLHWYHHITV+IYV+ S+ +H+APG +F V+NY VHA MY+YY+L++L+   PKFV +++TS+QL+QM++G +I  ++Y +K RG+ CQ +   L    AMY +YFVLFAH+FY  Y             +SKSAH
Sbjct:   18 WHEKKFLDYMLERWTDSFVYSAIYIIVVFGGQFLMKHRPRYDLRPCLAIWSGVLAIFSIVGAVRTWPELISVLSNHGLQYSVCIPTYFKGVTSFWSFLFTVSKVYELGDTIFIVLRKQPLIFLHWYHHITVLIYVWYSYTDHTAPGRWFMVMNYTVHAFMYSYYTLRALQFRFPKFVNMVITSLQLTQMIIGVLINIWIYKIKGRGEFCQQSYENLGYSSAMYFTYFVLFAHFFYTTY-------------LSKSAH 261          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Cavefish
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:103036861])

HSP 1 Score: 179.104 bits (453), Expect = 1.181e-52
Identity = 95/243 (39.09%), Postives = 138/243 (56.79%), Query Frame = 2
Query:  209 LLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAES 934
            + + W  S   S LY   I  G+  M  R  F LR P+ +WS  LA+ SI G  R+ + ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QMV+G ++   VY+   +G  C    + +     MYLSYFVLF  +F+ AY      +R   +S
Sbjct:   24 MQENWKKSFLFSALYAACILGGRHLMKQREKFELRKPLVLWSLTLAVFSIFGAMRTGSYMMYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFRVSRKFAMFITLTQITQMVMGCVVNYLVYSWMQQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAYVNKTKGAREMKKS 266          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Cavefish
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:103036861])

HSP 1 Score: 178.718 bits (452), Expect = 1.656e-52
Identity = 93/228 (40.79%), Postives = 133/228 (58.33%), Query Frame = 2
Query:  215 DYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            + W  S   S LY   I  G+  M  R  F LR P+ +WS  LA+ SI G  R+ + ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QMV+G ++   VY+   +G  C    + +     MYLSYFVLF  +F+ AY
Sbjct:   26 ENWKKSFLFSALYAACILGGRHLMKQREKFELRKPLVLWSLTLAVFSIFGAMRTGSYMMYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFRVSRKFAMFITLTQITQMVMGCVVNYLVYSWMQQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAY 253          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Cavefish
Match: zgc:92749 (elongation of very long chain fatty acids protein 6-like [Source:NCBI gene;Acc:103026880])

HSP 1 Score: 175.252 bits (443), Expect = 2.801e-51
Identity = 99/244 (40.57%), Postives = 145/244 (59.43%), Query Frame = 2
Query:  203 ELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            +   + W  S      Y  +I+LG+ +M  R  ++LR P+  WS  LA+ SI G+ R+ + +L T   +GF  +VC  +FY    +  W + F +SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +H A G +F  +NY VHA+MY+YY+ K+  I +PK   I++TS+Q+ QM +G  +L+ VY              +++ G  MYLSY +LF+ +FY  Y K      A+AE
Sbjct:   22 QWFQENWTASYVFCAAYAAVIFLGRFFMRRREKWDLRRPLMFWSLSLALFSICGSIRTGSYMLNTYSSHGFRQTVCDTNFYSAPFSKFWAYAFTLSKVPELGDTVFIVLRKQRLIFLHWYHHITVLLYTWASYKDHVAGGGWFMTMNYSVHALMYSYYTAKAAGIQLPKPCAILITSMQILQMAMGLTVLALVYFWHHEVHCASNMQNIMW-GSLMYLSYLLLFSWFFYQTYLKKDKRKGAKAE 264          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Cavefish
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:103036861])

HSP 1 Score: 175.252 bits (443), Expect = 4.284e-51
Identity = 94/236 (39.83%), Postives = 135/236 (57.20%), Query Frame = 2
Query:  230 SIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAES 934
            S   S LY   I  G+  M  R  F LR P+ +WS  LA+ SI G  R+ + ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QMV+G ++   VY+   +G  C    + +     MYLSYFVLF  +F+ AY      +R   +S
Sbjct:   40 SFLFSALYAACILGGRHLMKQREKFELRKPLVLWSLTLAVFSIFGAMRTGSYMMYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFRVSRKFAMFITLTQITQMVMGCVVNYLVYSWMQQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAYVNKTKGAREMKKS 275          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Cavefish
Match: zgc:92749 (elongation of very long chain fatty acids protein 6-like [Source:NCBI gene;Acc:103026880])

HSP 1 Score: 173.711 bits (439), Expect = 3.809e-50
Identity = 97/228 (42.54%), Postives = 141/228 (61.84%), Query Frame = 2
Query:  251 YVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAE 931
            Y  +I+LG+ +M  R  ++LR P+  WS  LA+ SI G+ R+ + +L T   +GF  +VC  +FY    +  W + F +SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +H A G +F  +NY VHA+MY+YY+ K+  I +PK   I++TS+Q+ QM +G  +L+ VY              +++ G  MYLSY +LF+ +FY  Y K      A+AE
Sbjct:   77 YAAVIFLGRFFMRRREKWDLRRPLMFWSLSLALFSICGSIRTGSYMLNTYSSHGFRQTVCDTNFYSAPFSKFWAYAFTLSKVPELGDTVFIVLRKQRLIFLHWYHHITVLLYTWASYKDHVAGGGWFMTMNYSVHALMYSYYTAKAAGIQLPKPCAILITSMQILQMAMGLTVLALVYFWHHEVHCASNMQNIMW-GSLMYLSYLLLFSWFFYQTYLKKDKRKGAKAE 303          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Sea Lamprey
Match: elovl6l (ELOVL family member 6, elongation of long chain fatty acids like [Source:ZFIN;Acc:ZDB-GENE-031110-3])

HSP 1 Score: 188.348 bits (477), Expect = 2.494e-57
Identity = 95/234 (40.60%), Postives = 145/234 (61.97%), Query Frame = 2
Query:  209 LLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGK 907
            L D+   +   S+ Y+VLI+ G+  M  RP F LR P+ +WS  LA+ SIIG  R+   +   +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHH+TV++Y + S+ +  A G +F  +NYGVHA+MY+YY++++  + +P+ + +++T+ Q+ QMV+G  +   VY    +G      + +++  L MY SY +LF H+FY+AY + +
Sbjct:    1 LPDHRRKAFLFSIAYLVLIFWGQHAMKQRPKFELRKPLMLWSLSLALFSIIGAVRTGAYMWYILSTNGLQQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIVLRKQKLIFLHWYHHVTVLLYSWYSYKDMVAGGGWFMTVNYGVHAVMYSYYAMRAAGMRVPRLLAMLITTTQIGQMVLGCFVNVLVYRWMRQGQCSSYVENIVWSSL-MYFSYLLLFCHFFYDAYLRPQ 233          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Sea Lamprey
Match: elovl5 (ELOVL fatty acid elongase 5 [Source:ZFIN;Acc:ZDB-GENE-040407-2])

HSP 1 Score: 57.3806 bits (137), Expect = 2.061e-9
Identity = 69/287 (24.04%), Postives = 131/287 (45.64%), Query Frame = 2
Query:  206 LLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSN-----ALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITV-MIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPII-----VTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKK 1027
            LLLD +  ++  +++Y++++ +G   M  R  F+L+  + +++++L  +S    +     L+A +   G+     + H    ++      LW  I+ +SK +E  DT F ++RK+   +  LH YHH ++  I+ F+         ++    N  +H +MY YY L  +    P   P +     +T  QL+Q V+  +       +      C      L+  ++  +S  +LF++++   Y K    SR + ES     H NG +   S+ G  H NG  T  +K
Sbjct:   32 LLLDSYLPTLVSTLVYLLVVAVGPKLMRERQPFSLKGLLVVYNALLTALSFYMFYE----LVAGVWTGGYNLRCQNTHSAGEADMRIARVLW--IYYLSKLIEFLDTVFFIVRKKNTQVTVLHVYHHASMPTIWWFVLNWVPCGHSYFGATFNCFIHVLMYGYYGLSVI----PAMRPYLWWKRYITQAQLTQFVMTMVQSGSAIVMP-----CGFPAGWLWFQISYMMSLVLLFSNFYIQTYIKQG--SRPKLES-----HANGKMEPRSS-GDLHENGNSTRQRK 295          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Sea Lamprey
Match: elovl4b (ELOVL fatty acid elongase 4b [Source:ZFIN;Acc:ZDB-GENE-030131-7672])

HSP 1 Score: 55.0694 bits (131), Expect = 6.889e-9
Identity = 61/210 (29.05%), Postives = 96/210 (45.71%), Query Frame = 2
Query:  425 VCHPHFYYN-------SNALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYV--INYGVHAIMYTYYSLKSLRIPMPKFVPII-----VTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNG 1006
            +C P  Y +       ++ALW +   +SK +E  DT   +LRK+   + FLH YHH T+    ++   +  A G  F+   IN  VH +MYTYY+L +     PK  P +     +T IQ+ Q  + +    Y     L  D C     + +  +A  +S+ +LFA ++Y  Y K      AR E+ +  A      NG  +     S+G
Sbjct:   37 ICQPVNYTDDVNEMRIASALWWY--YVSKGIEYLDTVLFILRKKFNQVTFLHVYHHATMFTLWWIGI-KWVAGGQSFFGAHINSMVHVVMYTYYALSAFG---PKMQPYLWWKRYLTIIQMVQFHLSTFHTGY----SLYVD-CPFPKWMHWSLIAYSVSFILLFADFYYRTYMK------ARREAGAIGAADRAAANGRPSQQPSASSG 229          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Yeast
Match: ELO1 (Elongase I, medium-chain acyl elongase; catalyzes carboxy-terminal elongation of unsaturated C12-C16 fatty acyl-CoAs to C16-C18 fatty acids; ELO1 has a paralog, ELO2, that arose from the whole genome duplication [Source:SGD;Acc:S000003732])

HSP 1 Score: 60.077 bits (144), Expect = 1.710e-10
Identity = 58/230 (25.22%), Postives = 102/230 (44.35%), Query Frame = 2
Query:  248 LYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKL------RGDTCQITDRLLYM-----GLAMYLSYFVLFAHYFYNAYFKG 904
            +Y V+I+ G+  + S     LR    + + +L  +S +        +L  +  +G  ++VC+   +        ++  ++K VE  DT  +VL+ + L FLH YHH    +  +     ++A       +N  VH +MY YY L +  I +  +    VT +Q+ Q ++  I++ YV   K+         T Q  D L  M     G A+  SY  LF  ++   Y +G
Sbjct:   71 MYYVVIFGGRSLVKSCKPLKLRFISQVHNLMLTSVSFLWLILMVEQMLPIVYRHGLYFAVCNVESWTQPMETLYYLNYMTKFVEFADTVLMVLKHRKLTFLHTYHHGATALLCYNQLVGYTAVTWVPVTLNLAVHVLMYWYYFLSASGIRV--WWKAWVTRLQIVQFMLDLIVVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFISFYIEVYKRG 298          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Yeast
Match: YLR372W_mRNA (Elongase; involved in fatty acid and sphingolipid biosynthesis; synthesizes very long chain 20-26-carbon fatty acids from C18-CoA primers; involved in regulation of sphingolipid biosynthesis; lethality of the elo2 elo3 double null mutation is functionally complemented by human ELOVL1 and weakly complemented by human ELOVL3 or ELOV7 [Source:SGD;Acc:S000004364])

HSP 1 Score: 56.225 bits (134), Expect = 3.849e-9
Identity = 50/174 (28.74%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  410 GFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKS--LRIPMPKFVPIIVTSIQLSQMVVGSIILSYV----YALK-LRG-----DTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            G  +S+C    +        ++  ++K VEL DT F+VLR++ L+FLH YHH    +  +      ++      ++N GVH IMY YY L S  +R+   ++    VT  Q+ Q ++  + + +     YA K L G      TC  T      G  +  SY +LF  ++  +Y
Sbjct:  138 GLFWSICSKEAFAPKLVTLYYLNYLTKFVELIDTVFLVLRRKKLLFLHTYHHGATALLCYTQLIGRTSVEWVVILLNLGVHVIMYWYYFLSSCGIRVWWKQW----VTRFQIIQFLIDLVFVYFATYTFYAHKYLDGILPNKGTCYGTQAAAAYGYLILTSYLLLFISFYIQSY 307          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Yeast
Match: YCR034W_mRNA (Fatty acid elongase, involved in sphingolipid biosynthesis; acts on fatty acids of up to 24 carbons in length; mutations have regulatory effects on 1,3-beta-glucan synthase, vacuolar ATPase, and the secretory pathway; ELO2 has a paralog, ELO1, that arose from the whole genome duplication; lethality of the elo2 elo3 double null mutation is functionally complemented by human ELOVL1 and weakly complemented by human ELOVL3 or ELOV7 [Source:SGD;Acc:S000000630])

HSP 1 Score: 55.8398 bits (133), Expect = 4.723e-9
Identity = 74/269 (27.51%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  251 YVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSL--KSLRIPMPKFVPIIVTSIQLSQMV--VGSIILS--------YVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY-FKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTN 1018
            Y V+I+ G+  +S    F L     + + VL  +S+         L+  I  +G  +++C+   +        ++  I K +E  DT F+VL+ + L FLH YHH    +  +      ++       +N GVH +MY YY L  + +R+   ++    VT  Q+ Q V  +G I  +        Y   L   GD C  +    + G A+  SY VLF  ++ N Y  KG   SR     V K AH      GV+A   ++ N  L N
Sbjct:   78 YYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMVEQLVPIIVQHGLYFAICNIGAWTQPLVTLYYMNYIVKFIEFIDTFFLVLKHKKLTFLHTYHHGATALLCYTQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRVWWKEW----VTRFQIIQFVLDIGFIYFAVYQKAVHLYFPILPHCGD-CVGSTTATFAGCAIISSYLVLFISFYINVYKRKGTKTSR-----VVKRAH-----GGVAAKVNEYVNVDLKN 331          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Nematostella
Match: EDO48664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI99])

HSP 1 Score: 56.9954 bits (136), Expect = 3.117e-9
Identity = 60/236 (25.42%), Postives = 110/236 (46.61%), Query Frame = 2
Query:  230 SIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALW-----GFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYF-YVINYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGK 907
             + +  +Y+ ++ +G  +M +R A++LR  + +++  L ++S    +     +L +I ++  M   C    Y     L       +I+ +SK VE  DT F +LRK+   + FLH YHH ++ +  ++     +    YF    N  +H IMY YY L ++   + +++     +T +QLSQ       L  V+  K     C   +  L++  A   S   LF +++  AY  GK
Sbjct:   37 CLSLMAMYLFIVKVGPKFMENRKAWDLRGVLVVYNFALVLLSAYMVYEFIASIL-SIPEFNLM---CQDVSYEEDPRLMRLARVCYIYYLSKFVEYFDTFFFILRKKNNQISFLHVYHHASMCLLWWMVCKWIAGGVSYFGAACNSFIHVIMYLYYGLSAMGPSVQRYLWWKRYLTKMQLSQFA-----LVVVHTSKAIHMNCGFPNGFLWLQSAYMCSLVALFMNFYQKAYNAGK 263          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Nematostella
Match: EDO37426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX1])

HSP 1 Score: 47.3654 bits (111), Expect = 4.171e-6
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  485 SKPVELGDTAFIVLR--KQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYV-INYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVG 757
            +K +EL DT F++LR  ++ + FLH YHH T+++     +H ++ P   F + +N  VH  +Y YY+  +L         I +T +Q+ Q V+G
Sbjct:   99 TKNIELLDTVFMILRHRQRQISFLHVYHHSTILLLSDYCYHFYAWPSIAFMLGLNSFVHIFLYFYYAQSALYQQQRPAWKIRMTELQIVQFVIG 192          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Medaka
Match: ELOVL6 (elongation of very long chain fatty acids protein 6 [Source:NCBI gene;Acc:101172187])

HSP 1 Score: 194.897 bits (494), Expect = 1.081e-58
Identity = 99/232 (42.67%), Postives = 146/232 (62.93%), Query Frame = 2
Query:  209 LLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            + + W  S   S LY  L++ G+ YM  RP  NLR+P+ +WS  LA+ SIIG  R+ + +L  +   GF  S+C   FY    +  W + FV+SK  ELGDTAFIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA MY+YY+ ++  + +P+   +++TS Q++QMV+G  + + VY    +GD     D + +  L MYLSY +LF+++FY  Y +
Sbjct:   28 MQENWSKSFMFSALYAALVFAGQHYMKPRPKMNLRLPLVLWSLSLAVFSIIGAVRTGSYMLHILSHGGFRQSICDQSFYNGPISKFWAYAFVLSKAPELGDTAFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYTVHAFMYSYYAARAAGLRVPRPFAVLITSSQIAQMVMGVTVSALVYRWMQQGDCHSRLDNITWATL-MYLSYLLLFSNFFYQTYLR 258          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Medaka
Match: ELOVL6 (elongation of very long chain fatty acids protein 6 [Source:NCBI gene;Acc:101166505])

HSP 1 Score: 188.734 bits (478), Expect = 2.223e-56
Identity = 96/234 (41.03%), Postives = 143/234 (61.11%), Query Frame = 2
Query:  203 ELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFK 901
            E + + W  S  +  LY  L++ G+ +M  RP  NLR P+ +WS  LAI SIIG  R+   +L  + + GF  SVC   FY       W + F +SK  ELGDT FI+LRKQ LIFLHWYHHITV++Y + ++ +  A G +F  +NY VH++MY+YY+ ++  + +P+   + +T+ Q+ QM +G ++L+YVY            D++++ G  MYLSY +LFA +FYN Y K
Sbjct:   22 EWMQENWRKSFMLCGLYAALVFGGQHFMRERPKLNLRRPLVLWSLSLAIFSIIGAVRTGTYMLHVLLNGGFRQSVCDSSFYKAPVTKFWAYAFALSKVPELGDTMFIILRKQRLIFLHWYHHITVLLYSWYTYKDQVAGGGWFMTMNYMVHSLMYSYYAARAAGLRVPRVCAMTITAAQILQMAMGLVVLAYVYYWMDIAHCFSYVDKVVW-GTIMYLSYLLLFASFFYNTYLK 254          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Medaka
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:101173129])

HSP 1 Score: 176.407 bits (446), Expect = 1.282e-51
Identity = 92/228 (40.35%), Postives = 133/228 (58.33%), Query Frame = 2
Query:  215 DYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            + W  S   S LY   I  G+  M  R  F LR P+ +WS  LA+ SI G  R+ + ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QM++G ++   VY+   +G  C    + +     MYLSYFVLF  +F+ AY
Sbjct:   26 ENWKKSFLFSALYAACILGGRHVMKQREKFELRKPLVLWSLTLAVFSIFGAIRTGSYMMLILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFKVSRKFAMFITLTQITQMLMGCVVNYLVYSWMQQGQECPSHMQNIVWSSLMYLSYFVLFVQFFFEAY 253          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Medaka
Match: elovl6 (ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:101173129])

HSP 1 Score: 176.407 bits (446), Expect = 1.472e-51
Identity = 92/228 (40.35%), Postives = 133/228 (58.33%), Query Frame = 2
Query:  215 DYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNS-NALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAY 895
            + W  S   S LY   I  G+  M  R  F LR P+ +WS  LA+ SI G  R+ + ++  +   G   SVC   FY    +  W + FV+SK  ELGDT FIVLRKQ LIFLHWYHHITV++Y + S+ +  A G +F  +NY VHA+MY+YY+L++    + +   + +T  Q++QM++G ++   VY+   +G  C    + +     MYLSYFVLF  +F+ AY
Sbjct:   29 ENWKKSFLFSALYAACILGGRHVMKQREKFELRKPLVLWSLTLAVFSIFGAIRTGSYMMLILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYALRAAGFKVSRKFAMFITLTQITQMLMGCVVNYLVYSWMQQGQECPSHMQNIVWSSLMYLSYFVLFVQFFFEAY 256          
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Medaka
Match: elovl8a (elongation of very long chain fatty acids protein 4-like [Source:NCBI gene;Acc:101168572])

HSP 1 Score: 80.8777 bits (198), Expect = 1.025e-16
Identity = 73/234 (31.20%), Postives = 114/234 (48.72%), Query Frame = 2
Query:  245 VLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIIS-------IIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYV--INYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGK 907
            + Y+++I++G   M +R   NLR  + +++  +  +S          +W +   LL    DY        P     +   W F F  SK +EL DT F +LRK+   L FLH YHH T MI+ + +  ++ A G  F +  IN  VH +MY YY L ++   M K++     +TS+QL Q  + SI  +Y     L  D C   D +  + LA  LS  VLF +++Y +Y   +
Sbjct:   45 LCYLIIIWVGPKLMVNRQPVNLRTVLIVYNFAMVCLSAYMFYEFTASSWLAGYSLLCQPVDYSE-----SPLAMRMARVCWWFYF--SKVIELSDTIFFILRKKNSQLTFLHVYHHAT-MIFNWWAGVKYVAGGQSFLIGLINSFVHVVMYLYYGLAAVGPSMTKYLWWKRCLTSLQLLQFFIVSIHTTY----NLLAD-CDFPDSMNSVVLAYCLSLIVLFGNFYYRSYLSKR 265          
BLAST of Elongation of very long chain fatty acids protein vs. Planmine SMEST
Match: SMESG000021565.1 (SMESG000021565.1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 316/317 (99.68%), Postives = 317/317 (100.00%), Query Frame = 2
Query:   83 MQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 1033
            MQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHS+YWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV
Sbjct:    1 MQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSDYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 317          
BLAST of Elongation of very long chain fatty acids protein vs. Planmine SMEST
Match: SMESG000021565.1 (SMESG000021565.1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 306/322 (95.03%), Postives = 307/322 (95.34%), Query Frame = 2
Query:   68 MKTEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 1033
            M TEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHS+YWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLH              FHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV
Sbjct:    1 MMTEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSDYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLH-------------CFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 309          
BLAST of Elongation of very long chain fatty acids protein vs. Planmine SMEST
Match: SMESG000021565.1 (SMESG000021565.1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 305/320 (95.31%), Postives = 306/320 (95.62%), Query Frame = 2
Query:   74 TEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 1033
            TEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHS+YWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLH              FHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV
Sbjct:    2 TEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSDYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLH-------------CFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 308          
BLAST of Elongation of very long chain fatty acids protein vs. Planmine SMEST
Match: SMESG000021565.1 (SMESG000021565.1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 302/317 (95.27%), Postives = 303/317 (95.58%), Query Frame = 2
Query:   83 MQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 1033
            MQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHS+YWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLH              FHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV
Sbjct:    1 MQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSDYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAFIVLRKQPLIFLH-------------CFHEHSAPGHYFYVINYGVHAIMYTYYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANGIKHSNGVLTNGKKRV 304          
BLAST of Elongation of very long chain fatty acids protein vs. Planmine SMEST
Match: SMESG000001433.1 (SMESG000001433.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.083e-12
Identity = 88/285 (30.88%), Postives = 138/285 (48.42%), Query Frame = 2
Query:  170 LYGISHSNYWHELLLDYWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGTWRSANVLLATIRDYGFMYSV-CHPHFYYN---SNALWGFIFVISKPVELGDTAFIVLRKQ--PLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYV---INYGVHAIMYTYYSLKSLRIPMPKFV--PIIVTSIQLSQMVVGSIILSYVYALKLRGDTC-QITDRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLVNGVSANG 988
            L  IS S     LL+D +  +  I+  Y++ +Y+G   M ++  FNLR P+ I+ ++L II     +         ++   F  +V   P        ++A+W F   ISK VEL DT F VLRK+   + FLH YHH T+    ++       PG   ++   IN  VH +MY+YY L      + KF+     VT +QL Q +VG I     + + L  + C  I   ++Y G+   +S   LF +++Y AY   KY +  R +    + H+  + NG S+NG
Sbjct:   18 LLNISDSRVSDWLLMDAYWPTWGITGFYLLSVYIGMWLMKNKIPFNLRNPL-IFHNLLMIILNFHIFSQLLYHSWKLKYNYFCQAVNADPDNLSELKIASAIWWF--YISKLVELLDTVFFVLRKKNDQVSFLHVYHHATMFPLWWIGVKW--LPGGSAFLGPMINSFVHVVMYSYYGLTIFCPALRKFMVWKKYVTRLQLIQFIVGMI-----WGINLLVNGCVHIPKWMIYTGIVYGISMISLFLNFYYRAYIL-KYRNLPRTDIC--NGHVEIMKNG-SSNG 288          
The following BLAST results are available for this feature:
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELOVL31.337e-6141.32ELOVL fatty acid elongase 3 [Source:HGNC Symbol;Ac... [more]
ELOVL63.691e-5337.08ELOVL fatty acid elongase 6 [Source:HGNC Symbol;Ac... [more]
ELOVL63.691e-5337.08ELOVL fatty acid elongase 6 [Source:HGNC Symbol;Ac... [more]
ELOVL61.641e-1934.81ELOVL fatty acid elongase 6 [Source:HGNC Symbol;Ac... [more]
ELOVL49.141e-1427.82ELOVL fatty acid elongase 4 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elo-31.200e-6243.35Putative fatty acid elongation protein 3 [Source:... [more]
elo-93.542e-5039.66Elongation of very long chain fatty acids protein ... [more]
elo-42.831e-4740.00Putative fatty acid elongation protein 4 [Source:... [more]
elo-62.703e-4437.29Elongation of very long chain fatty acids protein ... [more]
elo-26.976e-4334.17Elongation of very long chain fatty acids protein ... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Baldspot5.679e-6741.79gene:FBgn0260960 transcript:FBtr0075355[more]
Baldspot5.679e-6741.79gene:FBgn0260960 transcript:FBtr0075356[more]
bond3.433e-1127.90gene:FBgn0260942 transcript:FBtr0084263[more]
bond3.433e-1127.90gene:FBgn0260942 transcript:FBtr0084261[more]
bond3.433e-1127.90gene:FBgn0260942 transcript:FBtr0084262[more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:927494.866e-6144.30zgc:92749 [Source:ZFIN;Acc:ZDB-GENE-040718-309][more]
elovl6l8.546e-5240.96ELOVL family member 6, elongation of long chain fa... [more]
elovl61.603e-5138.46ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
elovl63.409e-5039.17ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
elovl61.885e-3547.41ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000040168.12.281e-5639.56ELOVL fatty acid elongase 3 [Source:NCBI gene;Acc:... [more]
elovl63.261e-5440.09ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
ENSXETT00000024129.12.540e-4143.32elongation of very long chain fatty acids protein ... [more]
abtb21.885e-1230.51ankyrin repeat and BTB domain containing 2 [Source... [more]
abtb21.897e-1230.51ankyrin repeat and BTB domain containing 2 [Source... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Elovl37.540e-5439.08elongation of very long chain fatty acids (FEN1/El... [more]
Elovl65.011e-5337.69ELOVL family member 6, elongation of long chain fa... [more]
Elovl65.011e-5337.69ELOVL family member 6, elongation of long chain fa... [more]
Elovl31.115e-5240.44elongation of very long chain fatty acids (FEN1/El... [more]
Elovl64.467e-4541.50ELOVL family member 6, elongation of long chain fa... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49191|ELO3_CAEEL1.526e-6143.35Putative fatty acid elongation protein 3 OS=Caenor... [more]
sp|Q9HB03|ELOV3_HUMAN6.419e-6141.32Elongation of very long chain fatty acids protein ... [more]
sp|O35949|ELOV3_MOUSE5.274e-5339.08Elongation of very long chain fatty acids protein ... [more]
sp|Q9H5J4|ELOV6_HUMAN1.773e-5237.08Elongation of very long chain fatty acids protein ... [more]
sp|Q5ZJR8|ELOV6_CHICK1.889e-5241.38Elongation of very long chain fatty acids protein ... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UTT04.833e-7949.42Elongation of very long chain fatty acids protein ... [more]
A0A1I8FXJ41.318e-7543.43Elongation of very long chain fatty acids protein ... [more]
A0A1I8GA744.630e-7543.07Elongation of very long chain fatty acids protein ... [more]
A0A2T7PWR71.499e-7249.36Elongation of very long chain fatty acids protein ... [more]
A0A2C9KEA41.727e-7246.69Elongation of very long chain fatty acids protein ... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elovl61.181e-5239.09ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
elovl61.656e-5240.79ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
zgc:927492.801e-5140.57elongation of very long chain fatty acids protein ... [more]
elovl64.284e-5139.83ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
zgc:927493.809e-5042.54elongation of very long chain fatty acids protein ... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
elovl6l2.494e-5740.60ELOVL family member 6, elongation of long chain fa... [more]
elovl52.061e-924.04ELOVL fatty acid elongase 5 [Source:ZFIN;Acc:ZDB-G... [more]
elovl4b6.889e-929.05ELOVL fatty acid elongase 4b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ELO11.710e-1025.22Elongase I, medium-chain acyl elongase; catalyzes ... [more]
YLR372W_mRNA3.849e-928.74Elongase; involved in fatty acid and sphingolipid ... [more]
YCR034W_mRNA4.723e-927.51Fatty acid elongase, involved in sphingolipid bios... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO486643.117e-925.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374264.171e-632.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELOVL61.081e-5842.67elongation of very long chain fatty acids protein ... [more]
ELOVL62.223e-5641.03elongation of very long chain fatty acids protein ... [more]
elovl61.282e-5140.35ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
elovl61.472e-5140.35ELOVL fatty acid elongase 6 [Source:NCBI gene;Acc:... [more]
elovl8a1.025e-1631.20elongation of very long chain fatty acids protein ... [more]
back to top
BLAST of Elongation of very long chain fatty acids protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021565.10.000e+099.68SMESG000021565.1[more]
SMESG000021565.10.000e+095.03SMESG000021565.1[more]
SMESG000021565.10.000e+095.31SMESG000021565.1[more]
SMESG000021565.10.000e+095.27SMESG000021565.1[more]
SMESG000001433.11.083e-1230.88SMESG000001433.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033585 ID=SMED30033585|Name=Elongation of very long chain fatty acids protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1397bp
TTTGTTTAAGTCTGTCAAATGATTTTCTCGAGAACCGCACTTTTTTGAAT
AGAAATATAGAAATTGGATGAAGACGGAGAAGATGCAATATCATCCAGAA
CTCGATGGCGAAACGGTTTCCAAGCTGGGTTTATTAGATTACAACGTGAA
GGATCTCCATCCGATGGAGTTATACGGGATTAGTCACAGCAATTATTGGC
ATGAATTATTGTTGGATTATTGGCATTACAGCATTCACATCTCCGTGCTC
TACGTCGTGTTGATTTATCTTGGCAAAATGTACATGAGTTCTAGACCTGC
GTTCAACCTGCGAATGCCCATGAATATCTGGAGCAGTGTATTGGCTATCA
TCAGTATTATCGGAACATGGCGCAGTGCAAATGTCCTTCTAGCAACAATT
CGGGATTATGGATTTATGTACTCGGTCTGCCATCCGCATTTTTATTACAA
CTCCAATGCGTTATGGGGATTTATTTTCGTGATATCGAAACCGGTAGAAC
TCGGCGACACGGCATTTATCGTACTCCGAAAACAGCCATTGATATTTCTC
CATTGGTATCACCACATTACGGTCATGATTTATGTTTTTCTCAGTTTCCA
TGAACACTCAGCTCCGGGCCATTATTTCTATGTCATCAATTACGGAGTGC
ACGCAATCATGTACACGTATTACTCGCTGAAATCCTTGAGAATCCCGATG
CCGAAATTTGTTCCGATAATTGTTACTTCAATTCAATTGTCACAAATGGT
CGTCGGCAGTATCATTCTCTCGTATGTGTACGCGTTGAAATTAAGAGGGG
ACACGTGTCAAATTACCGATAGATTGCTTTACATGGGATTGGCTATGTAT
TTGAGTTACTTCGTGTTGTTTGCCCACTATTTCTATAACGCTTACTTCAA
AGGAAAATATTGGTCGAGAGCTCGAGCTGAGTCAGTTTCGAAATCGGCCC
ACCTTAATGGATTGGTTAACGGCGTTTCCGCCAATGGGATTAAACATTCT
AATGGAGTTCTGACCAACGGCAAGAAACGAGTTTAAATCTTTTATATAAT
TATATTAATTATTATATTTATCGAATTGGTTTGGCGGGGGGTGTGATAAT
ACATTTTGAACTCGCTAGGATTTTGTGATAAAATATATTGTTCTTGTTTC
AATGATAATGACAAATTTTGTGCCACCCATTTTGTAATATTTTTGTTTTT
GACTAGATCTGCGGCACTGACAATTTGTGATTTAATAAATTTGGTTTTAA
TGCTTGATCTGTAGAGTGATCGAGTTGTGTTCGGTCAATTACGCTATTTT
TCAGCATTTGTATTCAAACATTTGAAACAAAAAATTACAGTAATATAATG
AAATAAAATAATTTATTTAAATAAACAATTAGATTGTTAAACTTAGG
back to top

protein sequence of SMED30033585-orf-1

>SMED30033585-orf-1 ID=SMED30033585-orf-1|Name=SMED30033585-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MKTEKMQYHPELDGETVSKLGLLDYNVKDLHPMELYGISHSNYWHELLLD
YWHYSIHISVLYVVLIYLGKMYMSSRPAFNLRMPMNIWSSVLAIISIIGT
WRSANVLLATIRDYGFMYSVCHPHFYYNSNALWGFIFVISKPVELGDTAF
IVLRKQPLIFLHWYHHITVMIYVFLSFHEHSAPGHYFYVINYGVHAIMYT
YYSLKSLRIPMPKFVPIIVTSIQLSQMVVGSIILSYVYALKLRGDTCQIT
DRLLYMGLAMYLSYFVLFAHYFYNAYFKGKYWSRARAESVSKSAHLNGLV
NGVSANGIKHSNGVLTNGKKRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002076ELO_fam
IPR030457ELO_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0006633fatty acid biosynthetic process
GO:0019367fatty acid elongation, saturated fatty acid
GO:0042761very long-chain fatty acid biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0009922fatty acid elongase activity
GO:0016740transferase activity
GO:01023363-oxo-arachidoyl-CoA synthase activity
GO:01023373-oxo-cerotoyl-CoA synthase activity
GO:01023383-oxo-lignoceronyl-CoA synthase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002076ELO familyPFAMPF01151ELOcoord: 48..280
e-value: 8.4E-59
score: 199.1
IPR002076ELO familyPANTHERPTHR11157FATTY ACID ACYL TRANSFERASE-RELATEDcoord: 45..280
NoneNo IPR availablePANTHERPTHR11157:SF17ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEINcoord: 45..280
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 158..177
NoneNo IPR availableTMHMMTMhelixcoord: 51..68
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
IPR030457ELO family, conserved sitePROSITEPS01188ELOcoord: 158..166